fȎfffsffJf1fffrCffg&C> FreeBSD BOOT @ 0x%x: %d/%d k of memory, %s%s console Boot default: %d:%s(%d,%c)%s %s boot: Can't find %s UWVS}1S|4CF~j@6jD6<6 = } hhh hh h=t4hh h|h-t h uPaP54P|tPtP5D65@6hh |%|0th. u j h|h.T=-ƅt5h>Invalid format! Booting %d:%s(%d,%c)%s @ 0x%x Start address too low text=0x%x data=0x%x bss=0x%x symbols=[+0x%x+0x%x+0x%x+0x%x+0x%x] .configtotal=0x%x entry point=0x%x U(WVSj EPMэvI tot9Ȇ%=t$=t= t=th>]iU= t!1=tІf= t }}W5aP54PhOhnuhuuuut FuuhuVQuuhjuVu t )߉މ5H6jVEPujShuV u$j]S%jVSNE܃E܃Pjh uV u܉5L6  Ћ Ћ ЉÁ6= 6686H*ABuJABuhh(h*Zhhh(kuVh $h6S| Pue[^_Can't find file %s UVSE] ut~5h VS D3e[^No keyboard found Keyboard found UVSMu A< t< t<-umA< t< t 1023 (BIOS limit) Error: D:0x%x C:%d H:%d S:%d UWVSE9`\uU 9h\ 9d\E =\8Ɓ~ VhKE =\8Ӊؙ=X8EE =X8׋X8)~=h`8SWuVu t@h`8SWuVutWuVuhlXʋE`\U h\Ӊd\E +h\ `8e[^_UWVS=P8 t9MT89EE)ȉ158׉Éމ15,f}15,f]ffE1ۿP6 fTfUf9t v~fEf9D tC}~у~t/=t   <Q,؉)Ee[^_UWVS}u ~,Shp\SWhp\E)߃ԍe[^_U WVS} 5x#8}NPU B9wu9 r^08# @#^L]u1Ndt}u9] |SRu| /+]9] }] uRhp^SuUpRz])] ډ} ~ 9u 9 e[^_%s U WVSEE8?u xuExUr0M׉ËÉEQ!ӉAUQUyxNjY`}EUZdtPhplhh xyxpPsUu /u EM9/t= u =tnfff@u[EEUt}/tEM MuE1UM9]ru M9 w}1x#8[P]M -C‰UM M9Mwu E9 r xR0 x8# @#QLUuSxJdtRhp pS׃p}tSRh|pSRupUUM j Ce[^_UWVSu  ,JxJd\t9ptr0Shp+pVЋ=xtpe[^_Unknown device UVSހ;t;(tC;u;ul\~:u< w l\C9tH=MM8u@8Ft:u:-< w ƒУCtq<,uC;tg<w ƒC;tLC<)t;u;t;l\ƒЄut"t u h_uh tPxp|hp|St|1e[^@@7  |/-\ 08@ L4@ W   @ L4#tQ@ @ Zv/mntR"<T 08@ L4@ W   @ L4#tQ@ @ Z)<TU L4@ v I , hQj߇zAL4L4L4?sA" L4L4L408UQ@yL4L4L4 (=pm!L4L4L4rP!L4L4L4Az!L4L4L4Š`!L4L4L4τI!L4L4L4{F)!L4L4L4Ӆ!L4L4L4Se!L4L4L4 ǎg4!L4L4L4h!L4L4L4OqL!L4L4L4!L4L4L4FiY!L4L4L4,n.L!L4L4L4 ]!L4L4L4 Z&\!L4L4L4NarYBmAL4L4L4!L4L4L4\!L4L4L4}9$!L4L4L4ox!L4L4L47%!L4L4L4/@Y!L4L4L4 n!L4L4L4F3!L4L4L4`R!L4L4L41?!L4L4L4 U4!L4L4L4 w5&M!L4L4L4 C!L4L4L4 ,!L4L4L4 :!L4L4L4|!L4L4L4a!L4L4L4m5@!L4L4L4ML]!L4L4L4>+*!L4L4L4}P!L4L4L4[|d!L4L4L4l^!L4L4L48!L4L4L40!L4L4L4zl}!L4L4L4!L4L4L4;-}!L4L4L4WwZ!L4L4L4)Co!L4L4L4y?!L4L4L4^"ea!L4L4L4!L4L4L4 jd!L4L4L4!͚/q!L4L4L4".K'!L4L4L4#=!L4L4L4$_!L4L4L4%E!L4L4L4&& !L4L4L4'cڹ!L4L4L4(1z!L4L4L4)1]!L4L4L4*b!L4L4L4+ټH!L4L4L4,!L4L4L4-:lv!L4L4L4.e.!L4L4L4/+4۹e!L4L4L4?~ aL4L4L4~e4!L4L4L4L aL4L4L4zG!L4L4L4; aL4L4L4(R!L4L4L4YWaL4L4L4z3!L4L4L4X;LaL4L4L4:S5!L4L4L48aL4L4L40L!L4L4L4 MaL4L4L4s !L4L4L4NaL4L4L4MI%!L4L4L4`aL4L4L45ry!L4L4L4uWNaL4L4L4lܣ!L4L4L4y_aL4L4L4PQ0!L4L4L4ыaL4L4L4\\ !L4L4L4H$aL4L4L4Nvg!L4L4L4laL4L4L4  !L4L4L4 D aL4L4L4a/!L4L4L4_naL4L4L4 /!L4L4L4 &daL4L4L4 K{!L4L4L4 "g_aL4L4L4 Gx!L4L4L4 scNaL4L4L4 G|;7!L4L4L4 ",aL4L4L4 !L4L4L4 AlaL4L4L4A>B!L4L4L4gaL4L4L4;N9!L4L4L4ZOaL4L4L4 6!L4L4L4 7^aL4L4L4 M0!L4L4L4 x/aL4L4L4 ,!L4L4L4 >IaL4L4L4 l2!L4L4L4 c@]aL4L4L4J!L4L4L4ȑ=aL4L4L4F-!L4L4L4։2aL4L4L4_*!L4L4L4L aL4L4L40@!L4L4L4SYaL4L4L4(&z!L4L4L4H%WaL4L4L4=>!L4L4L4F!vaL4L4L4G67!L4L4L4K6aL4L4L4hD!L4L4L46qnaL4L4L4mb!L4L4L4m_aL4L4L4Z!L4L4L4 D%aL4L4L4zS\G!L4L4L4|aL4L4L4I:u!L4L4L44c}aL4L4L4r!L4L4L4i%aL4L4L4&,!L4L4L4`aL4L4L4Mo!L4L4L4b_aL4L4L4^|!L4L4L49aL4L4L4W\F!L4L4L43~aL4L4L4l!L4L4L4bGaL4L4L4/nE !L4L4L4&,aL4L4L4@!!L4L4L4)kaL4L4L4 L!L4L4L4LD_aL4L4L4npz!L4L4L4;aL4L4L4!L4L4L4%p>aL4L4L4-XL*!L4L4L4waL4L4L4F!L4L4L4aL4L4L4yA!L4L4L4Mea L4L4L4h! L4L4L4 |aL4L4L4%c!L4L4L4  aL4L4L4VR8!L4L4L4 aL4L4L4}'+!L4L4L4 f'aL4L4L4M;o!L4L4L4 'aL4L4L4u[a!L4L4L4 aL4L4L4&!L4L4L4 MaL4L4L4S@T!L4L4L4 01aL4L4L4z!L4L4L4 bua L4L4L4@65! L4L4L4@ yaL4L4L4A}T!L4L4L4A = 0aL4L4L4BޤS;!L4L4L4B XTjaL4L4L4Cȭn!L4L4L4C eaL4L4L4DRb!L4L4L4D m- aL4L4L4Ej!L4L4L4E [aL4L4L4Fr!L4L4L4F QaL4L4L4GK!L4L4L4G uUaL4L4L4Hn?!L4L4L4H pdcJaL4L4L4e!L4L4L4 1f:aL4L4L4oq!L4L4L4 XQUaL4L4L4Yb!L4L4L4 ~$SaL4L4L4.b!L4L4L4 GE aL4L4L4$!!L4L4L4 'Do6aL4L4L45v:!L4L4L4 aL4L4L4¦+!L4L4L4 paL4L4L4gq!L4L4L4 >VaL4L4L4 !L4L4L4 DVa L4 L4L4 k! L4 L4L4 ga L4 L4L4Me<! L4 L4L4 w[Ma L4 L4L4M4! L4 L4L4 9}'a L4 L4L4`L! L4 L4L4 ]B! L4 L4L4 Χ*a L4 L4L4 _! L4 L4L4  da L4 L4L4=9! L4 L4L4 [e)a L4 L4L4 ՖJ! L4 L4L4 )Nta L4 L4L4 k.! L4 L4L4 .a L4 L4L4 V! L4 L4L4 Rna L4 L4L4 ! L4 L4L4 Z9_a L4 L4L4 w! L4 L4L4 =c8a L4 L4L4!oc! L4 L4L4 o+a L4 L4L4 vd! L4 L4L4 *v a L4 L4L4 xF! L4 L4L4 ;`*ea L4 L4L4 "*! L4 L4L4 a L4 L4L4 {3P! L4 L4L4 #ɜ9a L4 L4L4  Z! L4 L4L4 FA! L4 L4L4 Ua L4 L4L4@! L4 L4L4 ja L4 L4L4QYd! L4 L4L4 5f+a L4 L4L4NI! L4 L4L4 ]Ia L4 L4L4ƣe! L4 L4L4 Z^ra L4 L4L4I! L4 L4L4 Ya L4 L4L4! L4 L4L4 24a L4 L4L4%0! L4 L4L4 g|a L4 L4L44I6! L4 L4L4 ~a L4 L4L4F ! L4 L4L4 na L4 L4L4g*! L4 L4L4 WN7a L4 L4L4ES! L4 L4L4 ^5a L4 L4L40~! L4 L4L4 p8a L4 L4L4x_! L4 L4L4 f! L4 L4L4 }a L4 L4L4}! L4 L4L4 ua L4 L4L4/2&! L4 L4L4 boa L4 L4L4v! L4 L4L4 Daa L4 L4L48T! L4 L4L4 ~"a L4 L4L4C3Z! L4 L4L4 :a L4 L4L4!T! L4 L4L4 Ma L4 L4L4<52! L4 L4L4 OCba L4 L4L4a.[! L4 L4L4 gfa L4 L4L4s! L4 L4L4 ǖWa L4 L4L4q0! L4 L4L4 `#a L4 L4L4Yuc! L4 L4L4 SȀ a L4 L4L4IN! L4 L4L4 a L4 L4L42j^! L4 L4L4 J! L4 L4L4 ~a L4 L4L4Ll6a L4 L4L4Tc! L4 L4L44! L4 L4L45! L4 L4L4 Z-}a L4 L4L4w*a L4 L4L4c F! L4 L4L4fl! L4 L4L4d!a L4 L4L4 Va L4 L4L4T@! L4 L4L4-g ^D! L4 L4L4-0a L4 L4L4S^a L4 L4L4./L! L4 L4L4. ~! L4 L4L4.9:a L4 L4L4|.a L4 L4L4;Y! L4 L4L4.6Sw! L4 L4L4.Aa L4 L4L4y0! L4 L4L4Etfa L4 L4L4s2e! L4 L4L4EQ7Ha L4 L4L4.! L4 L4L4Fm{3a L4 L4L4 /! L4 L4L4FK~a L4 L4L4"#7! L4 L4L4F}wHa L4 L4L4C! L4 L4L4Fvwa L4 L4L4n|! L4 L4L4Fw[5a L4 L4L4I! L4 L4L4F'a L4 L4L4ژh{! L4 L4L4F}a L4 L4L4{u/I! L4 L4L4F'Ra L4 L4L4xGE! L4 L4L4Fႍ a L4 L4L4g]a L4 L4L4 uY#! L4 L4L4F?Za L4 L4L4$'! L4 L4L4F4a L4 L4L45 ! L4 L4L4FbZa L4 L4L4:,! L4 L4L4FxK! L4 L4L4F Q5 ! L4 L4L4 $0?@! L4 L4L4 V:0! L4 L4L4 }! L4 L4L4 ^_! L4 L4L4 “c! L4 L4L4 pN! L4 L4L4 ^! L4 L4L4 w! L4 L4L4$ ! L4 L4L4!s! L4 L4L4-5! L4 L4L4V]! L4 L4L4(! L4 L4L4wM! L4 L4L4*<:! L4 L4L4qV$! L4 L4L4n(R! L4 L4L4! L4 L4L4 (~v! L4 L4L4 -J! L4 L4L4 4! L4 L4L4 Vy! L4 L4L4 ZF;! L4 L4L4k! L4 L4L4@z! L4 L4L4 .p! L4 L4L4u! L4 L4L4 "U! L4 L4L4@h! L4 L4L4T@! L4 L4L4!W`! L4 L4L4A\! L4 L4L4eUp! L4 L4L4"]! L4 L4L4Bsl<! L4 L4L4 T! L4 L4L4#_N! L4 L4L4Ck|! L4 L4L4nBD! L4 L4L4dBD! L4 L4L4hBD! L4 L4L4{$BD! L4 L4L4 JxBD! L4 L4L4XU6BD! L4 L4L4UrBD! L4 L4L4G+3BD! L4 L4L4R[BD! L4 L4L4.~DBD! L4 L4L4o;7BD! L4 L4L4QBD! L4 L4L4N[! L4 L4L4-H! L4 L4L4 iK! L4 L4L4l3! L4 L4L44! L4 L4L4K5)F! L4 L4L4rN! L4 L4L4)! L4 L4L4YK! L4 L4L4(3,#! L4 L4L4- i! L4 L4L4-{! L4 L4L4H! L4 L4L4pjL4jL4L4@HPX`hpxC8m L4 L4L4 XlAL4L4L4\thAL4L4L4 `cA L4L4L4 % L4 L4L4@j L4 L4L4 ~ L4 L4L4  ( 0 8 @ H P X PW" L4 L4L4` 7OAL4L4L4 ?^f<AL4L4L4 ,JAL4L4L4 gVAL4L4L4 r DAL4L4L4  AL4L4L4 W )AL4L4L4 {AAL4L4L4h fFA L4L4L4i 8$e L4 L4L4p j 9HA L4L4L4n k{>$ L4 L4L4x 7q$ L4 L4L4o TD'L4L4L4boot1EL4L4L4boot20 L4L4L4boot1"L4L4L4boot2Rz&L4L4L4boot1`kL4L4L4boot2%mL4L4L4boot1qiL4L4L4boot2[ L4 L4L4 9VtUJ"( t8obN)y5~4xuK]TYaT!o4-aUd]x$])w^($ &ΓbC 95)N?~sWSd %)kAx6HHr1)ܺ8D(6Z3SUF\S 8$~+-wksY6YJYPB6k)tULOPUjW"+TxhUhF(r̰z'h 3c |AV|?f:(b12l5-hOq˕\|&E#ю#!mRr< *YzF< g1NKf\E}6%4pRUNV e;>DE<-kQ.v39n'a,ttۓJdM*FxtJ$g{#w&"bPv1RjY,eyE80+{O3a}e0# 2Ob{#5 04M?/VQ$8W{6b@ec*>u0/pO,Nkus"7rqrME:#\ms;(t)z8 FP/hj*-QjQGk%Gj% {aeqv4vVfq[gfMEnE o|U6e[*K:)Q<'=DjE.,` 1!E<}5/OJ5GZM7~mMC*uO2F i u@AN[ku i9Gl$CSW/:S @me. ҧvA=HϳS&mxR(oMH$ t%}TLdo&4s]S$jKBd~?ES79E[C!c}#QQ >j; =(rU [Ҁl7a+0W1.R)n>!%Rd- 4)4xiu]OC k,F19W.ĘJZ _f5%. v:mt Ɠu)y2:4aEOkBA_qF9+MJlPJZ;iG>M~S_pE|p7(12.b%#" 1b޺Q,V(>F8˧R9WOBII7_Uxi6J v^x}d61UJe:f.>H:$Ƴ`oXQĪ[v3l3uL~_IO+PMB5xiz,"O(l K@^ @bq/)4qj,kj;}9t c lIIs ;eAm'{'Z*HMQ wG,Tg{n\&Gk)cU !8? %w9lx`K hnqQL gq7o Z͵<QyYNr of@zi!kV;E/ 7{gqVy dgYŪerm|R:m A_c3 "S_gng{b1ޚ{XU/vn/7Rx#8"<cx:1]OCZ&iX n'L5ap.*V4)%ܷFU(X |vQjZga̘syJ|HM~?:|' tTnj^shxMy @+64q>Qf0A-A&jQ/= |\K qӔ34=^[jL\>{RhFT=DutVwA=U ^")}bxQQL"qs}Vcc]Mh%R$_sR!-T2$+[CYf; 0D 6[:BzC^ - -9Mr_Vvu4 (btU×#^0!iv'(׎,zV$V9%wR&?B9x-OEycB.quf`sLI/.LEF:V_Yf @#n  m\k&.g=\S:i >Vɱ)ь~EB%x2wzPy~Q dum4nU w~]s l+4%~b 6U R \(RY 4L_B\T WJkWMoe:4oWtIwht0TevUl-/uqwuyvɈJIVztt^d\\C [(>_,n Zg;xd~[rzfXEOgJKT '~j?hPL"e%\9RJ"6I5SNe TAv0vJTl;?}3sTF|G_"8Y}D -K" !\fy3`fw* 5&+1Ov"b]kE8{2+v+8NI?,l i?_3x6^"p ;S|uv$ ?TK] j`@pLk`AvtQbX<,|'<+D >Cc2pVϼTkQ. 2:Qq<ݕ"D +G1i G gX$+gMe;PiR7|& A11$}@e^&JP}Kg]02CB~l݈Up:GpR('04v+4@(yV$[ W6Yk lږ6l$F^B#mP$c{ ĈW)+ tMX~j=,qM>B>KT<;H\*;oub17QT 6r;Xhsa'PQ+Oj/>Xw\Dt}zqţ`qNilg>8gZ56:=D6Db,/ftU4Dky0X\7V @k"'yR|x@*XN1/+3A }n2$#A*Uft_#i^N@SzP ?"<twMo|Dw !.LO3#:"IS^hlSp8 :6?ZN)u[%:C2dltw5F|ŝYl%J-fee&'bpvq`"1$xbj ~#JIL0 |Brz( 3ZbkCB hGgЋM Tl>=BkԎV=KkU8&c[+.C>8x1R9 C"X7X7xm &(Q n@w/WH>}wtʕ"}W)l`ЙAV7MQm jn;ٱ<_]2kZ 5IVX! [?WSW4Y IWf[y0D@I@ W~E?ϗ-kU_-OgCL60CeROmIS#6(n9+D"` p&7[L THӥFPi/SdA"1O)u7 VXrx1<R2S~<crNNi/ѱk]|A*H-{o"Rt&Xc ȡ#K1wBmLghPY%\{.cU|:x@P=c#x$W'-$V*)4>d72eS7*{Nҕ?A<|M-bs; {'#)skeiZj#:1S0RPt ` 蚬/(M*jQ?1E$Oxi#F&o6qZXT 1lߺ+#xrJ))RGw,Y8_ޑ}5},3}:}RzzV^"!+]h{RWiwIZ_":{V%q3~3|yjohbfhu\mU @ʡH+Pl?ZF~E"xk:,u0m._NyPj`'27 H4T@4*jkBIDyBSTGڽ#g, ;7hX b[" ֭<]bwuUD%O:qXZ\w [kqFN Wf?H|ju6_.3{4;njwP8PTAF 7'ybdXs{aT`'ݶ4(,,.$m &Gd&rYޗ!Gc|\kJh1_@0hr(U\c d6|Cj _6Q.Gz{5 Y [J=h_!JtLSvxM"!Sahvrvn0cvn0drvn0dvn0ervn0evn0frvn0fvn0grvn0gvn0hrvn0hvn0s1 rvn0s1!vn0s2"rvn0s2#vn0s3$rvn0s3%vn0s4&rvn0s4' apm(card0)card1solectl ;; snp?) unit=`expr $i : 'snp\(.*\)'` rm -f snp$unit mknod snp$unit c 53 $unit chown root.wheel snp$unit ;; # Valid arguments to isdn: # none makes all the node but nic0 # 5000 makes nic0 for Niccy 5000 # 3008 makes nic0 for Niccy 3008 # 3009 makes nic0 for Niccy 3009 # 1000 makes nodes for Niccy 1000 # tel* makes nodes for TELES S0 # isdn*) type=`expr $i : 'isdn\(.*\)'` if [ "X${type}" = "X" ]; then type=none fi unit=54 rm -f nic0 snic0 n?ic0 isdn isdn? ity?? itel?? ispy mknod n8ic0 c $unit 0 mknod snic0 c `expr $unit + 4` 0 mknod n9ic0 c `expr $unit + 6` 0 mknod isdn c `expr $unit + 1` 0 mknod isdn1 c `expr $unit + 1` 1 mknod isdn2 c `expr $unit + 1` 2 mknod ity00 c `expr $unit + 2` 0 mknod ity01 c `expr $unit + 2` 1 mknod ityo0 c `expr $unit + 2` 130 mknod ityo1 c `expr $unit + 2` 131 mknod itel00 c `expr $unit + 3` 0 mknod itel01 c `expr $unit + 3` 1 mknod ispy c `expr $unit + 5` 0 chown root.wheel n8ic0 n9ic0 snic0 isdn isdn? ity?? itel?? ispy chown uucp.wheel ityo[01] case $type in 5000) ln snic0 nic0 chown root.wheel nic0 ;; 3008) ln n8ic0 nic0 chown root.wheel nic0 ;; 3009) ln n9ic0 nic0 chown root.wheel nic0 ;; 1000|tel*|TEL*|none) ;; *) echo "No such ISDN device subtype: $type" ;; esac ;; # dufault@hda.com: If I do much more work on other A-D boards # then eventually we'll have a "ad" and "dio" interface and some of these # "labpcaio" ones will be gone. # labpcaio: D-A and A-D. # labpcdio: Digital in and Digital out. # labpc*) umask 7 case $i in labpcaio*) name=labpcaio unit=`expr $i : 'labpcaio\(.*\)'` all="0 1 2 3 4 5 6 7" offset=0 ;; labpcdio*) name=labpcdio unit=`expr $i : 'labpcdio\(.*\)'` all="0 1 2 3" offset=8 ;; *) echo "Don't understand that labpc name" exit ;; esac if [ "X${unit}" = "X" ]; then unit=all fi case $unit in 0|1|2|3|4|5|6|7) rm -f $name$unit mknod $name$unit c 66 `expr $offset + $unit ` ;; all) for i in $all do rm -f $name$i mknod $name$i c 66 `expr $offset + $i ` done ;; *) echo "No such LabPC unit: $unit" ;; esac umask 77 ;; perfmon) rm -f perfmon mknod perfmon c 2 32 chown root.kmem perfmon chmod 640 perfmon ;; local) umask 0 # XXX should be elsewhere sh MAKEDEV.local umask 77 ;; *) echo $i - no such device name ;; esac done - ... . .. dev*stand- bin.sbin/ etc4 mnt5mnt16mnt27mnt38mnt49 tmp: usrI@.profile$ . .. 0 1 2 3 4 5 6 7 8 9 10! 11" 12# 13$ 14% 15& 16' 17( 18) 19* 20+ 21, 22- 23. 24/ 250 261 272 283 294 305 316 327 338 349 35: 36; 37< 38=39> 40? 41@ 42A 43B 44C 45D 46E 47F 48G 49H 50I 51J 52K 53L 54M 55N 56O 57P 58Q 59R 60S 61T 62U63* . ..+ fixit_crunch+ cat+chmod+chroot+ cp+date+ dd+ df+echo+ ed+expr+hostname$+kill+ ln+ ls+mkdir+ mt+ mv+ pwd+ rcp+ rm+rmdir+sleep+stty+sync+test+ [+badsect+chown+clri+ disklabel+dump+ ft+dmesg+fdisk+mknod+mount+newfs+ping+reboot+restore+scsi+swapon+umount+ mount_msdos+ mount_cd9660+ mount_nfs+rdump+rrestore$+ mount_mfs+chgrp+ ftp+more+ rsh+ sed+telnet+rlogin+ vi+find+grep+view+ ex,,tar# # Internet (IP) protocols # # $Id: protocols,v 1.7 1997/10/03 01:32:41 itojun Exp $ # from: @(#)protocols 5.1 (Berkeley) 4/17/89 # # Updated for FreeBSD based on RFC 1340, Assigned Numbers (July 1992). # ip 0 IP # internet protocol, pseudo protocol number icmp 1 ICMP # internet control message protocol igmp 2 IGMP # Internet Group Management ggp 3 GGP # gateway-gateway protocol ipencap 4 IP-ENCAP # IP encapsulated in IP (officially ``IP'') st 5 ST # ST datagram mode tcp 6 TCP # transmission control protocol egp 8 EGP # exterior gateway protocol pup 12 PUP # PARC universal packet protocol udp 17 UDP # user datagram protocol hmp 20 HMP # host monitoring protocol xns-idp 22 XNS-IDP # Xerox NS IDP rdp 27 RDP # "reliable datagram" protocol iso-tp4 29 ISO-TP4 # ISO Transport Protocol class 4 xtp 36 XTP # Xpress Tranfer Protocol idpr-cmtp 39 IDPR-CMTP # IDPR Control Message Transport ip6 41 IPV6 # internet protocol version 6 rsvp 46 RSVP # Resource ReSerVation Protocol icmp6 58 ICMPV6 # ICMP for IPv6 vmtp 81 VMTP # Versatile Message Transport ospf 89 OSPFIGP # Open Shortest Path First IGP ipip 94 IPIP # Yet Another IP encapsulation encap 98 ENCAP # Yet Another IP encapsulation divert 254 DIVERT # Divert pseudo-protocol #!/bin/sh - # # Copyright (c) 1990 The Regents of the University of California. # All rights reserved. # # Written and contributed by W. Jolitz 12/90 # # Redistribution and use in source and binary forms are permitted provided # that: (1) source distributions retain this entire copyright notice and # comment, and (2) distributions including binaries display the following # acknowledgement: ``This product includes software developed by the # University of California, Berkeley and its contributors'' in the # documentation or other materials provided with the distribution and in # all advertising materials mentioning features or use of this software. # Neither the name of the University nor the names of its contributors may # be used to endorse or promote products derived from this software without # specific prior written permission. # THIS SOFTWARE IS PROVIDED ``AS IS'' AND WITHOUT ANY EXPRESS OR IMPLIED # WARRANTIES, INCLUDING, WITHOUT LIMITATION, THE IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. # # @(#)MAKEDEV 5.2 (Berkeley) 6/22/90 # # Device "make" file. Valid arguments: # all makes all known devices, standard number of units (or close) # std standard devices # local configuration specific devices # mach-4 mach4&lites+devices for Mach's XFree86 distribution # (see http://www.cs.hut.fi/lites.html for more info on LITES) # # Tapes: # wt* QIC-interfaced (e.g. not SCSI) 3M cartridge tape # st* "NEW type scsi tapes" (old driver uses the # block devices of the disks to get access) # ft* QIC-40/QIC-80 3M cartridge tape (interfaced # via the floppy disk controller) # # Disks: # wd* "Winchester" disk drives (ST506,IDE,ESDI,RLL,...) # fd* "floppy" disk drives (3 1/2", 5 1/4") # sd* "SCSI disks" # cd* "SCSI CD-ROM disks" # mcd* "Mitsumi CD-ROM disks" # scd* "Sony CD-ROM disks" # matcd* "Matsushita (Panasonic) CD-ROM disks" # wcd* "IDE CD-ROM disks" # vn* "vnode disks" # od* "optical disks" # # Console ports: # vty* virtual console devices for syscons/pcvt/codrv # # Pointing devices: # mse* Logitech and ATI Inport bus mouse # psm* PS/2 mouse # sysmouse Mousesystems mouse emulator for syscons # # Time devices: # refclock-* serial ports used by xntpd parse refclocks # # Terminal ports: # tty* general purpose serial ports # cua* dialout serial ports # ttyA* Specialix SI/XIO dialin ports ('*' = number of devices) # cuaA* Specialix SI/XIO dialout ports # ttyD* Digiboard - 16 dialin ports # cuaD* Digiboard - 16 dialout ports # # Pseudo terminals: # pty* set of 32 master and slave pseudo terminals # vty* virtual terminals using syscons/pcvt/codrv console # # Printers: # lpt* stock lp # # SCSI devices (other than CD-ROM, tape and disk): # uk* "unknown" device (supports ioctl calls only) # worm* WORM driver # pt* Processor Type (HP scanner, as one example) # # PC-CARD (previously called PCMCIA) support # card* PC-CARD slots # # Special purpose devices: # apm Advanced Power Management BIOS # bpf* packet filter # speaker pc speaker # tw* xten power controller # snd* various sound cards # pcaudio PCM audio driver # socksys iBCS2 socket system driver # vat VAT compatibility audio driver (requires snd*) # gsc Genius GS-4500 hand scanner # joy pc joystick # tun* Tunneling IP device # snp* tty snoop devices # spigot Video Spigot video acquisition card # ctx* Cortex-I video acquisition card # meteor* Matrox Meteor video acquisition card (pci) # bktr* Bt848 based video acquisition card (pci) # qcam* Connectix QuickCam(tm) parallel port camera # isdn* ISDN devices # labpc* National Instrument's Lab-PC and LAB-PC+ # perfmon CPU performance-monitoring counters # pci PCI configuration-space access from user mode # # $Id: MAKEDEV,v 1.127.2.11 1997/09/09 10:47:51 markm Exp $ # #PATH=/sbin:/bin/:/usr/bin:/usr/sbin:$PATH umask 77 # Convert integer to partition name dkitop() { local p case $1 in 0) p=a;; 1) p=b;; 2) p=c;; 3) p=d;; 4) p=e;; 5) p=f;; 6) p=g;; 7) p=h;; *) p="?";; esac echo $p } # Convert integer to slice name dkitos() { local s case $1 in 0) s="";; 1) s="";; *) s=s$(($1-1));; esac echo $s } # Convert disk (type, unit, slice, partition) to minor number dkminor() { echo $(($1 << 25 | ($2 / 32) << 21 | ($2 % 32) << 3 | $3 << 16 | $4)) } # Convert the last character of a tty name to a minor number. ttyminor() { case $unit in [0-9]) m=$unit;; a) m=10;; b) m=11;; c) m=12;; d) m=13;; e) m=14;; f) m=15;; g) m=16;; h) m=17;; i) m=18;; j) m=19;; k) m=20;; l) m=21;; m) m=22;; n) m=23;; o) m=24;; p) m=25;; q) m=26;; r) m=27;; s) m=28;; t) m=29;; u) m=30;; v) m=31;; *) m="?";; esac echo $m } # Raw partition for disks dkrawpart=2 # Compatibility slice for disks dkcompatslice=0 # Raw slice for disks dkrawslice=1 # Control bit for SCSI scsictl=$((1 << 29)) # Standard umasks disk_umask=037 # allow group operator to read disks tape_umask=017 # allow group operator to read/write tapes for i do case $i in all) sh MAKEDEV std # standard sh MAKEDEV wd0 wd1 wd2 wd3 fd0 fd1 sd0 sd1 sd2 sd3 # bdev, disk sh MAKEDEV cd0 mcd0 scd0 matcd0 wcd0 # bdev, cdrom sh MAKEDEV od0 # bdev, ODD sh MAKEDEV ft0 wt0 st0 # bdev, tape sh MAKEDEV ttyd0 ttyd1 ttyd2 ttyd3 # cdev, serial sh MAKEDEV cuaa0 cuaa1 cuaa2 cuaa3 # cdev, serial sh MAKEDEV lpt0 lpt1 lpt2 # cdev, printer sh MAKEDEV pty0 ch0 tw0 bpf0 # cdev sh MAKEDEV perfmon speaker pcaudio psm0 mse0 sysmouse # cdev sh MAKEDEV vty4 # cdev sh MAKEDEV tun0 # cdev sh MAKEDEV vn0 # cdev sh MAKEDEV apm card0 card1 # cdev, laptop ;; std) rm -f console drum mem kmem null random urandom zero io tty klog rm -f stdin stdout stderr lkm pci mknod console c 0 0; chmod 600 console; chown root.wheel console mknod drum c 4 0; chmod 640 drum; chown root.kmem drum mknod kmem c 2 1; chmod 640 kmem; chown root.kmem kmem mknod mem c 2 0; chmod 640 mem; chown root.kmem mem mknod null c 2 2; chmod 666 null; chown root.wheel null mknod random c 2 3; chmod 644 random; chown root.wheel random mknod urandom c 2 4; chmod 644 urandom; chown root.wheel urandom mknod zero c 2 12; chmod 666 zero; chown root.wheel zero mknod io c 2 14; chmod 600 io; chown root.wheel io mknod tty c 1 0; chmod 666 tty; chown root.wheel tty mknod klog c 7 0; chmod 600 klog; chown root.wheel klog mknod stdin c 22 0; chmod 666 stdin; chown root.wheel stdin mknod stdout c 22 1; chmod 666 stdout; chown root.wheel stdout mknod stderr c 22 2; chmod 666 stderr; chown root.wheel stderr mknod lkm c 32 0; chmod 644 lkm; chown root.wheel lkm mknod pci c 78 0; chmod 644 pci; chown root.wheel pci rm -f fd/* mkdir fd > null 2>&1 (cd fd && eval `echo "" | awk ' BEGIN { \ for (i = 0; i < 64; i++) \ printf("mknod %d c 22 %d;", i, i)}'`) chown -R bin.bin fd chmod 555 fd chmod 666 fd/* ;; mach-4) mknod iopl c 22 0 mknod kbd c 23 0 mknod mouse c 24 0 mknod time c 25 0 mknod timezone c 26 0 ;; # Create device files for new Archive/Wangtek QIC-02 tape driver (vak) wt*) umask $tape_umask u=`expr $i : '..\(.*\)'` if [ x$u = x ]; then u=0; fi rm -f r[Ww]t$u nr[Ww]t$u r[Ww]t$u[a-f] nr[Ww]t$u[a-f] mknod rwt${u} c 10 `expr 0 + $u` # default density, 512b blocks mknod nrwt${u} c 10 `expr 4 + $u` # mknod rWt${u} c 10 `expr 64 + $u` # default density, 1024b blocks # mknod nrWt${u} c 10 `expr 68 + $u` mknod rwt${u}b c 10 `expr 16 + $u` # 60 megabytes mknod nrwt${u}b c 10 `expr 20 + $u` mknod rwt${u}c c 10 `expr 24 + $u` # 120 megabytes mknod nrwt${u}c c 10 `expr 28 + $u` mknod rwt${u}d c 10 `expr 32 + $u` # 150 megabytes mknod nrwt${u}d c 10 `expr 36 + $u` # mknod rwt${u}e c 10 `expr 40 + $u` # 300 megabytes? # mknod nrwt${u}e c 10 `expr 44 + $u` # mknod rwt${u}f c 10 `expr 48 + $u` # 600 megabytes? # mknod nrwt${u}f c 10 `expr 52 + $u` chown root.operator r[Ww]t$u nr[Ww]t$u r[Ww]t$u[a-f] nr[Ww]t$u[a-f] umask 77 ;; # Individual slices. od*s*|sd*s*|vn*s*|wd*s*) umask $disk_umask case $i in od*s*) name=od; blk=20; chr=70;; sd*s*) name=sd; blk=4; chr=13;; wd*s*) name=wd; blk=0; chr=3;; vn*s*) name=vn; blk=15; chr=43;; esac unit=`expr $i : '..\([0-9]*\)s'` slice=`expr $i : '..[0-9]*s\([0-9]*\)'` part=`expr $i : '..[0-9]*s[0-9]*\(.*\)'` case $unit in [0-9]|[0-9][0-9]|[0-4][0-9][0-9]|50[0-9]|51[0-1]) case $slice in [0-9]|[1-2][0-9]|30) oldslice=$slice slice=$(($slice+1)) slicename=`dkitos $slice` rm -f $name$unit$slicename* r$name$unit$slicename* minor=`dkminor 0 $unit $slice $dkrawpart` mknod $name$unit$slicename b $blk $minor mknod r$name$unit$slicename c $chr $minor case $part in [a-h]) case $oldslice in 0) slice=$oldslice ;; esac for part in 0 1 2 3 4 5 6 7 do minor=`dkminor 0 $unit $slice $part` partname=`dkitop $part` mknod $name$unit$slicename$partname \ b $blk $minor mknod r$name$unit$slicename$partname \ c $chr $minor done ;; "") ;; *) echo bad partition for disk in: $i ;; esac chgrp operator $name$unit$slicename* \ r$name$unit$slicename* ;; *) echo bad slice for disk in: $i ;; esac ;; *) echo bad unit for disk in: $i "(unit=$unit, slice=$slice, part=$part)" ;; esac umask 77 ;; fd*) umask $disk_umask unit=`expr $i : '..\(.*\)'` name=fd; blk=2; chr=9 rm -f $name$unit* r$name$unit* case $unit in 0|1|2|3) mknod ${name}${unit} b $blk `expr $unit '*' 64` mknod r${name}${unit} c $chr `expr $unit '*' 64` # Fake BSD partitions for i in a b c d e f g h do ln ${name}${unit} ${name}${unit}$i ln r${name}${unit} r${name}${unit}$i done # User-readable and programmer-readable name sets mknod ${name}${unit}.1720 b $blk `expr $unit '*' 64 + 1` mknod r${name}${unit}.1720 c $chr `expr $unit '*' 64 + 1` # ln ${name}${unit}.1720 ${name}${unit}135hs21 # ln r${name}${unit}.1720 r${name}${unit}135hs21 mknod ${name}${unit}.1480 b $blk `expr $unit '*' 64 + 2` mknod r${name}${unit}.1480 c $chr `expr $unit '*' 64 + 2` # ln ${name}${unit}.1480 ${name}${unit}135hs18 # ln r${name}${unit}.1480 r${name}${unit}135hs18 # ln ${name}${unit}.1480 ${name}${unit}96hs18 # ln r${name}${unit}.1480 r${name}${unit}96hs18 mknod ${name}${unit}.1440 b $blk `expr $unit '*' 64 + 3` mknod r${name}${unit}.1440 c $chr `expr $unit '*' 64 + 3` # ln ${name}${unit}.1440 ${name}${unit}135 # ln r${name}${unit}.1440 r${name}${unit}135 # ln ${name}${unit}.1440 ${name}${unit}135ds18 # ln r${name}${unit}.1440 r${name}${unit}135ds18 # ln ${name}${unit}.1440 ${name}${unit}96ds18 # ln r${name}${unit}.1440 r${name}${unit}96ds18 mknod ${name}${unit}.1200 b $blk `expr $unit '*' 64 + 4` mknod r${name}${unit}.1200 c $chr `expr $unit '*' 64 + 4` # ln ${name}${unit}.1200 ${name}${unit}96 # ln r${name}${unit}.1200 r${name}${unit}96 # ln ${name}${unit}.1200 ${name}${unit}96ds15 # ln r${name}${unit}.1200 r${name}${unit}96ds15 # ln ${name}${unit}.1200 ${name}${unit}135ds15 # ln r${name}${unit}.1200 r${name}${unit}135ds15 mknod ${name}${unit}.820 b $blk `expr $unit '*' 64 + 5` mknod r${name}${unit}.820 c $chr `expr $unit '*' 64 + 5` # ln ${name}${unit}.820 ${name}${unit}96hs10 # ln r${name}${unit}.820 r${name}${unit}96hs10 # ln ${name}${unit}.820 ${name}${unit}135hs10 # ln r${name}${unit}.820 r${name}${unit}135hs10 mknod ${name}${unit}.800 b $blk `expr $unit '*' 64 + 6` mknod r${name}${unit}.800 c $chr `expr $unit '*' 64 + 6` # ln ${name}${unit}.800 ${name}${unit}96ds10 # ln r${name}${unit}.800 r${name}${unit}96ds10 # ln ${name}${unit}.800 ${name}${unit}135ds10 # ln r${name}${unit}.800 r${name}${unit}135ds10 mknod ${name}${unit}.720 b $blk `expr $unit '*' 64 + 7` mknod r${name}${unit}.720 c $chr `expr $unit '*' 64 + 7` # ln ${name}${unit}.720 ${name}${unit}96ds9 # ln r${name}${unit}.720 r${name}${unit}96ds9 # ln ${name}${unit}.720 ${name}${unit}135ds9 # ln r${name}${unit}.720 r${name}${unit}135ds9 mknod ${name}${unit}.360 b $blk `expr $unit '*' 64 + 8` mknod r${name}${unit}.360 c $chr `expr $unit '*' 64 + 8` # ln ${name}${unit}.360 ${name}${unit}48 # ln r${name}${unit}.360 r${name}${unit}48 # ln ${name}${unit}.360 ${name}${unit}48ds9 # ln r${name}${unit}.360 r${name}${unit}48ds9 chgrp operator ${name}${unit}* r${name}${unit}* ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; ft*) umask $tape_umask unit=`expr $i : '..\(.*\)'` name=ft; blk=2; chr=9 rm -f $name$unit* r$name$unit* case $unit in 0|1|2|3) mknod ${name}${unit} b $blk `expr $unit '*' 64 + 32` mknod r${name}${unit} c $chr `expr $unit '*' 64 + 32` ln ${name}${unit} ${name}${unit}a ln r${name}${unit} r${name}${unit}a chgrp operator ${name}${unit}* r${name}${unit}* ;; *) echo bad unit for tape in: $i ;; esac umask 77 ;; od*|sd*|vn*|wd*) umask $disk_umask case $i in od*) name=od; blk=20; chr=70;; sd*) name=sd; blk=4; chr=13;; vn*) name=vn; blk=15; chr=43;; wd*) name=wd; blk=0; chr=3;; esac unit=`expr $i : '..\(.*\)'` case $unit in [0-9]|[0-9][0-9]|[0-4][0-9][0-9]|50[0-9]|51[0-1]) for slicepartname in s0h s1 s2 s3 s4 do sh MAKEDEV $name$unit$slicepartname done case $name in od|sd) rm -f r${name}${unit}.ctl minor=`dkminor 0 $unit 0 0` mknod r${name}${unit}.ctl c $chr $(($minor | $scsictl)) chmod 600 r${name}${unit}.ctl ;; esac ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; ccd*) umask 37 name=ccd blk=21; chr=74 unit=`expr $i : '...\(.*\)'` case $unit in [0-9]|[0-9][0-9]|[0-4][0-9][0-9]|50[0-9]|51[0-1]) rm -f r${name}${unit}.ctl minor=`dkminor 0 $unit 0 0` mknod r${name}${unit}.ctl c $chr $(($minor | $scsictl)) chmod 600 r${name}${unit}.ctl for part in 0 1 2 3 4 5 6 7 do minor=`dkminor 0 $unit 0 $part` partname=`dkitop $part` mknod $name$unit$partname \ b $blk $minor mknod r$name$unit$partname \ c $chr $minor done ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; uk*) unit=`expr $i : 'uk\(.*\)'` rm -f uk$unit mknod uk$unit c 31 $unit ;; worm*) umask $disk_umask unit=`expr $i : 'worm\(.*\)'` if [ "X${unit}" = "X" ]; then unit=0 fi chr=62 blk=23 name=worm rm -f ${name}${unit} mknod ${name}${unit} b $blk ${unit} rm -f r${name}${unit} mknod r${name}${unit} c $chr ${unit} chgrp operator ${name}${unit} r${name}${unit} umask 077 rm -f r${name}${unit}.ctl mknod r${name}${unit}.ctl c $chr `expr $unit + $scsictl ` ;; # SCSI processor type driver pt[0-9]*) chr=61 name=pt unit=`expr $i : 'pt\([0-9][0-9]*\)'` if [ "X${unit}" = "X" ]; then unit=0 fi unit=`expr $unit + 1 - 1` rm -f ${name}${unit} mknod ${name}${unit} c $chr $unit rm -f ${name}${unit}.ctl mknod ${name}${unit}.ctl c $chr `expr $unit + $scsictl ` ;; pty*) class=`expr $i : 'pty\(.*\)'` case $class in 0) offset=0 name=p;; 1) offset=32 name=q;; 2) offset=64 name=r;; 3) offset=96 name=s;; # Note that xterm (at least) only look at p-s. 4) offset=128 name=P;; 5) offset=160 name=Q;; 6) offset=192 name=R;; 7) offset=224 name=S;; # This still leaves [tuTU]. *) echo bad unit for pty in: $i;; esac case $class in 0|1|2|3|4|5|6|7) umask 0 eval `echo $offset $name | awk ' { b=$1; n=$2 } END { \ for (i = 0; i < 32; i++) { c = substr("0123456789abcdefghijklmnopqrstuv", i + 1, 1); \ printf("rm -f tty%s%s pty%s%s; \ mknod tty%s%s c 5 %d; \ mknod pty%s%s c 6 %d; \ chown root.wheel tty%s%s pty%s%s;", \ n, c, n, c, \ n, c, b+i, \ n, c, b+i, \ n, c, n, c); \ } \ }'` umask 77 ;; esac ;; st*) umask $tape_umask unit=`expr $i : '..\(.*\)'` chr=14 #remove old stype names rm -f [hml]rst[0123456] [hml][en]rst[0123456] [hml]enrst[0123456] #remove new style names rm -f rst${unit} [en]rst${unit} enrst${unit} rm -f rst${unit}.[0123] nrst${unit}.[0123]\ erst${unit}.[0123] st${unit}ctl.[0123] #remove control device case $unit in 0|1|2|3|4|5|6) for mode in 0 1 2 3 do mknod rst${unit}.${mode} c $chr `expr $unit '*' 16 + $mode '*' 4 + 0` mknod nrst${unit}.${mode} c $chr `expr $unit '*' 16 + $mode '*' 4 + 1` mknod erst${unit}.${mode} c $chr `expr $unit '*' 16 + $mode '*' 4 + 2` mknod st${unit}ctl.${mode} c $chr `expr $unit '*' 16 + $mode '*' 4 + 3` chgrp operator rst${unit}.${mode}\ nrst${unit}.${mode} \ erst${unit}.${mode} \ st${unit}ctl.${mode} chmod 600 st${unit}ctl.${mode} done rm -f rst${unit}.ctl mknod rst${unit}.ctl c $chr `expr $unit '*' 16 + $scsictl ` chmod 600 rst${unit}.ctl ln rst${unit}.0 rst${unit} ln nrst${unit}.0 nrst${unit} ln erst${unit}.0 erst${unit} ;; *) echo bad unit for tape in: $i ;; esac umask 77 ;; ch*) umask 37 unit=`expr $i : '..\(.*\)'` case $i in ch*) name=ch; chr=17;; esac rm -f $name$unit case $unit in 0|1|2|3|4|5|6) mknod ${name}${unit} c $chr `expr $unit '*' 16 + 0` chgrp operator ${name}${unit} rm -f r${name}${unit}.ctl mknod r${name}${unit}.ctl c $chr `expr $unit '*' 16 + $scsictl ` chmod 600 r${name}${unit}.ctl ;; *) echo bad unit for media changer in: $i ;; esac umask 77 ;; cd*|mcd*|scd*) umask $disk_umask case $i in cd*) unit=`expr $i : '..\(.*\)'`; name=cd; blk=6; chr=15;; mcd*) unit=`expr $i : '...\(.*\)'`; name=mcd; blk=7; chr=29;; scd*) unit=`expr $i : '...\(.*\)'`; name=scd; blk=16; chr=45;; esac rm -f $name$unit? r$name$unit? case $unit in 0|1|2|3|4|5|6) mknod ${name}${unit}a b $blk `expr $unit '*' 8 + 0` mknod ${name}${unit}c b $blk `expr $unit '*' 8 + 2` mknod r${name}${unit}a c $chr `expr $unit '*' 8 + 0` mknod r${name}${unit}c c $chr `expr $unit '*' 8 + 2` chgrp operator ${name}${unit}[a-h] r${name}${unit}[a-h] case $name in cd) rm -f r${name}${unit}.ctl mknod r${name}${unit}.ctl c $chr `expr $unit '*' 8 + $scsictl ` chmod 600 r${name}${unit}.ctl ;; esac ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; matcd*) umask 2 case $i in matcd*) unit=`expr $i : '.....\(.*\)'`; name=matcd; blk=17; chr=46;; esac rm -f $name$unit? r$name$unit? $name$unit?? r$name$unit?? case $unit in 0|1|2|3|4|5|6|7|8|9|10|11|12|13|14|15) mknod ${name}${unit}a b $blk `expr $unit '*' 8 + 0` mknod ${name}${unit}c b $blk `expr $unit '*' 8 + 2` mknod r${name}${unit}a c $chr `expr $unit '*' 8 + 0` mknod r${name}${unit}c c $chr `expr $unit '*' 8 + 2` chgrp operator ${name}${unit}[a-h] r${name}${unit}[a-h] chmod 640 ${name}${unit}[a-h] r${name}${unit}[a-h] mknod ${name}${unit}la b $blk `expr $unit '*' 8 + 128` mknod ${name}${unit}lc b $blk `expr $unit '*' 8 + 130` mknod r${name}${unit}la c $chr `expr $unit '*' 8 + 128` mknod r${name}${unit}lc c $chr `expr $unit '*' 8 + 130` chgrp operator ${name}${unit}l[a-h] r${name}${unit}l[a-h] chmod 640 ${name}${unit}l[a-h] r${name}${unit}l[a-h] ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; wcd*) umask 2 ; unit=`expr $i : '...\(.*\)'` blk=19 chr=69 rm -f wcd$unit? rwcd$unit? case $unit in 0|1|2|3) mknod wcd${unit}a b $blk `expr $unit '*' 8 + 0` mknod rwcd${unit}a c $chr `expr $unit '*' 8 + 0` mknod wcd${unit}c b $blk `expr $unit '*' 8 + 2` mknod rwcd${unit}c c $chr `expr $unit '*' 8 + 2` chgrp operator wcd${unit}[a-h] rwcd${unit}[a-h] chmod 640 wcd${unit}[a-h] rwcd${unit}[a-h] ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; lpt*) unit=`expr $i : 'lpt\(.*\)'` rm -f lpt$unit rm -f lpctl$unit mknod lpt$unit c 16 $unit mknod lpctl$unit c 16 `expr $unit + 128` chown root.wheel lpt$unit chown root.wheel lpctl$unit ;; tw*) unit=`expr $i : 'tw\(.*\)'` rm -f tw$unit mknod tw$unit c 19 $unit chown root.operator tw$unit ;; # Use this to create virtual consoles for syscons, pcvt or codrv # ttyv0-b # use as MAKEDEV vtyNN to create NN entries vty*) chr=12 units=`expr $i : 'vty\(.*\)'` eval `echo ${chr} ${units} | awk ' { c=$1; n=$2 } END { for (i = 0; i < n; i++) printf("rm -f ttyv%01x; mknod ttyv%01x c %d %d; \ chown root.wheel ttyv%01x;", \ i, i, c, i, i); }'` ln -fs ttyv0 vga # XXX X still needs this pccons relic ;; bpf*) unit=`expr $i : 'bpf\(.*\)'` rm -f bpf$unit mknod bpf$unit c 23 $unit chown root.wheel bpf$unit ;; speaker) rm -f speaker mknod speaker c 26 0 chown root.wheel speaker ;; cuaa?|cua?) umask 7 unit=`expr $i : 'cua.*\(.\)$'` rm -f cua*a$unit m=`ttyminor $unit` mknod cuaa$unit c 28 `expr $m + 128` mknod cuaia$unit c 28 `expr $m + 32 + 128` mknod cuala$unit c 28 `expr $m + 64 + 128` chown uucp.dialer cua*a$unit umask 77 ;; tty0?|ttyd?|tty?) unit=`expr $i : 'tty.*\(.\)$'` rm -f tty*d$unit m=`ttyminor $unit` mknod ttyd$unit c 28 $m mknod ttyid$unit c 28 `expr $m + 32` mknod ttyld$unit c 28 `expr $m + 64` chown root.wheel tty*d$unit ;; cuac?) umask 7 portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q r s t u v" major=48 card=`expr $i : 'cua.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=`expr $card \* 65536 + $minor` name=$card$unit rm -f cuac$name cuaic$name cualc$name mknod cuac$name c $major `expr $minor + 128` mknod cuaic$name c $major `expr $minor + 32 + 128` mknod cualc$name c $major `expr $minor + 64 + 128` chown uucp.dialer cuac$name cuaic$name cualc$name done umask 77 ;; ttyc?) portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q r s t u v" major=48 card=`expr $i : 'tty.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=`expr $card \* 65536 + $minor` name=$card$unit rm -f ttyc$name ttyic$name ttylc$name mknod ttyc$name c $major $minor mknod ttyic$name c $major `expr $minor + 32` mknod ttylc$name c $major `expr $minor + 64` chown root.wheel ttyc$name ttyic$name ttylc$name done ;; # RISCom8 'rc' driver entries cuam?) umask 7 unit=`expr $i : 'cua.*\(.\)$'` rm -f cuam$unit m=`ttyminor $unit` mknod cuam$unit c 63 `expr $m + 128` chown uucp.dialer cuam$unit umask 77 ;; ttym?) unit=`expr $i : 'tty.*\(.\)$'` rm -f ttym$unit m=`ttyminor $unit` mknod ttym$unit c 63 $m chown root.wheel ttym$unit ;; # Specialix SI/XIO. # Note: these are 'base 1' to match the numbers on the panels, and to match # the manual that comes with the system. ttyA*) major=68 nports=`expr $i : 'ttyA\(.*\)$'` port=1 while [ $port -le $nports ]; do minor=`expr $port - 1` name=`expr $port + 1000 | cut -c 3-4` rm -f tty*A$name mknod ttyA$name c $major $minor chown root.wheel ttyA$name mknod ttyiA$name c $major `expr $minor + 65536` chown root.wheel ttyiA$name mknod ttylA$name c $major `expr $minor + 131072` chown root.wheel ttylA$name port=`expr $port + 1` done # For the user-mode control program, 'sicontrol' rm -f si_control mknod si_control c 68 262144 chmod 600 si_control chown root.wheel si_control ;; cuaA*) umask 7 major=68 nports=`expr $i : 'cuaA\(.*\)$'` port=1 while [ $port -le $nports ]; do minor=`expr $port - 1` name=`expr $port + 1000 | cut -c 3-4` rm -f cuaA$name mknod cuaA$name c $major `expr $minor + 128` chown uucp.dialer cuaA$name port=`expr $port + 1` done umask 77 ;; # Digiboard PC/?? 16 port card. # The current scheme of minor numbering is: # # unused{14} CARD{2} major{8} CALLOUT{1} LOCK{1} INIT{1} PORT{5} # # CARD bitfield in future versions may be extended to 3 bits. # # See dgb(4) # ttyD?) portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" major=58 card=`expr $i : 'tty.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=`expr $card \* 65536 + $minor` name=$card$unit rm -f tty*D$name mknod ttyD$name c $major $minor mknod ttyiD$name c $major `expr $minor + 32` mknod ttylD$name c $major `expr $minor + 64` chown root.wheel tty*D$name done ;; cuaD?) umask 7 portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" major=58 card=`expr $i : 'cua.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=`expr $card \* 65536 + $minor` name=$card$unit rm -f cua*D$name mknod cuaD$name c $major `expr $minor + 128` mknod cuaiD$name c $major `expr $minor + 32 + 128` mknod cualD$name c $major `expr $minor + 64 + 128` chown uucp.dialer cua*D$name done umask 77 ;; mse*) unit=`expr $i : 'mse\(.*\)'` chr=27 rm -f mse$unit mknod mse$unit c $chr `expr $unit '*' 2 + 1` # non-blocking for X11 chown root.wheel mse$unit ;; psm*) unit=`expr $i : 'psm\(.*\)'` chr=21 rm -f psm$unit mknod psm$unit c $chr `expr $unit '*' 2 + 1` # non-blocking for X11 chown root.wheel psm$unit ;; mouse*) name=`expr $i : 'mouse\(.*\)'` if [ ! -c $name ]; then $0 $name # make the appropriate device fi rm -f mouse ln -s $name mouse ;; pcaudio) rm -f pcaudio pcaudioctl mknod pcaudio c 24 0 mknod pcaudioctl c 24 128 chown root.wheel pcaudio pcaudioctl ;; socksys) rm -f socksys nfsd spx mknod socksys c 41 0 mknod spx c 41 1 ln -s socksys nfsd chown root.wheel socksys nfsd spx chmod 666 socksys nfsd spx ;; snd*) # # changes from Linux voxware # minor Linux FreeBSD # 8 sequencer2 (aka music0) music0 # 17 patmgr0 sequencer1 # 33 patmgr1 sequencer2 # unit=`expr $i : 'snd\(.*\)'` chr=30 # XXX write this less verbosely, like std snd_security_hole=0 # XXX umask $snd_security_hole if [ $unit = "0" ] ; then rm -f mixer ; ln -s mixer$unit mixer rm -f sequencer ; ln -s sequencer$unit sequencer rm -f dsp ; ln -s dsp$unit dsp rm -f audio ; ln -s audio$unit audio rm -f dspW ; ln -s dspW$unit dspW rm -f music ; ln -s music$unit music rm -f pss ; ln -s pss$unit pss fi rm -f mixer$unit # Mixer [ Control ] mknod mixer$unit c $chr `expr $unit '*' 16 + 0` rm -f sequencer$unit # Sequencer [ FM Synth and MIDI output ] mknod sequencer$unit c $chr `expr $unit '*' 16 + 1` rm -f midi midi$unit # Midi 0 mknod midi$unit c $chr `expr $unit '*' 16 + 2` rm -f dsp$unit # DSP [ Digitized voice ] mknod dsp$unit c $chr `expr $unit '*' 16 + 3` rm -f audio$unit # SPARC audio [ Not fully implemented ] mknod audio$unit c $chr `expr $unit '*' 16 + 4` rm -f dspW$unit # Wide DSP (each sample is 16 bits) mknod dspW$unit c $chr `expr $unit '*' 16 + 5` rm -f sndstat # Status Device [ Debugging interface, only 1 ] mknod sndstat c $chr 6 # minor number 7 is unused rm -f music$unit # Sequencer level 2 mknod music$unit c $chr `expr $unit '*' 16 + 8` rm -f pss$unit # PSS and programmable devices mknod pss$unit c $chr `expr $unit '*' 16 + 9` # minor numbers 10-15 are unused umask 77 ;; vat) rm -f vatio mknod vatio c 25 128 chown root.wheel vatio chmod 660 vatio ;; gsc*) unit=`expr $i : 'gsc\(.*\)'` rm -f gsc${unit}* mknod gsc${unit} c 47 $unit mknod gsc${unit}p c 47 $(($unit + 8)) mknod gsc${unit}d c 47 $(($unit + 32)) mknod gsc${unit}pd c 47 $(($unit + 40)) chmod 666 gsc${unit}* chown root.wheel gsc${unit}* ;; apm*) rm -f apm chr=39 mknod apm c $chr 0 chown root.operator apm chmod 660 apm ;; card*) unit=`expr $i : 'card\(.*\)'` chr=50 rm -f card$unit mknod card$unit c $chr $unit chmod 644 card$unit chown root.wheel card$unit ;; ttyx?|ttyy?|ttyz?) case $i in *0) unit=0;; *1) unit=1;; *2) unit=2;; *3) unit=3;; *4) unit=4;; *5) unit=5;; *6) unit=6;; *7) unit=7;; *8) unit=8;; *9) unit=9;; *a) unit=10;; *b) unit=11;; *c) unit=12;; *d) unit=13;; *e) unit=14;; *f) unit=15;; esac case $i in ttyy?) unit=`expr $unit \+ 16`;; ttyz?) unit=`expr $unit \+ 32`;; esac rm -f $i mknod $i c 42 $unit chown uucp.wheel $i ;; cronyx) rm -f cronyx mknod cronyx c 42 63 chown root.wheel cronyx ;; joy) rm -f joy0 joy1 mknod joy0 c 51 0 mknod joy1 c 51 1 chown root.operator joy0 joy1 chmod 640 joy0 joy1 ;; spigot) rm -f spigot mknod spigot c 11 0 chmod 444 spigot ;; ctx?) unit=`expr $i : 'ctx\(.*\)'` rm -f ctx$unit mknod ctx$unit c 40 $unit chmod 444 ctx$unit ;; qcam?) unit=`expr $i : 'qcam\(.*\)'` rm -f qcam$unit mknod qcam$unit c 73 $unit chmod 444 qcam$unit ;; meteor?) unit=`expr $i : 'meteor\(.*\)'` rm -f meteor$unit mknod meteor$unit c 67 $unit chown root.wheel meteor$unit chmod 444 meteor$unit ;; bktr?) unit=`expr $i : 'bktr\(.*\)'` rm -f bktr$unit tuner$unit mknod bktr$unit c 79 $unit mknod tuner$unit c 79 $((16 + $unit )) chown root.wheel bktr$unit tuner$unit chmod 444 bktr$unit tuner$unit ;; tun*) ntun=`expr $i : 'tun\(.*\)$'` unit=0 while [ $unit -le $ntun ]; do rm -f tun$unit mknod tun$unit c 52 $unit chown uucp.dialer tun$unit unit=`expr $unit + 1` done ;; sysmouse) rm -f sysmouse consolectl mknod sysmouse c 12 128 mknod consolectl c 12 255 chown root.wheel sysmouse con . ..MAKEDEVconsoledrumkmem mem null random urandom zero io ttyklogstdinstdoutstderr lkm pci fdV wd0Wrwd0Xwd0aYrwd0aZwd0b[rwd0b\wd0c]rwd0c^wd0d_rwd0d`wd0earwd0ebwd0fcrwd0fdwd0gerwd0gfwd0hgrwd0hhwd0s1irwd0s1jwd0s2krwd0s2lwd0s3mrwd0s3nwd0s4orwd0s4p wd1qrwd1rwd1asrwd1atwd1burwd1bvwd1cwrwd1cxwd1dyrwd1dzwd1e{rwd1e|wd1f}rwd1f~wd1grwd1gwd1hrwd1hwd1s1rwd1s1wd1s2rwd1s2wd1s3rwd1s3wd1s4rwd1s4 wd2rwd2wd2arwd2awd2brwd2bwd2crwd2cwd2drwd2dwd2erwd2ewd2frwd2fwd2grwd2gwd2hrwd2hwd2s1rwd2s1wd2s2rwd2s2wd2s3rwd2s3wd2s4rwd2s4 wd3rwd3wd3arwd3awd3brwd3bwd3crwd3cwd3drwd3dwd3erwd3ewd3frwd3fwd3grwd3gwd3hrwd3hwd3s1rwd3s1wd3s2rwd3s2wd3s3rwd3s3wd3s4rwd3s4 fd0rfd0fd0arfd0afd0brfd0bfd0crfd0cfd0drfd0dfd0erfd0efd0frfd0ffd0grfd0gfd0hrfd0hfd0.1720$ rfd0.1720fd0.1480$ rfd0.1480fd0.1440$ rfd0.1440fd0.1200$ rfd0.1200fd0.820rfd0.820$fd0.800rfd0.800$fd0.720rfd0.720$fd0.360rfd0.360$fd1rfd1fd1arfd1afd1brfd1bfd1crfd1cfd1drfd1dfd1erfd1efd1frfd1ffd1grfd1gfd1hrfd1hfd1.1720$ rfd1.1720fd1.1480$ rfd1.1480fd1.1440$ rfd1.1440fd1.1200$ rfd1.1200fd1.820rfd1.820$fd1.800rfd1.800$fd1.720rfd1.720$fd1.360rfd1.360$ sd0rsd0sd0arsd0asd0brsd0bsd0crsd0csd0drsd0dsd0ersd0esd0frsd0fsd0grsd0gsd0hrsd0hsd0s1rsd0s1sd0s2rsd0s2sd0s3rsd0s3sd0s4rsd0s4rsd0.ctl$ sd1rsd1sd1arsd1asd1brsd1bsd1crsd1csd1drsd1dsd1ersd1e sd1f rsd1f sd1g rsd1g sd1hrsd1hsd1s1rsd1s1sd1s2rsd1s2sd1s3rsd1s3sd1s4rsd1s4rsd1.ctl$ sd2rsd2sd2arsd2asd2brsd2bsd2crsd2c sd2d!rsd2d"sd2e#rsd2e$sd2f%rsd2f&sd2g'rsd2g(sd2h)rsd2h*sd2s1+rsd2s1,sd2s2-rsd2s2.sd2s3/rsd2s30sd2s41rsd2s42rsd2.ctl$3 sd34rsd35sd3a6rsd3a7sd3b8rsd3b9sd3c:rsd3c;sd3d<rsd3d=sd3e>rsd3e?sd3f@rsd3fAsd3gBrsd3gCsd3hDrsd3hEsd3s1Frsd3s1Gsd3s2Hrsd3s2Isd3s3Jrsd3s3Ksd3s4Lrsd3s4Mrsd3.ctl$Ncd0aOcd0cPrcd0aQrcd0cRrcd0.ctl$Smcd0aTmcd0cUrmcd0aVrmcd0cWscd0aXscd0cYrscd0aZrscd0c[matcd0a\matcd0c]rmatcd0a$^rmatcd0c$_matcd0la$`matcd0lc$a rmatcd0lab rmatcd0lccwcd0adrwcd0aewcd0cfrwcd0cg od0hrod0iod0ajrod0akod0blrod0bmod0cnrod0cood0dprod0dqod0errod0esod0ftrod0fuod0gvrod0gwod0hxrod0hyod0s1z ft0{rod0s1|od0s2}rod0s2~od0s3rod0s3od0s4rod0s4rod0.ctl$rft0zft0arft0arwt0nrwt0rwt0bnrwt0brwt0cnrwt0crwt0dnrwt0drst0.0nrst0.0erst0.0st0ctl.0$rst0.1nrst0.1erst0.1st0ctl.1$rst0.2nrst0.2erst0.2st0ctl.2$rst0.3nrst0.3erst0.3st0ctl.3$rst0.ctl$rst0nrst0erst0ttyd0ttyid0ttyld0ttyd1ttyid1ttyld1ttyd2ttyid2ttyld2ttyd3ttyid3ttyld3cuaa0cuaia0cuala0cuaa1cuaia1cuala1cuaa2cuaia2cuala2cuaa3cuaia3cuala3lpt0lpctl0lpt1lpctl1lpt2lpctl2ttyp0ptyp0ttyp1ptyp1ttyp2ptyp2ttyp3ptyp3ttyp4ptyp4ttyp5ptyp5ttyp6ptyp6ttyp7ptyp7ttyp8ptyp8ttyp9ptyp9ttypaptypattypbptypbttypcptypcttypdptypdttypeptypettypfptypfttypgptypgttyphptyphttypiptypittypjptypjttypkptypkttyplptyplttypmptypmttypnptypnttypoptypottyppptyppttypqptypqttyprptyprttypsptypsttyptptyptttypuptyputtypvptypv ch0rch0.ctl$ tw0bpf0perfmonspeakerpcaudio pcaudioctlpsm0mse0sysmouse$ consolectlttyv0ttyv1 ttyv2 ttyv3  vga tun0  vn0rvn0vn0arvn0avn0brvn0bvn0c UVSMYQyt u9w<t 8t8/u p5@8u5<S1jP蜐U1UU1Service unavailableU帟fixit_crunch%s: %s not compiled in UWVS}  t8u.j/7G tp7=t(3Vt t;u;t WuCVhhh,|$e[^_UVS]j/S@G ޅtp=t"3V u  ;u1e[^UVSu] OSNVe[^usage: %s ..., where is one of: %sUWVShhh,|$1 =tO;0׍7Oh-h,|#3h/h,|# ;uh-h,|#jZgrepfindexviewvirlogintelnetsedrshmoreftpmount_nfsmount_cd9660mount_msdosumountswaponscsirrestorerestorerebootpingmount_mfsnewfsmountmknodftfdiskdmesgrdumpdumpdisklabelclrichgrpchownbadsect[testsyncsttysleeprmdirrmrcppwdmvmtmkdirlslnkillhostnameexpredechodfdddatecpchrootchmodcatUuu u@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. @(#)cat.c 8.2 (Berkeley) 4/27/95benstuvusage: cat [-benstuv] [-] [file ...] stdoutUVSu] x hjT hSVF $H44444444444444$8} }g,}<}K8}90}),}(}jh{ ,}hh,| j֊aÃ= }u-=<}u$=8}u=0}u=(}u =,}t SI Sh{衼 thjv 54}Qstdin-r%sUWVS]|{$};tV3t4h3T ƃu$3hv 4}*|{$}V'|{t V ;ue[^_%6d UWVSE1 MApqHyQU蠹 ËU Mi  ug=0}tJ}u8 {x{ { h{j 踖 E=8}t5= }u, =8}t!GWhzh{ {@E uZ=<}e {{}9{{${$h{j$ l =(} {{}9{{^{^h{j^謕  {{}9{{I{Ih{jI=,}sÀvSj zD6 {{}9{{M{Mh{jM @ {{}9{{-{-h{j-蠔 vSi zD5 {{}9{{^{^h{j^, ?t @ {{} 9{ t{,h{R6 {{} 9{ t{ڈ{h{S詓 t buF @t!5$}hr 4}f {@t hjiq e[^_UWVS]5{$};tV3t2jj3 ƃ }%3hRr 4}.5{$}V%{9t Vف;ue[^_U`WVS={=}uSEPW%ht5$}hjp E=s}Px}u jjUp 5}5}uà ~31S}PW荀 }hjp )ƅu벐}5$}h4q 4}e[^_Uuu u@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. @(#)chmod.c 8.8 (Berkeley) 4/1/94HLPRXfgorstuwxthe -R and -h options may not be specified together.invalid file mode: %s%s: %sfts_readU$WVSN EEEEE11hu u= E܃ q9Y$|Y1EEEaM T:-u&B9EuzuKa{raM M )E}XE}t*}t hjim tEteMM <wh<jEPS ƒ v <"=<tShjMl E8tShjl UE'S־ EuShjl EjuE u ǃ u jjk 1W ÃC4H $0!d!!!x!!!!!!!!!!}ujSW sn Psh*m $sn Psh m M}uC<@Pun %EPs/5 } sl =<thjj V~usage: chmod [-R [-H | -L | -P]] mode file ... Uh4"h,|j~Uuu u@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $Id: chroot.c,v 1.1.1.1.8.2 1997/09/16 06:46:12 charnier Exp $.%sSHELL/bin/sh-iUVSu]  hB#SV8 t吡a)ƍ33 uhC#%3 t3hE#ji StCPR! shE#jh hH#sÃuN#jhV#SS*! ShE#jh usage: chroot newroot [command] Uh$h,|j|Uuu u/@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. @(#)cp.c 8.2 (Berkeley) 4/1/94HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%sUWVSu 1Dž8Dž<h %u V:6 ƒ p¸*X$%&L'L'L'&L'L'L'&L'&L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'L'&L'L''L'L'L'L'L'L','L'<'Dž<1Dž8 Dž81P}h}\}\}h}T}X}Cv+5aM a M =X}tA=P}th%je <u 8uthG%je =P}t<t8t ‰d}j, ҉4`}4+ NE 0IvRh%jMe Rh赟 0J=u+Ƃ.z/uJ BwߡM EPh ƒu=<t$hh%jc fEf%f=@~ | jxuw=X}u=P}t%8u <t@QE 0n @QE 0{ fHf%f=@u=P}u =X}t  1SRu Pkw%s: %s%s: directory causes a cycle..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).fts_readUpWVSEh.uu E u jj)b Eu( E@4tt6Pt uFMqe PMqh)c E릐Mqh)c E눃} Mfy2uZ} tJj/ql- ƒtM+A@E EuMq)uE MI$MUMQA$+u:/t {/t/C-=~Rhh)VRS,  x/uH @=wEPh u MQ<9EuOB9EuGqhh*Ib EMAtA=wm1u;.u }u]KC;uhp}g E}tGE0}tMЍTA‹ME=~ M0Ѓ}t$;<<<<s<<G<< <ЍTFЋMADdAЍTF‹MQ ~?MIЍTF‹MQ ~ЍTF‹MQ~ЍTF‹MQ;~uo p}u hI:jP =t}u P tYhq6hZ:h_:" p}EEjEP t ha:jO hq6hZ:hx:P" H ƅuz:Vh~:j%脐 e[^_illegal time formatUh=P [-v [+|-]val[ymwdHM]] ... [-f fmt date | [[[[yy]mm]dd]HH]MM[.ss]]usage: date [-nu] [-d dst] [-r seconds] [-t west] [+format]%s %s Uh=h>hJ>h,| jb@(#)netdate.c 8.1 (Berkeley) 5/31/93LOOPSETDATEREQSETDATETESTMSITEREQMSITETRACEOFFTRACEONDATEACKDATEREQDATEQUITRESOLVECONFLICTREFUSEACCEPTELECTIONSLAVEUPMASTERUPSETTIMEMASTERACKMASTERREQACKADJTIMEANYudptimedudp/timed: unknown servicebindall ports in usegethostnameconnectsendsend (delayed error)recvfromwrong ack received from timed: %scan't reach time daemon, time set locallyUlWVSha?he? uhk?lN {@fƅ1jjjI ƃ }=<+7he?M (jjP_ƅ ؆fjPV },<0t1h?"M Ku h?ƅƅhS{ ǃth?L hhSP< E 1fEDžjPVH }h?UL jh SVno }=<=h?$L Džj St  PjjSh*[DžPPhhV@ 0u%t=$h?xK DžPPjh PVRG }=<=h?K fft tVZZ1I4 h? K u h?J VZl}[^_decembernovemberoctoberseptemberaugustjulyjuneaprilmarchfebruaryjanuarysaturdayfridaythursdaywednesdaytuesdaymondaysundayUWVS1E8tZ]ju EtWM ƒ t+ET0щHPu R,M ƒ uF;ue[^_UVSEu tExt @xuX]jO0@Ee[^UWVSEplHu:ׅt"dׅu &u v1 <e[^_UMUE <+t<-t Q,)Q$QDdl~ ”QQf %UWVSu]}E <+t <-t^t~9C C)Fع Pj+VO ع ӋF؉F ~rjtC~9~ G )؉)؍Xع Pj-V t)9^}jj-V t)^C v1FVe %e[^_UVSu]E <+t <-tZVV )у9~(C)F jjj+Vu1}ډV 1ۅu_tXF 9|-)F jjj-VltVF  )؉F 1ۅu~Vn9^ Vd %e[^US]UME |a<+t<-t$BtK9}B)RBRPtC9~)ЉRBRj-0C9} )Pj-!~19)‰Pj+S]UWVSu]E <+t <-tEFعPj+VF tdعӋF؉F~UFMعPj-V t%9^}jj-V t)^~1^VOc %e[^_UWVSu]E <+t <-tEFع<Pj+V tdع<ӋF؉F;~UĉFMع<Pj-V t%9^}jj-V t)^;~1^Vb %e[^_UWVSu/MÀ+t-uCE0ȉ׍OMh0S G9tdShƒtjREPu GShƒjREPu +dS6 ƒMD 1E$KKYLYLYLYLKYLYLYLYLYLYLYLYLYLYLYLYLYLYLYLYLYLYLYLYLYLYLLYLYLYLYLYLYLYLYL,LYLYLYLYLYLYLYLYLYLLYLDLREPu n^REPu NREPu >jREPu ,jREPu REPu f uv1e[^_USEtXPWI؃u]Uuu u @(#)args.c 8.3 (Berkeley) 4/2/94skipseekofobsifibsfilescountconvcbsbsunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %dseek offsets cannot be larger than %dUWVS}uj=5x}z Ãu5x}hMj> C;u5x}h$Mj> x}EhPjj hpEP uuhMj> =}y tuh>Mj> y=}SAЃx}D }t1 t } }tt hnMG?  }tBu hMj> =}uhMj= WtTot_!t6t }W% }ThMj= =}uhMjo= $T}t uhMjB= wvhhNj= 195}w19vhh+Nj< e[^_UUE 02w Uu1}Uu}Uu}ujUuU}u u}UE}U}u uUEUuyUue}unblockucasesyncswabosyncoldibmoldebcdicoldasciinotruncnoerrorlcaseibmebcdicblockascii,unknown conversion %s%s: illegal conversion combinationU}tth RMQf EhRjjh EP$ uuh Rj; }Ptuh#Rj: P}@ t뇐UUE 02u %s%s: illegal numeric value%s: %sUVS]jEPS ƃ u5x}hRj9 U9u5x}hRjC: UVS }u}Y}(jjQZ } }5}hYjt2 h}=v}u hYj2 u  Z|h}HuSQѸ  }3h}HuQ5衸   = }5hYj1 h}u3}JR9 }u jjh1 P} }9sˍR9}t}Ro9u jj1 }}=}t =t }h`u" %SQ5 t }1ۋ4vV' zT5уt:4vVn` z4 Cv 1ې4vV2' zT5уt:4vV, z4 Cv tV1ۋzT5уt1vS_ ƃz4  Cv#1ۋzT5уt/vS4, ƃz4  Cv~t}tZ1ۋzT5уt0vS^ z4  CvV1ۋzT5уt.vSh+ z4  CvjUR3g ZME}e[^UVS]`Rs;%tshYj- fhff u-sURhm@@s]>t S'jjjs^?uu =<uKX[^US }t}}9}t*t 5}j 5}j5}=@ 5}5}5}= u}e}u5}hYj, 5}hY- 3}u5j}1QR5}X>ut5}hYq- }}}}}L}9u}}},}t}} }}}}t(}jI}_t!}t}HP}RRb }}]U=$Tu =Tu =WuH }t?tE9s,t)Pj )Pj5,> =tjW%s: end of device%s: short write on character device%s: short write on tape deviceUWVS=}t 5 5SW5 : 2u5h;bj* =<t5hYj) 1}9u95}f}9tZt,=}u#}5hMbE[+ Et5hqbj* )5)9r}؅tR)P5=   e[^_@(#)misc.c 8.3 (Berkeley) 4/2/94%u+%u records in %u+%u records out blockblocks%u odd length swab %s %u truncated %s %u bytes transferred in %.6f secs (%.0f bytes/sec) ư>UWSjURja dME%}UEu]5}5}5}5}hdjd]S誔 0JRSj8(=}t;;du5dQWhBdjdSe 0JRSj7 }t>;du5dQShYdjd]S 0JRSj7 }UE1RP,$u$uuuhjdjd]Sȓ 0ɉ߈щJRSj17x[_U|Uj:@(#)position.c 8.3 (Berkeley) 4/2/94%sskip reached end of inputUWVS}uMj }%}SQ5}<8Ӄ5}hefj& 5}}1V5}5}6 ~}t )uЋ5}Kǐu v I hhfjH& }t'u5}hef& 5s5}hefjR% e[^_US uNj %SQ5 %7ӃJA5hefj$ tCfEUURhm5 5 5hefj$ 19555 A5 }5hefjX$ fEEURhm5 5 u5hefj$ C9vV555 a4 9 t5hefj# C9wC9+]Uuu umisccdfscd9660isofsiso9660fsafsprocfskernfsportalfdescmsdoslfsmfsnfsalllocalufsiknt:BLOCKSIZE=1k%s/tmp/df.XXXXXXUtWVSu 8<@DžhiVu ƒ kt' ?thitant#tt*T@hi 멐<5Lk8s fa)E4jP' Dž1ۃ9}60I9}C9Ѓ>=8u DžPl tKDž19}70I9}C919~(1PdC9j75EP6ɧ }&6wǃ6hi! ;fUff u6f`6"ǃhi$ P赍 NjHhWe tWhi! hHjWj t6]>SW tƅS? 6hi ! jW Wc O>SWs }Whi -}u0FщS>1[^_UWVSjEPX 19}41ېuEPZ u E؃L F9|1e[^_unknown type `%s'UWVSu =t13VZ uC=8 E;u0HvR>nuM~ouG=t93FP1Z uCЃ=8t#E#%;uVhmj e[^_UWVSE}u=<ujP E EE1ҋM 9ME1EE쐐}ut,sN=<uuELPUR U9Ut}}u@EEEEB9U Ee[^_Filesystem%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted on %-*.*s %*ld %8ld %8ld %5.0f%% %7ld %7ld %5.0f%% %s Y@UWVSu]  ,=,uLh$h(] 0PhoSShoY =@t hoY hoY PSShoY ^ +^N< }Vt $E9}יEș}F=$NQVt $9}ȉיؙF=$QVt! $9}ȉיV ЙF=$N Q5(hoX }tES<$,p,p$hpX =@tFV+^tR$S<$,p,p$vSh pNX h!p>X FLPh$p-X e[^_U WVSu4=4u jVQ D}Vhi 9h h8jh > Dž,Dž0l=h` p  tȿdË)؉d=Dž Dž$Vu+rjZQLPD-jZVEP8-u 5D<*[^_ df: %qd: %s UWVS]uju u5D +VS5D)9t9 <t'Re Pu uhsh,|# 1e[^_usage: df [-ikn] [-t fstype] [file | file_system ...] UhAth,| j,Uuu u-n%sUWVS] 讵 3t!tu10H~{u|\u|cu D3htU ;t? {{}9{{ {h{j H9 ;tu' {x{ {h{j 9 jZ+Uuu u)@(#)buf.c,v 1.4 1994/02/01 00:34:35 alm Exp%s cannot seek temp fileout of memorycannot read temp fileUWVSuu1V9u V 9tTVN  j55@Ӑ }(5< Phvh,|q h v'vF9P}W57ul5<E Phvh,| h6vh 8 P=P\t jpb\j5c= Pu&\t j1b\t jb5@Vj5; |9t05< Phvh,|E hDvhF7 Q e[^_line too longcannot write temp fileUWVSjǃu'5< Phvh,|謽 h6v]; tC; u+E=~ hJxƃ=tdjj5@袎 }#5<| Phvh,|@ h v|5@} ‰ 5@Vju |9tE5< Phvh,|¼ hXxh5 14w O O W! C؍e[^_US]5~‹XS]invalid addressUM19tt@9ut!uhzh4 ÐUVSuP9~r 9/9C9| 9~~@ 95a9|$9~R@ 955~95| Pu#\t jz^\tjC_e[^/tmp/ed.XXXXXXw+cannot open temp fileUWVS̠Ġj?; ؿ{fh~ ƃt%h{Vu1,V]ShjV SjjS e[^%sUEu5< Phhl/ UU EЃ6$$8L`tā؁ā؁1øÐ~Ð~Ð~Ð~Ð~Ð~Ð~Ð ~ Ð ~ Ð ~ Ð ~ Ð ~ Ð~Ð~Ðbad hex digit in keybad binary digit in keyUWVS}U :05BuDŽC~1ۍ$ˆ;C~uDŽC?~1{1ɐҍ1 A~C9~ jRWC [^_des_setkeyUWVSu=u6~1ɸtA@~t" B9~VN t he[^_des_cipherUWVSu] 1uQ1ۉ𐊋ܢ0@C~tPjVV5 t hPܢF[)؍3PhR" ^1ۉܢ0@C~tPjVV t hujjV( e[^_decryption failed (block corrupted)decryption failed (incomplete block)cannot read fileUWVSu} WjjVJ. Ãu|EFEjjVV t h%1򐐊ܢ0 B@~EܢEW u^vh$WP ~h$ } hIe[^_@(#)glob.c,v 1.1 1994/02/01 00:34:40 alm Expinvalid pattern delimiterUWVS( t uh]h( {UEt(8u@($5Ƌ=9= |lVjÃt=Ġtj jvSjjjSu u }t }uVVG69= }1e[^_unexpected end-of-file & no previous command%s out of memoryUWVS1ۃ}u;jEPÃu'?h`h|hu' ܐGi P|}u PPN |S‰U~Т| t %{ݐEfku5Тwou&5Тyu/jEP ÃUB(9P=}V5$[ ul5<i Phh,|- hh.& P=P\t jP\ajYQU5($ Pu&\t jUP\t jQE@PS5$  $(;"|1 |(~PPPOL |(8u1e[^_UVSu@ܠ9PP5 uf5< Phh,|׫ hh$ P=Pu#\t jBO\tj PLܠ Pu#\t jO\tjO41e[^UWVS]9] tg=}5O}1ɋE9}D9uJH19ʉB19U|УA9|9] ue[^_U$ 9}#<u@$$9}%<t$9~$Ð1UP$ܠ5  P=Pu#\t jM\tj]N@(#)io.c,v 1.1 1994/02/01 00:34:41 alm Expr%s: %s cannot open input filecannot close input file%lu UWVS}?!uhGPH[ hWyKP`= Åu#5<X PWhh,| h^u Sƃ} ~?!uS\ |@SE }35< PWhh,|軨 hh! (Vٌ=XuԌPh{腨 +E e[^_newline inserted newline appended UWVS} W^E11 ̠M ĠM9=%E̠Ġ=Ht=uǃP5<u; P\t j;K\jLM MtKGPPj^à u- Pua\t jJ\tEjK< Pu&\t jJ\t juK } }tt}t}th,|hۍ*=̠t$}t=Ġu}uh,|hO! =Ġt=̠t}uFu ̠}u M ̠M Ġ=Ht V)Ɖe[^_%s out of memorycannot read input fileUWVS1=Ht uMAxyHyQ@ EME}u }G `} VԠ9P=}S5<vuo5< Phh,|H h#hI P=P\t jH\jtIԠ< Pu&\t jmH\t j6I<UFĠVԠ9P=}S5<pui5<~ Phh,|B h#hC P=P\t jG\jnHԠ< Pu&\t jmG\t j6H} u < FUMA @t35< Phh,|脣 h1h @t< F̠<=Ġt=̠t tFe[^_wcannot open output filecannot close output fileUWVS}?!uh*GPT u WDP6 Åu%5< PWhh,|虢 h,duuSƃ } ?!uSU |@SV? }35<p PWhh,|3 hDh4 3Vٌ=XuԌPh{ }t E+E@1e[^_UWVSu VE=Ht[pT9u|QWt3_95u=Ġt =̠u CSPuZ }/]F?u=HtuUE)‰UEe[^_cannot write fileUWVS}] ug=HtWPCT|GWPCyv }25< Phh,|跠 h#h Nu1e[^_unexpected end-of-fileUWVS(B< u()߃~DPSOBuM9(JM89P}S54un5< Phh,|ן h#h P=P\t j>C\jD84 Pu&\t jB\t jCW5(54  O4D } tO[ƅ|t Т|0 thh  1 >89P=}S54 ui5< Phh,|螞 h#h P=Pu\t j B\ajBU84 Pu&\t jA\t jB4V5ТP{ 4~DPR?W89P=}S54 un5< Phh,|臝 h#h P=Pf\t j@\FjA:84 Pu#\t j@\tjvA4M94e[^_stdin: %s cannot read stdinUWVSE1 {yh|{7 |{8|{EV9P=}S5ТN uo5<\ Phh,| h#h! P=P\t j?\jL@Т Pu&\t jE?\t j@ТʈFu Ġ kf{@tB5<{ Phmh,|? hxh@ %{(1$f{9ut uSt ТТ(e[^_%ld \ Press to continue...  \abfnrtv\UWVSu} 1EM_uhqs. EEC9}gh{hv =XuG=u>EM9 t}0Eh{hy h{J 1 *E<^w6\t1 {{y9{~< eq {{}9{{\{h{j\ Ct&Ph\, t-n%0 {{} 9{< t{{h{Pu 0 {{} 9{< t{{h{P- 0 {{} 9{< t{{h{P ? {{} 9{< t{{h{P FOMt6 {{}9{{${h{j$\  {x{ {h{j , 1e[^_@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. @(#)main.c,v 1.1 1994/02/01 00:34:42 alm Exp*usage: %s [-] [-sx] [-p string] [name] p:sx ? interrupt? invalid filename%s %swarning: file modifiedscript, line %d: %s unexpected end-of-fileUWVS變 hSj. 1E E0}ЍP~ ]|ruF5ThTu u tXst pt .xt%LȠX H묋E 05lh,|˕ jaE M ])ӉډUt18-u*X~aNM JUj:jX thj hj jj hj h 6 ǃt&h,|hY h]h `}E 8tIP9t}9=(u 2|9}hEh 1e[^_invalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsinvalid destinationno previous substitutioninvalid pattern delimiteraw%ld ! unknown commandUWVS11E(=vPY  zD5t(8 t @(뽐(E(p$(p4@l@dԮH@4dt@$1ɐ(tPA,=~ h^(vR zD5u h"ƅ>!u h1ɐ(tVhd hdS'Ph{ =t h,f5j31}gt}GuPE}Gt}VuE}tX1ɐ(!tVhd 5 d>tPVƅR 95F ,7 (!tVhd 5 5}WuPd>tP ƅ>95u,p=,c=XV}qLB=~ h1ɐ( t?[t \t!)CSqÃuhZ7C; &C9u+=(W9P=}V5< ui5<J Phh,|X hh P=P\t ju\j:5 Pu&\t j9\t jW5(5 (=Ġu'hshQ 1j jW5le[^_USU:^uB:]tH< tF<[u<Z.t :t=u)<]u9t u1B:]u9uB:]u1:]uЋ]@(#)sub.c,v 1.1 1994/02/01 00:34:44 alm Expnumber out of rangeUWVSu} ( uu (< ur8uB(( <wEj h(R  =t=u7=<"u.hh gu B(1e[^_no previous substitution%s out of memoryUVS1(E((8%8M8H,@(=hh NJ(V09~hP=}S5Դ 0 Pu&\t j6\t j((F< u(:R<\uR((F u6=u-g…t~Т| t %{ސ(M8V09P=}S5̳ ue5<ڭ Phh,|S hh P=Pu#\t j \tj1L0 Pu#\t j\tj5e[^no matchUWVSEPE )‰9E`5ǖuu PuƃT1PP{58PSvÃu9 P \t j\jt5%GMPPjn ǃ u5 P\t je\j*y9L Pu&\t j,\t jEE +9E}uU uhMhG E tu PP|1e[^_infinite substitution loop UWVS] DžDžDž1Sǐǃ@=Ġtj jsWؗKj PjWu^ H}t9M] Р9P=}S58 um5<" Phh,|O hh P=PS\t jM\3j'Р8 Pu&\t j \t j=Ġtjj (W肖8VWP裹 Mq PW )(Р9P=}S58轮 un5<˨ Phh,|N hh P=P\t j\jР8 Pu&\t j\t j~=Ġtjj VW/8VWPP (?t@tEt1(u ,tj PjWuw )TР9P=}S58M uf5<[ Phh,|M hh P=P\t j\tpjOgР8 Pu&\t jM\t j~3(u*,u!MthCh~ ]=Ġtjj VW萓8VWP豶 8f^ftD1[^_UWVS} M=)M<&M IM)؋Р9~fP=}V58蚫  5Р8 Pu&\t j\t j9]x8M CG9]\<\EM<0<99EM DE)؋Р9~fP=}V58 45Р8 Pu&\t j#\t j9]8M CG9]WР9~hP=}S58( Р8 Pu&\t j\t jS8MGEE+9WР9P=}S58艩 uf5<藣 Phh,|[I hh\ P=Pu#\t j\tjAР8 Pu#\t j\tjR8e[^_@(#)undo.c,v 1.1 1994/02/01 00:34:44 alm Exp%s out of memoryUS]9 |d@PR] ƒtX @uO @Lu 3 @L R5< Phh,|G hh 5J 1]nothing to undoU WVS=}=}=t =uhh\ %= t ,jFP= }EO}4t= tMD PD D D @ByT BT BBT T PPVD D FBD PFVD @BT D T D BME6M/= }@O}9E<}ƐM}ED3ED3EE@U)RDD3DD3EEDEDUB}M9=t}=}= Pu#\t j\tj1e[^_UWVSC  @<u(D8t9tV>Vf 9u = u e[^_Uuu u @(#)yaccpar 1.9 (Berkeley) 02/21/93B[aim3O (                      !"   (:%&)*+%-/*+-/:<=>:%&)*+-)/%&)*+-/<=>%&*)<=>/%&)*+-:/&|)+-<=>&)<=>&)+-|<=>&|)&|)<=>&)&)<=>|<=>|<=><=>|&)%&|*+-/|<=>:<=>||%&|*+|-/:<=>%*+-/||:<=> malloc() failedUS]jf uhj迒 X]UWVSuj- EtV ‹EPuhjn 1wm1Ʌu>-utP0щH9s, 2wm1Ʌu1But E EEe[^_UUHwr UVS]u -t#s/ sٙ s1e[^%dUVSuHv3j Ãu hj@ vh%S ^e[^UE8%|&=<>+-*/%:()UWSu1Ã0uPh tEPu1{=u+<u!Se[_UVS];u{%"1C8tStt {ue[^%d %s US] , hj :8u ph phw 5U]syntax errorUhj艏 UVS]u Su V Se[^UVSu] Vu StVYSSj< SBe[^UWVSu} Vu Wt"VpWjwv触 VWG9F%PÃVW؍e[^_UWVSu} VNu WAt"VWwv VzWtG9F%P5ÃV:W4؍e[^_UWVSu} Vu Wt*V`WZwv藥 PÃ+VWG9F%PÃVW؍e[^_UWVSu} V6u W)t*VWwv P@Ã)VZWTG9F%PÃVW؍e[^_UWVSu} Vu Wt"V@W:wvw VWG9F%PÃVW؍e[^_UWVSu} Vu Wt"VWwv VJWDG9F%PÃV W؍e[^_non-numeric argumentUWVSu} Vt Wuhj肋 FGPVW؍e[^_UWVSu} Vt Wuhj* F+GP؍e[^_UWVSu} V:t W-uhjҊ FGPVW؍e[^_division by zeroUWVSu} Vt Wuhjf Ou hjQ VЙQ`VhWb؍e[^_UWVSu} V^t WQuhj Ou hj VЙRVW؍e[^_%sU0WVS}W3u +jM quV莔 t#hSVP Shj_ jURjwV uD}u>}u8}|WMWUR4U؋M+UMQR)Ã!}u j h:ÃW u URd ؍[^_yacc stack overflowUWVS  1fuL=}H} ut}xsk]9u_=֮+H 4]&fpJ B RH Gut,x"]9u]&= uh=  Et[xSKf<]u?֮3J 4]&frJ Bl=l=*<]()C$8|,@Th|0@0p]0p}0p0p)0p0p0p0p v0pb0pN0p:0pq&0p0p-?)‰2 )M <]ueuaJ fBM MA=}h} =}"t$x ]9u 4]& 4}=֮s,H fpJ Bmh*1e[^_Uuu u@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. @(#)hostname.c 8.1 (Berkeley) 5/31/93ssethostnamegethostname%s UWVS}]  1h SW4Q t?tsu ېѐa)Ǎ~t.0HPRJ t]h j藁 hSӱ t h jp tj.Sܽ tPh 蹾 j usage: hostname [-s] [name-of-host] Uh h,|r* j; Uuu u@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. @(#)kill.c 8.4 (Berkeley) 4/28/95-lillegal signal number: %s%s -soption requires an argument -- s0illegal process id: %s%sUWVS] w }EM3 M}~}=wm1uj EP3 E :tE8tRh j }~EEHv R3}4 u h p j9 h{2j' 3 u=M}h 蓀 3 uFE8-x;PvRu  zD5t3E}oc=wm1t>j EP3赾 E :tE8tRh j~ }vR3M}u1}tbj EP3S  :tE8tRh l uQ/ u3h ~ M}uV虑 sigUVSujhV[ uV4 u 胁 u C~e[^unknown signal %s; valid signals:Uuh~ h,|j UVSu4 u h V & tu h h"V% C~če[^ kill -signal_number pid ... kill -signal_name pid ... kill -l [exit_status]usage: kill [-s signal_name] pid ...%s %s %s %s Uhwhhhhh,|% j Uuu u@(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. @(#)ln.c 8.2 (Berkeley) 3/31/94fs.%sU`WVSu] | hSVJ t0ft ~!stܮ+뽐a)ƸV =ܮtXT tt 9t1jh3P胎 js3lPn tEPV tVhj z fEf%f=@t193tjV3 ǃ 93uW %s/%sU`VSu] =ܮu:EPV t VfEf%f=@u<V}uEPSL uIfEf%f=@u;j/V/E u@PShhS EPS!  EPS %=tt S uSVЃtSh z 1[^ ln [-fs] file ... directoryusage: ln [-fs] file1 file2%s %s Uh,hOhkh,|! j艌 Uuu uUE @PE@P蚐 UE@PE @P肐 UME P σD$$ $ $ $ $ $ $ $ $ $ $ $ $ $ $ g$ $ $ 8$ $ $ $ $ H$ $ $ $ $ T$  $ $ $ $ $ $ $ $ $ $ $ $ d$ x$ T$ $ $ $ $  įxxįyįxU;  |ȯqaQ̯A1&a)ƍ<=u'=įuN=u=u =u=įu'=|u =u=įu =t==t (hEP  } =tT=ul=tlDy=tl|al R=ul==tl(%=tl` l=t h(#=įthD) h+tSWV ShjG 5= %s: directory causes a cycle%s: %s %s: %s: fts_readUWVS]1=u(PSu b ƃ u jjj jV PjX=|41=u tV^ ÃC4t tMېtt̍C@Ph!k 빐sm PC@Ph"k 뒐f{2t{@.u =v=ptsh"$ }~sh" pWV PSE[E=jSV =<th"j;i e[^_-%lu%quUWVS} 8E=u=įu =tEEEEEEEEEEDžtEEu EfN4ftf u0vl PV@Rh"-j F =}ufu4=|u+F ~@.u=u F =ȯtV&RV@RRD N&9MsM}^ %sUVSUfz2uB@Ph?)hP #B@PBphd2hP hSV9k u!5<z] PVhj2h,|= Ƅ(Shw2% [^UWVS}]IMGu NM E=vPP zD6?tUKue[^_usage: ls [-1ACFLRTacdfikloqrstu] [file ...] Uh3h,|f j/m Uuu u@(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. @(#)mkdir.c 8.2 (Berkeley) 1/25/94m:pinvalid file mode: %s%sUWVS}] E1h4SW' t(mt~puEא5LŐaÃ;uu/VB uVh4j.X hPͨ %1;tM}tW3Bt*#W3L }3h4eX ;uVKk UlWVSfU fU]1E;/uCE1u  }0HEuuh8jS uPut tG t tG t1uPu E}uh8jR GfE=wm1uVG tP6Eu6h8j)S P&6S, tS6h8 E8jEP6ג E EG t ~~E8t6h8jR EEPhmub }>7uh8jQ ]Shm@@ub } jjQ Sje Wangtekeofbnludaeomwrpuslcni por erm bpe bom mbdndtillinusereadwritestartrmarkwmarkrewexcep vol wo ro wany ranywptimeractiveArchive ViperSCSI tape drive%d: unknown tape drive type %s tape drive, residual=%d ds erUVSufftpf9tf;u V rFPsh<ҍ sFPh0<`s FPh3<N$ {x#{ {Ph;肍 h{j q e[^%s=%o%s=%xUWVSE} ]1t;u WPh<WPh<0 5C,$ {{}9{{<{h{j<\q Ht9 {{}9{{,{h{j,q < ~P {{} 9{< t{{h{Pp C< C; CR {{}9{{>{h{j>pp e[^_usage: mt [-f device] command [ count ] Uhh>h,| jsb X3B5/91-174X3.193-1990ECMA TC17X3.202-1991X3B5/88-185AQIC-1350QIC-320QIC-150QIC-120HI-TC2HI-TC1X3.56-1986X3B5/86-199X3B5/87-099X3.158-1986X3.116-1986X3.157-1987X3.136-1986X3.54-1986X3.39-1986X3.22-19830x%02xUU=t9t8u8t@ÐRh?hЯo ЯUWVSu0Ѝx=tWVsQ t;ue[^_variable= %d bytesUEtPh4@ho Ð+@Present Mode: Density = %-12s Blocksize %s ---------available modes--------- Mode 0: Density = %-12s Blocksize %s Mode 1: Density = %-12s Blocksize %s Mode 2: Density = %-12s Blocksize %s Mode 3: Density = %-12s Blocksize %s US]sPs Phk@趈 h@謈 sPs$Ph@荈 $srPs(Ph@k sSPs,PhAL s 1Ps0PhFA* ]The "eof" command has been disabled. Use "weof" if you really want to write end-of-file marks, or "eom" if you rather want to skip to the end of recorded medium. Uh+Bh,|n j7^ Uuu u@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. @(#)mv.c 8.2 (Berkeley) 4/2/94fi%s: destination pathname too longUtWVSu hCVu2 ƒ t@ftiu.  벐멐a)E4}EP}tv ƒufEf%f=@t}~dv6P\ EtSq 0҉߈щ\ /1ۃ0щD 9t=/u O9u9tx/t H9u鋕0ҋD=~6hCBI ,R6[ P6dtM$Sb[ %soverwrite %s? override %s%s%s/%s for %s? rename %s to %sUpWVS} =4jW# !uVu S1ۃ= tWhEh,|  wjW teVWB uWEPEP WjuҠ Pju PE} uEPEPhEh,|t $ti {yh|{V |{|{t0 t+ {yh|{" |{|{ uՃytYuWu^ u1p=<tWuhEF O]Su4 tuhE|F &fEf%f=uSWu Wuse[^_malloc failed%s: remove%s: set owner/group (was: %u/%u)%s: owner/group changed; clearing suid/sgid (mode was 0%03o)%s: set mode (was: 0%03o)%s: set timesUWVSjju ƃ }uhEUB@9sNt PM Ur@UL uhGE UB@jhu ǃ }0=<uu { tu hED VT }55VJT à ~S5WS 9tu }@uhED u tu hGtD V/T W)T VT UfZfrr W4 t;Urr u hG#D  tPu hHD Ufb UBPW tPu hTHC UBEB EEEEPu ` tu hnHC WSS t u hEu u1uhG[C e[^_-PRpmv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmU …u7ju uhJhJhJ' hJhEB jU jEPRd) uhJhJqB ÐEt hJhJߐtPhJhK?B s …u1juh:KhJh>K h>KhEB j:U jEPR( u h>KcEth>KhJPu1ÐPh>KhKA  mv [-f | -i] src1 ... srcN directoryusage: mv [-f | -i] src target%s %s UhLhLhLh,|\ j%T Uuu u@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. @(#)pwd.c 8.3 (Berkeley) 4/1/94P%s UVS]u hMVSH t?tPtMې9at;jj* u jj> PhM5| jR usage: pwd Uh$Nh,| jR Uuu u@(#) Copyright (c) 1983, 1990, 1992, 1993 The Regents of the University of California. All rights reserved. @(#)rcp.c 8.2 (Berkeley) 4/2/94dfprttcpshell%s/tcp: unknown serviceunknown user %d -d -p -rrcp%s%s%sUWVS]u E1hNVS T5<$OPPPPPPPPPPPPpOPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPtPPPPP840<<Ea)Í4hOh OK| uh OhOj< @f@ ,P_ Lu5,h'OjM< Ht"!5,R VS5DO }t5,/ VS5DO ~ 0H;O=0t7OP;O=8tudRj@U2u ME80щM؉щM܋U؍T U}щK}щHE؃}t%}0щM܍T Ӊ]܋E؍\T]]܋U؍\TSA Eu jj8 MtqEE8?u L8Wuu;O}tfRQMu;OQVhPWuhhRhuRSu 0Fuu;O}tfRQMu;OQVhPU2hhRhRSuʤ ,5,uu@ =H}0щ˃SS? Eu jj7 uhPhRSuV UUjuMuLQL0@PEPi H,} jnK EjEPjjQ } hRH8 }j1K u? 5, ujEEE H9E9e[^_/bin/cpexec %s%s%s %s %s%s -f %sUWVSEEH9EKM ME0"ÃM90ҋEM |0Ӊ]TRU^> ǃUu jj6 EM tE0;O=8t VC;udRj@M1q ‰UuEE L1-EE0>u L0V0щʃSRUS= ǃUu jj4 ShPhIVRW¡ jWVL0@PEPbg H,W= =H}Dl5, EjEPjj5H% } hR5 ME LQjj 5HME HEEEH9Ee[^_%s: %s%s: not a regular fileT%ld 0 %ld 0 C%04o %qd %s UWVSDž]9u] 4jjVP |* t'5<6 PhX;gfU@t u&<=4t>&hX j/ xuxx=8tRuuhXhr 0JR5HB xUԋMRQfURhXh 0JR5HnB (|"hh uB Dž|DžDžUԅ} >ډ|E9u9Us }+|u?WvB 9tDž} <tWv5HaA 6Ws5HGA 9tDž} 5<|U9 u|9uA tu.<ujh;O5H@ !3 PhXu9_l[^_D%04o %d %s ..%s/%s: name too long%s/%sE UWVSudF u5<83 PuhXj/uf ƃuuF=8tME pp hXhS' 0ɉ߈щJRS5H? |TVjE f@%Ph\hSӛ 0ɉ߈щJRS5H;? $g} 1 S 9tY޿dRt͉޿\t}0щщTvSuh\ kSuh ]hS Pj2)0 jh]5H/> ^ [^_ambiguous targetunexpected lost connectionmtime.sec not delimitedmtime.usec not delimitedatime.sec not delimitedatime.usec not delimited%sexpected control recordbad modemode not delimitedsize not delimited/%s%s%s%s: set times: %sdropped connection%s: truncate: %s%s: set mode: %sprotocol error: %sUWVSu DžLDžPDžXjt %h=8u PW }tNh)_ jE@ :_b O_V _J _> _2 6D=0t V jh;O5H< URDu ufUff@u DžP@<@jS5H; ƒ  B  jR5H;  NU9s uF4ʀwJ=<u%0҉߈JRSj: uj> D 4E uJB@TXj 4u 8t5<' &`Rh_jY8 +44jp|9Qp`64 ‰щ48p,0 ,94u098t)DžDžL8} <LDžp|StxT,0x90x90ut9,pp|s`3 ‰щ48p,0 ,94u098t)DžDžL8} <LT4884`af ƒ t)5<% PHh9`Dž=8t"lud9\th\-luTd9\tFfhff#\R` t5<% PHhJ`N`T2 XtRuRDžXURH })5<$ PHh`Džt,s8Lh$ PHhXjh;O5H 1 1LRh[`j4 jh;O5H0 [^_UVSjP5H 1 t jt |< 1CjP5H0 t j5C9s uă=<u)PVj0 Du j3 [^ rcp [-pr] f1 ... fn directoryusage: rcp [-p] f1 f2%s %s Uh^mhmhmh,| j]3 w%crcp: UVSu] D=(uhm5HRb (t`jhm5(4 hm5($ SV5( hm5( 5(I =<uSVb e[^@(#)util.c 8.2 (Berkeley) 4/2/94UE:u 1ÐÐt:t/t@8u1%s: %sU`S]EPSԤ ufEf%f=@t+<5<^! PShnj1 ]%s: invalid user nameUWVS}|avS  zD5u*wm1u _t-uF>uWh9o 1e[^_-csh/bin/shUWVSn Ãtt 1lu juhohohoo j,1 jj, jj, jEPS }EWjt, Vjl, Ee[^_fstat: %s%sU`WVS}uEPu  }5< PhpVEH1ޅu9r=Swo% Gt !5<k Php1e[^_lost connectionU=<u h&qj j/ Uuu udfiPRrUWVSu] 1hqSVl "$qrrrrrrrrrrrrrrrrrrrrTrrdrrrrrrrrrrrrr9$$ a)ƍq S ;u 5 0. jI ( t SA S5 - %s: %s%s: unable to read%sfts_readUWVS1=t=$u=u=(tjtPu ƃ u jj0 V: Ã-C4H  $sXttt tttttttst Psh,sj| =$t{tsE Psh,ss  Y=t/smaximum option value is %d -- %soption requires a numeric argument -- %sUWVS}EEhHj jhP]]S Eu&hHj jh4Sz Eu1+p7@Euuh\b M]uuE~t P=Pt"CD0P3h> ;uVZ PV_ Ph> e[^:%lxcflagiflagispeed%ldlflagoflagospeedUWVSj:u i= E u jE @E UUhE P, Ã;j=S= Eu SpMAMuhQ ;cu!޿uEUBU;iuW޿uEM0޿u!uhċuU EUB$ ;lu#޿ȋuEMA ;ouW޿΋uEUB޿ԋu!uhċu EMA( xP=Pt^TU8u=RS ; u/wuhċuy ?}EMD >u>u S} !e[^_ttyspeedsizesanerowsrawospeedoldnlnewispeedextproceverythingdeccookedcolumnscolscbreakallUUE 02*: illegal option -- -%soption requires an argument -- %sU WVS} U;-u GC G]hlj jhEP ƃu1YFutSh Ft'MP@GuShh SWFиe[^_UEjpPDRP UUztRÁJ"JB$ B$B US]sa: fCFC]UE@+@-@0P$߀CP$`@ UEjpPDRP| UUztEEPh`t2v EEUS]s9 PCP C ]UExtHH``@ US]si9 PCP/ C ]US]{t SICP3 C C C ]US]s9 fCDC]UEP KP @+P$g@P$@@ %d %d UEPFR@DPhz8 %ld UEP1 Ph8 TIOCSETDUUEEPht2 } hđj @(#)modes.c 8.3 (Berkeley) 4/2/94-mdmbufmdmbuf-rtsflowrtsflow-dtrflowdtrflow-dsrflowdsrflow-ctsflowctsflow-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5-imaxbelimaxbel-decctlqdecctlq-ixanyixany-tandemtandem-ixoffixoff-flowflow-ixonixon-icrnlicrnl-igncrigncr-inlcrinlcr-istripistrip-inpckinpck-parmrkparmrk-ignparignpar-brkintbrkint-ignbrkignbrk-kerninfokerninfo-nokerninfonokerninfo-newcrtnewcrt-crtcrt-pendinpendin-flushoflusho-tostoptostop-noflshnoflsh-icanonicanon-isigisig-prteraseprterase-echoprtechoprt-ctlechoctlecho-echoctlechoctl-echonlechonl-iexteniexten-altwerasealtwerase-crtkillcrtkill-echokeechoke-echokechok-crtbscrtbs-crterasecrterase-echoeechoe-echoecho-oxtabsoxtabs-tabstabs-onlcronlcr-litoutlitout-opostopostUWVSEM 8=tF8u,RWM2 MuF#A A A ;uT=TtFX8u,RWMF2 MuF#AA A ;u=tB8u(RWM1 MuF#A$A$ A$N ;uŻ,=,tN08u4RWM1 Mu F#AA AA  ;u1e[^_@(#)print.c 8.6 (Berkeley) 4/16/94tablet disc; new tty disc; slip disc; ppp disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-oxtabscflags-creadcs5cs6cs7cs8-parenb-parodd-hupcl-clocal-cstopbctsflowrtsflow-crtscts-dsrflow-dtrflow-mdmbufcchars%s = %s;%-8s%s UWVSu E1tXt t:tt,hshhhV0 ǃPhA0 ǃu u 9tPSh0 ǃ Shҗ0 ǃ}vFPPh/ ǃ t h/ MY h}wuP}w|P}wu P}wuP}wtPb}wt#PA}wt؃*P#}wt2P}w@t:P}w tCP}wt LP}w}WP}w@t_P^}wtgP:}w toP}wtwP}wt PMh}w tP}wuP}}w@tP\}w}P<}wu P}wt P}wu P}w u ĘP}wt؃͘P}wu՘Pz}wtݘPY}wtP8}wtPMYh}wu؃P}wuP}wu PMYhR}wu Pq%=t t5=t=t%hh#h'h+& /P}w t 7P}w@u?P}wf}FP}wt NP%=t =t hV*h^"}wtftgP:}wtoP}wtxP}wtPM4}uehoP=Pt;]F4PV P6hjdSX Sn >uj j P1=PM08,Dž(T}t(A48 tu6h0P (4PVKPh,S} G u%10hR( ,hB( ( >\tEPh( 8Ph ( [^_US]=4th' 48]%s: %s %s %sUWS]4uS58h' 4K0ЍDHvhm' Shb' 4ShM' 4e[_%dUEM @wQhjh,~V ,ÐuÐ,},M--.u ^B? ^B@ ȈB,@(#) Copyright (c) 1989, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. @(#)stty.c 8.3 (Berkeley) 4/2/94-aefgaef:g%sstdin isn't a terminalTIOCGETDTIOCGWINSZ: %s gfmt1illegal option -- %stcsetattrTIOCSWINSZUXWVSƅ EEaXh@E 4t Ƌ] 0ҡa<щH9-hFSu ƒ ($DBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB,EBE6j5Lm E}5LhLj Ea9UaEE uVu ƒ}hOj# EPht@uC } hfjH ]Shht@u }5< Pho^ b}t,r }w1 E 8u%uuEPEP uSV. EEE 8EEu ]̐uV{uVuVoE wmƒ1҅t&E 0" WSS WS\ EGjhE 0W uE PSEE 0h E EE Ex}t"EPju } hj }t%EPhgtui } h j usage: stty [-a|-e|-g] [-f file] [options] Uh|h,|薍 j_ @(#)util.c 8.3 (Berkeley) 4/2/94stdout appears redirected, but stdin is the control descriptorUj tJj thhr g}BP|%hDžDž9uDžhDžlu 9(uyu ȋ;tih|LE9u fff|ffCUOutDž9)uytGh }|cjYA9wu?u V6uXj u jj 6h)  u>t -2u8t6P tP6c ~DžuPWP4 fftfu9kE9uw)DžuGPtw)DžuGPMuffffYQhP [^_UE8u@8uÐxu Ð1U@WVS}u $h lв4H4`@@ȳܳ,V2e}Myj tۻ*j tj tKj M9Au URj5 19My9|B9|I:@2 *`"URv a MAMfQ9uy| F^FRMQt̃y}ċMy|Q8<16v FV:t뎐0~JVVN N1v v uu )ىˉ^뎐V 9VV 9V V 9VV 9VV 9VV 9Ve[^_UWVSu} VU&U8PuVP5 u )u׸e[^_UpVSuh6Ã|VUtt/UEPR^ EEPEPSK}%e[^UVSuh v Ã}KuEP6EPv EFEjEPS}%e[^%s: trailing non-numeric characters%s: underflow%s: overflow%s: expected integerUVS]u ;t:=vP* zD5tC;u͊u =wm1u0<-t<+C=wm1tn<j EPS ‹E 8tShj =<"u/uShj uShj Shɵj e[^syntax errorUhji expression is too complexUh,j= @(#)operators.c 8.3 (Berkeley) 4/2/94ݷڷ׷Է-z-x-w-u-t-s-r-p-n-k-h-g-f-e-d-c-b!db_][XTPLHD@-ge-le-lt-gt-ne-eq!==&-a|-odb_] Uuu uC@(#) Copyright (c) 1981, 1983, 1993 The Regents of the University of California. All rights reserved. @(#)badsect.c 8.1 (Berkeley) 6/5/93usage: badsect bbdir blkno [ blkno ] ./dev/Cannot find dev 0%lo corresponding to %s sector %ld cannot be represented as a dev_t Don't forget to run ``fsck %s'' UWVSu \p }hmh,|| j v |EPhgY }v(L j @ffD@S <uSK jj 0ЍD8< ÃtLCP8 @PWX } WK j T9EufHf%f=`u< uvuh j 0ҋ8щ48BQ8R: 8rj@SX ‰H} SJ j\ <@h@h h <Jd4R4Й4 E }~T6 jS u0<HdPh6k }6=J @M}@Ph 5@ block %ld out of range of file system block %ld in non-data area: cannot attach cg %d: bad magic number Warning: sector %ld is in use U WVS<EPdEE} M9y$s uhUE􋘼EƉ΋EP!PʉH9M}tPU9~& F9~uh h@5 <֋A!AQ IdR =DU t,=U t Vh޼h,|}t5d5`sL 5d5`s =hs@=<th¿j V groupUS];t(LS] u hTSb@d]userUS];t$S> uhS(@`]%s%s: illegal %s nameUS]<j EPS ƒ =<tShj E8tu ShjX Ћ]you are not a member of group %sU@S]=<u =`t8=Lu/ZX Lt!=htjy Shj+ =dts=PujEPjÑ HPP|'d9TtHPP}=P}&=ht j 5LhCjb =hu Sh ] chgrp [-R [-H | -L | -P]] [-f] [-h] group file ... chown [-R [-H | -L | -P]] [-f] [-h] :group file ...usage: chown [-R [-H | -L | -P]] [-f] [-h] owner[:group] file ...%s %s %s UhMhhhh,|p j Uuu uusage: clri filesystem inode ... %s%s: can't read superblock%s: superblock magic number 0x%x, not 0x%x.%s is not a valid inode number.clearing %d UH WVS]xc h`h,|0o j E E jjPgL }hj jjh | }hjS h S = thj ߋ\TthTShj 0E M 9U 2 ƃM 1hj\ Vh  ӉOы!GGؙx_`_d j }hj 9thj xslFhjS sljىșc }hj) y 9thj l E U : j Uuu uCCDfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunusedBNRWb:ers:w/dev/%sr%s%c%sr%s%sioctl DIOCWLABELrU WVSO_ Dž1ېhu u 8$t000X0000000000000000000000000000d00000000000000t000LL= t~. = t^. = t>. c= t. C5= t- - a)EM M =t= u6 *= u  }j-M 8/tCjcPhh5   0‰ 1= tP5E =<uc8/tYPhh5 0 1= tPRE }5h j/  Hn$Ht}t,SEEPhmd hj蚽 }t+Sh{A S#$=t"}uhjM qE }tZ+hh9h M q uM qh j SP '}u M YE}t*hSM q)hhÉ߾ES)#EEPhmd9 hj: 1ÍE}uhjM q hh ÉߍES"uSh auto%s: unknown disk type /usr/mdec%s/%sUWVS]޿<u$ Snx uShAh,|d jp }E=uBUBt88/tPhXhbhv Ph =uCUBt98/tPhXhbh+ Ph juVBd } t ju V: e[^_ioctl DIOCSDINFOwriteioctl DIOCWDINFOUVSu]Sd$WEVǃWEVfǃS(f=ShfdV }<tt h~jjjV EEPhmdV } hE3 u V 9u!t+5PV 9th2 @EEPhmdV $ShgdV }h1e[^disklabel: %s: No disk label on disk; use "disklabel -r" to install initial label Label magic number or checksum is wrong! (disklabel or kernel is out of date?) Open partition would move or shrink Labeled partition or 'a' partition must start at beginning of disk US<uhh,|h,|` hhhhh,|` <j 1 ]Bad pack magic number (label is damaged, or pack is unlabeled) ioctl DIOCGDINFOUSE=h hP =5h j輶 xwL;WEVu WEVt xvxw";WEVuWEVuS %ft?hh,|_ j hhedAP } hj$ ؋]%s/%sboot%s/boot%sBootstrap doesn't leave room for disk label UWVSu ~(uF(dž u} w(uhVf_ =uN="h uuA =5h j] hu_ =t =R j/5见 u 9A4=wm1u A 9uȡ  =uhShXh5 # j5  };ruC ShXhP 0= =uhShXh5  j5  };ruC ShXhP} 0= j5: E}5h j跳 } w( Ãu5h j莳 u v(uSe v(uu4 }5h jS uP 1w<%Btt}ǾS j59 E }5h jٲ } G()REPu }5h j褲 u M9s$9thh,|[ j A9rߋEe[^_# %s: type: %s type: %d disk: %.*s label: %.*s flags: removeable ecc badsect bytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld sectors/unit: %ld rpm: %d interleave: %d trackskew: %d cylinderskew: %d headswitch: %ld # milliseconds track-to-track seek: %ld # milliseconds drivedata: %ld %d partitions: # size offset fstype [fsize bsize bps/cpg] %c: %8ld %8ld %8.8s%8d %5ld %5ld %5.5s %5ld %5ld %5d %5ld %5ld %5d%20.20s # (Cyl. %4ld- %ld) UWVSu5hVY M fA f w%4|h %PhVSY E PjhV MAXPARTITIONS (%d)partition %c: size 0, but offset %dpartition %c: offset past end of unit partition %c: partition extends past end of unit unused partition %c: size %d offset %dU WVS}E(u jh,u jh0ujh h,|qB 4ujh"h,|MB E fHujh68u O,O0O8<u O8O4O<ujhLh,|A E 1w(t haujhh,|A E 1w(t hYffvj%Ph7 1fрaM>;uCtPPhU UG<9Cv EPhh,|UA E UC9G>u{tsPBaPhlUTUB~͋Ee[^_"auto" requires the usage of a canonical disk name. open()U S8/uhh,|@ 1lPhhh Sh jjSF à u h jh hlhedAS@ } hjE SF lboot overlaps used partition %c marked as FS_BOOTboot overlaps partition %c, %sCannot install boot program UWVS1= ȋu1v(E19EڀaUMM9tXu9qr y uJA DA E< t9tEPhh,|> GA hEPhD ECU9|thh,|[> j$ e[^_Warning, US]hh,|*> E PSh,|A hh,| > ] (to write disable/enable label) disklabel [-NW] disk (to restore label and boot program) disklabel -R -B [ -b boot1 [ -s boot2 ] ] disk protofile [ type ] (to write label and boot program) disklabel -w -B [ -b boot1 [ -s boot2 ] ] disk type [ packid ] (to install boot program with existing label) disklabel -B [ -b boot1 [ -s boot2 ] ] disk [ type ] (to restore label with existing boot program) disklabel -R [-r] disk protofile (to edit label) disklabel -e [-r] disk (to write label with existing boot program) disklabel -w [-r] disk type [ packid ] (to read label)usage: disklabel [-r] disk%s %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s UhIhkhhhhh`hhhh$h6hThhhhh,|: Hj褥 U1ɋU9s f3 9rUuu u rcannot read %s: %s WARNING: no file `%s', making an empty one wcannot create %s: %s cannot read %s even after creating it: %s USh5@! Ã<tP P5@!h~#5@!h#h5@! Ãu5<諓 P5@!h6#Se h5@!u à u5<m P5@!h*"jCP S S ]UVSuh j8 SVO|h p p ːl jh @P8 d p h Jx Jye[^UWVS=X! 0v1d 95h ~RhSW( u-%8}9X!}X! Fd 95h e[^_r+cannot rewrite %s: %s fseek: %s %s: %s ftruncate (%s): %s the epoch level %c dump on %sUWVS=L!NhM5@! ǃu5<蒑 P5@!hP!OMjQ ]5d Ö d h p l WjjW7 }5< Phg X!Ed 2M9 h ~=hVuz u%8t>Ed ]49h hj:6 h d A h huV %T!Ed 2 M9 h ~!VWEd ]49h W5~ t5< P5@!hrW h M]uuu~ t5<踏 P5@!hzCWr =T!thT! P%Rhe[^_%-16s %c %sUVSu] P蹥 PPShV4 }5< P5@!hre[^Unknown intermediate format in %s, line %d USX%uhS, 9t 0X%Pu 9}5X%5@!h~1%16s %c %[^ ] UVS]uVPShu e VgR|1x[^TAPE/dev/rst0/etc/dumpdates/etc/dtmpTP_BSIZE must be a multiple of DEV_BSIZE 0123456789aB:b:cd:f:h:ns:T:uWwnumber of blocks per filenumber of blocks per writeplease choose a blocksize <= 64 densityhonor leveltape sizebad time "%s" Must specify disk or filesystem Unknown arguments to dump: %s You cannot use the T and u flags together. -standard outputinvalid characters in tape an unlisted file systemnonethe epoch Date of this level %c dump: %sDate of last level %c dump: %sDumping %s (%s) to %s on host %s to %s Cannot open %s bad sblock magic number dev_bsize (%d) is not a power of 2TP_BSIZE (%d) is not a power of 2mapping (Pass I) [regular files] mapping (Pass II) [directories] estimated %ld tape blocks. estimated %ld tape blocks on %3.2f tape(s). can't allocate tape buffers - try a smaller blocking factor. dumping (Pass III) [directories] dumping (Pass IV) [regular files] DUMP: %ld tape blocks DUMP: %ld tape blocks on %d volumes(s) finished in less than a second finished in %d seconds, throughput %d KBytes/sec DUMP IS DONE! DUMP IS DONE @(\.@U$WVS# 1EET!hT! 0!h辐 d%u d%@!l%%0} E PURYhu uT ǃ wЃG$d d d d d d d d d d d d d d d d d d d d d d d d d  d d T d d d d d d d d d  8 H d  d  d d d d d  d d d d  d D d T  %h%jjh  qhjh c  @Nh&j $ -hj hG ƹ lj=  p  Ld%j jhO E  jjh[ @0! 5LJX!}5Lheh,|0, j E ?ME 2L!!Wj迖 au)։uE ] hth,|+ j E Nu~Qhh,|+ E 0E hh,|l+ M}uhh,|Q+ j }t"=L!thh,|*+ j 5d%u d% tؙ=   N=h%uD= u=$ td =0!u 6=$ t0!j:5d%肽 tgd%0 j:Pi d%d%j 5d% thh,|0* j 50 Mu jߔ _ PiH jj舐 thLjt jjh thLjT jjH thLj4 jj ( thLj  jj  thLj jj thLjԏ h\jŏ u jj贏 p5Ãt/3j@3hH$I j@sh$: 'j@5hH$" j@hh$ $G$(#,#j@h$^ %У$P!}u=T!thT! -V%Ph8 =X!thX!趘 -V PhWL5hv<tshx0 tS5d%hZ 5d%hDj5 %}5hj1 CE uUPhjv 0>ЃP| u jj_t -UP6Pj (}uU-BUEUUBUEU:t}tUUu؋U +HUe[^_r/dev/ttyfopen on %s fails: %s excessive operator query failures DUMP: "Yes" or "No"? DUMP: %s: ("yes" or "no") U@WVSh h"輰 ƃu5<v Ph"h+@U1Vj?EP uf G~ShBDEjEP33 u jh V t uV;uG tW j e[^_/dev/w Message from the dump program to all operators at %d:%02d ... DUMP: NEEDS ATTENTION: UWVS@fDfhuS; hFS脬 ÃPS |%pphHS4 = ui1> u(CPSHy9C  Sj t CPSHy 9C t Ȉ SQE F>utu >uS誴 [^_%3.2f%% done, finished in %d:%02d Y@UWVSEP2 M9 d ,d   )+  MS$Q<$ R$}E Em$YmȾщljȾ<SW$he[^_ DUMP: UVSuhh,| ] SVh,| h{^ h,|^ SVh z> e[^UE Puh,| US]hh,|" E PSh,| h{Y^ h,|O^ j]%s UVSujt Ãt4v|p Ct"vjp Ct6Yp u5<o Ph] RFCFC؍e[^/etc/fstabCan't open %s for dump table information: %s rwrorqUWVS u!5<Bo Ph h f Ås!t(s!ts!uSj~s ƃu5<n Ph] O ^5oG e[^_UWVS}5t{^Ws蔦 t]W3腦 tN3tWPi t2?/t18/uW@PN tC8/uW@P7 u6u1e[^_Dump these file systems: Last dump(s) done (Dump '>' file systems): ??%c %8s (%6s) Last dump: Level %c, Date %s UWVSMMEP 6hH$j5h 5d = }wu h"h" E"1d 9=h hSu袣 P[ E@]SGE1t(Pt!)M)9}F}wut@uP}tMAPS t }wt>Ph"( Gd 9=h 8e[^_UVSEU 0hSVŢ u +e[^UWS]0Pp tSPW h%j x =|1e[_Lost connection to remote host. on %s: %s%sU0VSh$= j ]SX 5  DEEEPjjSFVx tOhS5 x ~1Ƅ( %( u %RS5h %j>{ tcpkshellshell%s/tcp: unknown service who are you? RMT/etc/rmtlogin to %s as %s failed. Connection to %s established. IP_TOS:IPTOS_THROUGHPUT setsockoptUVS= uwh%%=( t%P艦 u%%=( t%Ph%j8z P uh&jz j@5; Ãt*5Vcujy C 0h&p Ãu &h %7h SV 0 @Ph }V5h)&5hD&h,|{  E =~EE+jEPhh5q }EE=jEPhh5= EjEPjj5! (} hc& e[^invalid user name %s UWVSu>tZÀu9vSo[  zD5%u_t-tWh(1 F>ue[^_O%.226s %d UVSuu Vh)hS|  SV[^C closeU= uh_)hb)Q R%d readU$WVS}u h)j]S Sh)ƃ} 5<619}.)P;P5s  EE9|ԉe[^_W%d writeU WVS] Sh*juV{ 0HPV5r Su5r (h*e[^_U WSuh*j]S 0HPS5r e[_Uu u5lr Uh*{L%d %d seekUPSu uh*jP]S Sh*]S statusUVS= t11h)+h,+}1%CF?v%e[^I%d %d ioctlUSE |'Puh~+hS Sh+UWS] 0щHPS5Kq ‰0щH 9tuDe[_%s: %sProtocol to remote tape server botched (code "%s"). U WSj]SU<w8hSSuh+,}Fu  GAt70ЍD9v H8 uEPh2,EP' [_UjEP5}p tEProtocol to remote tape server botched. (rmtgets got "%s"). UWVS}u ~< u C'CNh>-Whg-Te[^_UWVSv x    = uE=h%u< ș=$ u qu1 11ۡ  Pf tˡ T!ʉ< )ƒ@ $F~% $  8 < \%e[^_UWV% B B D=\%u\%} t `!  `! 9 |e^_UWVStN E}G M}uNA  \%`!%`!j`!K ]+]Su%r hHY 9th6\ j%B$% r % }GtvuЉ (} u ME}H%S }G BS\%?u \% {tQjURs he th1g j%B 9Ut h6e[^_Context save fork fails in parent %d Parent %d waiting for child %d has another child %d return Child %d returns LOB status %o Bad return code from dump: %d Dumping volume %d on %s Cannot open output "%s". Do you want to retry the open?Volume %d begins with blocks from inode %d UWVSjjJb E d ǃuj3b V Ã}Whe9jjja uVҜ 9tPSWh9ᐋEt%PSh9 EEpt t j juh9Oj = uj,5d%ԍ t]= t 8td%j,5d%訍 t @   5d%5 h: =0 tj5d%*= uhh5d% 8!}.5d%h:jh9:L uj념Gx% }t4!%P!P$\!P! $p%$ ~%pRhX:e[^_The ENTIRE dump is aborted. U=T%ta T%9t jRYa h<mjUuc U=t jh too many slaves, %d (recompile smaller): %s UWVS` T%h =j_ h`1j _ h0j^ h`=j^ 1 1ې % IQщ)Ѝ9u EPjjj | 0 }5< R PWh=E, ǃ4 0 u;191ې, 5_ $F9~jj^ Wu@j}$G1j_عҍ0 P4, hHn߃~T%e[^_UWVS1 1ېD~j P4_ D$F~܍e[^_slave couldn't reopen disk: %s master/slave protocol botched - didn't get pid of next slave. master/slave protocol botched. error reading command pipe: %s U VS5%] j5x % }5<5P Php? jEPuhth?5 %p uh9 %X  =  t&C P%  BPQ  C{u.h%  BPuhb=t h? S s9 lhʕ u=u藨 1E U9}W=0 t)P%@PXE)P%@P58!W[ E }|uCuu ~~E}}j5T%_\ j5 jEPuhH9ju0\  t5< N Ph?e[^UWVS} u]SVWU҃ ~ )Å~琐|E)؍e[^_UWVS]Sh jhQREދVN jhQRE9E~ED!Ee[^_U,WVSEE p%ME]9]EMu]]E}MMD! Uu NjWUEE} ]ԃ|(tnuUB t C11t 32MB)Extended DOSPrimary DOS with 16 bit FATXENIX /usr filesystemXENIX / filesystemPrimary DOS with 12 bit FATunused/dev/dev/r%sCannot open disk %s (%s) Cannot open any disk (%s) ******* Working on device %s ******* Media sector size is %d Warning: BIOS sector numbering starts with sector 1 Information from DOS bootblock is: We haven't changed the partition table yet. This is your last chance. Should we write new partition table? -t flag specified -- partition table not written. fdisk {-a|-i|-u} [-f [-t] [-v]] [-{1,2,3,4}] [disk] UVS]u /€:tB h^Rg e[^%d: US]hR]*g u"Sh cg S C~S] sysid %d,(%s) start %ld, size %ld (%qd Meg), flag %x beg: cyl %d/ sector %d/ head %d; end: cyl %d/ sector %d/ head %d UWVSEEǁ()jhW) uh[c2f G 1҉É֡ EUEEUUUEEjhuuHÉWRQGPhece U()RVSw whtce (GPWUЃ?POQWRGEƒ?RO%QhcRe e[^_UWVz' offx)Ue^_UVS]5h')l)h)p)5t)hi)hj)hk)VS_hm)hn)ho)t)Pp)HP=e[^The data for partition %d is: Do you want to change it? The static data for the DOS partition 4 has been reinitialized to: sysidstartsizeExplicitly specifiy beg/end address ?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorAre we happy with this entry?UWVSE()uheZc u = .he = t,jSp }ujhec j MMCPuh f tECsuh&f tECs uh,fx tEC h1f] KS%KM?!VuhWf% tuuuhjf tMMWuhyf t}K?$ˆSMKKS%KM?!Vuhf tuuuhf tMMWuhfd t}K$?ЈCMK4CPCPCPs sCPCPCPC PCHP(uhf$e[^_parameters extracted from in-core disklabel are: cylinders=%d heads=%d sectors/track=%d (%d blks/cyl) Figures below won't work with BIOS for partitions not in cyl 1 parameters to be used for BIOS calculations are: UhDi#` 5\'5D&5|/5/hvi` =t'?=/ =l'~ hi_ hi_ 5d'5t'5l'5/hvi_ Do you want to change the active partition?active partitionAre you happy with this choiceUWVSE8)= tthjtUuSVhj t]hjtٺ0JyCw De[^_Do you want to change our idea of what BIOS thinks ?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsUShk]5/Shk tE/5l'Shk tEl'5t'Shl tEt'l't'd'dhjZs]UWVS}u}u} uEVE=d'd')EE=t'át'ËU)BUE$?U EUe[^_%s: Can't get file status of %s %s: Device %s is not character special %s: Can't open device %s %s: Can't get disk parameters on %s U`EP5@&˥ u#5@&5/h_mh,|0 ÐE u5@&5/hmh,| = u}t 1P5@&6 `'u)=<uÐ5@&5/hmpj9t `'Ð5@&5/hmh,|u USUM ]j QR5`'/  u@ 5 S5`'v.   9t*҉ ~RS5`'G. ]USUM ]j QR5`']/ 5 S5`'- ]%s: Can't get disk parameters on %s; supplying dummy ones UShH&hedA5`'- tW|&// x& |/ l't&D&t'£\'d'ى£h'}5@&5/hoh,| //|/l'D&t'\'d'h']%s: Can't read fdisk partition table %s: Invalid fdisk partition table found Uhz'jj u5/hph,| Ðf=x)Uu1Ð5/hqh,| %s: Can't write fdisk partition table U=p't jA1Ðhz'jj t1Ð5/hqh,|K %s [n] yesYESyYUWVuh rX h|{jdh%X 0%ƀ%=%tb%rtB%rt,%rt%ru 1e^_Supply a decimal value for "%s" [%d] %s is an invalid decimal number. Try again UWVS1uuhrW h|{jdh%W 0%ƀ%%t"%Ѕt t uAuu1hBЃ w؍\Au t ut2 t uAuth%hrcV 7u e[^_unknownUVSu*1ɺ| 9uB A9| te[^UVSu ]jXjV+ Pa tC퐊<#CPa u<#tfP_ tND2CPp` t5EjEPSX ‹NT0 E 9tF념e[^%s: ERROR line %d: the geometry specification line must occur before all partition specifications. %s: ERROR line %d: incorrect number of geometry args %s: ERROR line %d: unknown geometry arg type: '%c' (0x%02x) %s: ERROR line %d: number of cylinders not specified %s: WARNING line %d: number of cylinders (%d) may be out-of-range (must be within 1-1024 for normal BIOS operation, unless the entire disk is dedicated to FreeBSD). %s: ERROR line %d: number of heads not specified %s: ERROR line %d: number of heads must be within (1-256) %s: ERROR line %d: number of sectors not specified %s: ERROR line %d: number of sectors must be within (1-63) UWVSU = t5<&5/huzt5<&5/h{u/l't'11ېDv5<&5/hswh,|軼 1e[^_%s: ERROR line %d: incorrect number of partition args %s: ERROR line %d: invalid partition number %d %s: ERROR line %d: unable to adjust start of partition %d to fall on a cylinder boundary. %s: WARNING: adjusting start offset of partition '%d' from %d to %d, to round to an head boundary. %s: WARNING: adjusting size of partition '%d' from %d to %d, to round to a cylinder boundary. %s: ERROR line %d: size for partition '%d' is zero. UWVSuE ~t!5<&5/hyh,|誺 {F EHvu5<&5/hyE()jS輺 FCFCF$C sE{u jS葺  t'1DžtFG9}su5<&5/hzWVu5/hgzh,| {s K15d' d'+{9t3WVu5/hzh,|M蟹 Mt{ C K u"u5<&5/h2{h,|d 8CPCPCPQsCPCPCPC PCHPEEe[^_%s: ERROR line %d: incorrect number of active args USE1 xt5<&5/h1}h,|贸 WH Av!Q5<&5/hyh,|艸 ,8)0JyD؋]UXVS]Su3E|w[QcdjǼe~k*NԽf1l +WϬOAg'25mE!, 8Xyp­PuHڊTB$^ha(L/?36nF"-=9;Y zqZ{ Q[vrI|גUC %sw\R_Jib)}M0܂V@4&7 DoxGt#S].K`>:< 8?61$#*-pw~ylkbeHOFATSZ] '.)<;25 PW^YLKBEhofatsz}G@IN[\URxqvcdmj709>+,%"ڧg`in{|ur_XQVCDMJ /(!&34=:UM 1ҐsHB~UM1ҐsB~UWVS}u EEEEM,U2UŠ@U0ˆU2EEUUIuϊUUUGNu1e[^_UWVSuu EEt'19E} s}a]܉LC]A9M}}<]\]]ЊM}\?)ljEû?)É؊EȊE2EȈE%*@؈EA=~@E}u1!E@=~@EUA=~@E}u1!E@=~@E\T)y@EMЉ+Ty@E)y@E)y@ET)y@E̋T)y@EȊE2E2E2E2E2EȈE%*@U?+TE?)ȊE?)ET@\@MЊ@E0҄u1 %@=~@EE2EUu1#%@=~@EE2EUu1#%@=~@E㊅\0Uu1!%@=~@EE2EUu1#%@=~@EE2EUu1#%@=~@EE2\Uu1 %@=~@EE2EUu1#%@=~@EE2EUu1#%@=~@EEE%EMM؋E uƅ\EE9s/U2Š@]0È]2\E\9rр}u}u \O \u1$\@B}@2Eu1!%@B}@2Eu1%@+Ey@EE2E2\E\u1%\@B=~@2Eu1%%@B=~@2Eu1"%@E=~@EEEE}}tt}niMtaEu1+%@@)‰Ѕ}@%@}܉D9E~EEG}܃EUu1"%@=~@2EȊEUu1 %@=~@2E%uuE@EE`ʈtu1'@@)‰Ѕ}@%@]܉D9E C]܃]\]]M}\?)ljEû?)É؊EE2EE%*@؈EA=~@E}u1E@=~@EUA=~@E}u1!E@=~@E \T)y@EM+Ty@E)y@E)y@ET)y@ET)y@EE2E2E2E2E2EE5%*@U?+TE?)Ȋ|?)xT@\@M@E0҄u1"%@=~@EE2EUu1#%@=~@E⊅|2xUu1!%@=~@E㊅\0Uu1!%@=~@EE2EUu1#%@=~@EE2xUu1 %@=~@EE2\Uu1 %@=~@EE2EUu1#%@=~@EE2|Uu1 %@=~@EU}tEDžT]9TƉ`DžX}9X}q`CptX;p ;tu1*%@@=~@0X]9X|F`T}9TZU]lEDžT}9TƉdDžX]9X}qdGhlXh tu1*%@@=~@0X}9X|FdT]9TZ19MD E؊\)}08\XD)u1(%@X)‰Ѕ}@0E\)0]D)Tu1 %@=~@0EA9Mg}y}o}eE؁}51H[^_Uuu uO@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $Id: mknod.c,v 1.3.2.2 1997/06/18 06:13:34 charnier Exp $usage: mknod name [b | c] major minor node must be type 'b' or 'c'%s: non-numeric major number%s: non-numeric minor numbermajor or minor number too large%sU WVS]u 蠉th-h,|X j! F1uEt,=uEt0؍PLRP F9|uL }t Ut^U 2$EuU 2hMj LPk ÃuU 2huja C ELU 22 Ãu%U 2 ÃuU 2hj s2tnu~ou 01ۉ8t8,uC@8uP ǃuj 14j,P t @C琐e[^_%s,%sUWVSutW>tR0ҋ} ЍSF ǃu jj u VhSWH u ǃtV e[^_,-oUWVSEU Eh-EP tOt-u UCj=P t@Uƿ5tU/CC뜋U e[^_[-dfpruvw] special | node[-adfpruvw] [-t ufs | external_type]special node[-dfpruvw] [-o options] [-t ufs | external_type]usage: mount %s %s mount %s mount %s Uhhӱhhh6h,|较 j %s %s %s %s,sync,noexec,nosuid,nodev,union,async %u %u 1 1 0 0 UWVS]5C0t2PC,4{LWVh/ C0t h C0t h  C0t h C0t h C0 t hŲ C0@t h̲ V謊 u Wۊ tpphӲ {,u h۲hr e[^_groupquotauserquotaupdateforcesyncasyncunionrdonlysuidexecdevautoatimerwroo:ufsvfsload("ufs")%s on %s: mount table full. Specified device does not match mounted device. Incorrect super block. %s UlVSu] E-ahISV t0?t#oujEPh5Lǐk뽐a)ƍtTEsEEt E Ej2H hLF ÃuKhL9I t:hLI thPg H hLF ÃEPuVtC$P }oVuh_h,|@ <tu.hjEt h}hh,| mP& Phƴh,| R1e[^usage: mount_ufs [-o options] special node Uhuh,| jc ,-o %s: option not supportedU WVSu Eu jj uhV荁ƃ>nu~ou EE] ;ti0щOWRV ƒ ut =t;uƃ;t)U{ tUE9Cu [ &C!=uVh¶j 19u e[^_Uuu uKU1ɋU9s f3 9r,-o %s: option not supportedU WVSu Eu jjl uh0Vƃ>nu~ou EE] ;ti0щOWRV) ƒ ut =t;uƃ;t)U{ tUE9Cu [ &C!=xuVh2j^ 19uNe[^_asyncunionrdonlysuidexecdevautoatimerwromfsNF:T:a:b:c:d:e:f:i:m:o:s:NOS:T:a:b:c:d:e:f:i:k:l:m:n:o:p:r:s:t:u:x:%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: bad rotational layout count spacetime%s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad total tracks%s: bad sectors/track%s: bad spare sectors per cylinder/dev/%sr%s%s%s%s: %s%s: getmntinfo: %s%s is mounted on %s%s: unknown disk type%s: %s: not a character-special device %s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: maximum file system size on the `%c' partition is %d%s: no default #tracks%s: no default #sectors/track%s: no default sector sizeWarning: changing optimization to space because minfree is less than %d%% disagrees with disk labelWarning: calculated sectors per cylinder%s (%d) %s (%lu) mfs:%dvfsload(mfs)mfs filesystem not availableUWVS]4lj/M 1 6t@M 6h56F t15Dž=1t Džu SI -9$0Կ @l,X T 8d555L1 55Lh˹L6L5}5L a5Lh߹5L =25LhP5L 5Lh 65LQ 5Lh-5L% 65LhG5L u5Lht5L 6I5Lhg5L 5Lh;5Lu 65Lh5LI | c5Lhɺ5L }5Lhm =yj=1tjhh5L@5Lu5Luh  5LE 5LhH5L V5Lhh5L 6i5Lh5L 75LhX5L 5Lh(5La 5LhȻ+ a)ËM M t=1ut M j/Q) uW hhh1 EPh1TO u hhh1 Dž 1=5tDž j N }5< P hjPY ƃu5<e P hx j h u NxqæjSh urSW# tCPW uLP h Ny=1t86t/P! Ãu56h*j M }5<O P hbEP }5< P h-fEf%f= t"=1u 56h@ jM 12? Ht,P<v3=wm1uM 1hh=1u=6u M A6 Ë=wm1t >uPM 1h  ~ uPM 1h = 6u 69 6v&=1uPPM 1h޼=VuCHV V=uC0M 1hb=uC,M 1h.;=5uC(5M 1hL=uCL} =6uCJ6 6=u#FS(vУ=u2F F!  У=u=H=6u  6=6=t-hgh,|l jhh,|l =uC@}    5=uCB} +6=t%S89tRhPhͽhh,| l =6u  6CP5CTVEFEFEF E V=5u2 $ =1> PhSu Dž$ t Dž Dž 5 6 5h&1 ÃuTh{3 t2h3 t h%i2 h0 Ãu hP5M qtC$P }5< PM qh=5t 65P559 j ioctl (GDINFO)USh0hedAu }J6t*VP} Ãu56h*)h uh 0]UWVS}u jj, }"jj56? VWj y  SW j/ usage: %s [ -fsoptions ] special-device mount-point [device-type]usage: %s [ -fsoptions ] special-device%s where fsoptions are: -N do not create file system, just print out parameters -O create a 4.3BSD format filesystem -S sector size -T disktype -a maximum contiguous blocks -b block size -c cylinders/group -d rotational delay between contiguous blocks -e maximum blocks per file in a cylinder group -f frag size -i number of bytes per inode -k sector 0 skew, per track -l hardware sector interleave -m minimum free space %% -n number of distinguished rotational positions -o optimization preference (`space' or `time') -p spare sectors per track -s file system size (sectors) -r revolutions/minute -t tracks/cylinder -u sectors/track -x spare sectors per cylinder U=1t56hh,|f h)56h8h,|e hch,|e hyh,|e hh,|e hh,|e hh,|e hh,|e hh,|we h(h,|he h=h,|Ve hmh,|Ge hh,|8e hh,|)e hh,|e hh,|e h h,|d h%h,|d hWh,|d hh,|d hh,|d hh,|d hh,|d hh,|d hh,|{d jD mfsmmappreposterous size %d preposterous ntrak %d preposterous nsect %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size (%d) cannot be smaller than fragment size (%d) fragment size %d is too small, minimum with block size %d is %d There is no block size that can support this disk minimum bytes per inode isWith a block size of %d %s %d Minimum bytes per inode is %d With %d bytes per inode, minimum cylinders per group is %d With %d sectors per cylinder, This requires the block size%s to be changed from %d to %d and the fragment size %s to be changed from %d to %d CylinderWarning: cylinder%s groups must have a multiple of %d cylinders panic (fs_cpg * fs_spc) % NSPF != 0cylinder groups must have at least %d cylinders Warning: Block size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder File system performance may be impaired. and ntrakrotational layout tables with nsectWarning: insufficient space in super block for %s %s %d %s %d.%sinode blocks/cyl group (%d) >= data blocks (%d) must be increasednumber of cylinders per cylinder group (%d) %s. Filesystem must have at least %d sectors Warning: inode blocks/cyl group (%d) >= data blocks (%d) in last cylinder group. This implies %d sector(s) cannot be allocated. Warning: %d sector(s) in last cylinder unallocated cylinders%s: %d sectors in %d %s of %d tracks, %d sectors %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) super-block backups (for fsck -b #) at: %d, %s/>UWVSDž|EPa@ 3]S~=1 `hj  tJuh{- j jUR˛ t]u R j jq-5hhS(: ǃ }55- j 1 659sXvSRWj 9t55, j ) ދ 6 59rjjWjj 65Rj 5uhP, j W M55 6֋59v1 6 6R=,5u j z EVUV=5tL;H;L;H;< 6ShO j  h 655SR-5566 Sh j Vh j  P6T6I t h- jt {tShV j[ 559}VShr j; h hG j 9 }S h' j Уh6҉l6X;\;`; d;p6 ~p6ѽt6T6~t6ѽ t6P6X66~6ѽ=X6~.5P6}^RV5T6h j p; P6 6P66T6ؙ=5Ɖ566~6ѽ ١T6t=T6Ƌ X6t1 =(6 T6\ؙƋ X6\1ؙ  ,6 X6 066H6ؙ=6Ë X6\ؙى86<6 6~%<6ѽ6J6t%<6P6@ЙP;T;P6։Dž6TXT扅XTP;T;P;T;~r P;5T;66 66x9~HuDx9ѽ~/u$x9x9ѽ~ t݋x96 5p6t1 P64Ƌt09~56=06 6x<686Tމt\ؙ񉵈56 6~~D;Džl56p;E 6σyσ656ؙǍO} ‰P P6L=D;~= 6扵ؙƍ^}^P9LrL9PDžlP6sۉP6u 4%x9ѥt\ؙ񉵈56 X6ɉ X66T69P6uhWw hsm j6 =X6 6ۉT6%6ADžhx5xp)Éؙ=6Ƌ 6\1ؙى65P6عá6\ؙ=669Eh/=X6"p+x<6|=6=6ؙGWhVh P6H P6=X66HD6ѽt\ؙƉ=6 p;M6փyփ=66ǍO} <25D;~CD㉝ÃyÃ9Hr 9Hs %P6 6p+xؙ=6Ƌ 6\1ؙى65P6عá6\ؙ=669h P6عơ6\0ؙ=669~+p+xPRh ,lu,56h h lt#56h! h hu ltRP659tSVh@h]a T659tSVh}h= j 6t[=6tSh 6JЙ؉6 =6up 6+x=6ؙƋ6t3É6 P64 D 9~Džh 6+ 6p+xșLșÉ6 D 956 P6@D;<86琡6 p;E 6yˋ 6 yӉ<~B ÍK} 89@rf@9vVDžl6+6p+xؙ=6Ë 6\ؙى66=6=66566օth jƶ 9~h# j襶 9=6uhT luhu jg lt#ht h^lthh^ 56hK =6tj 56 p;M6׃y׃Ӊ56 56 Í{}{Ӌ=D;~? 6扵 ƍN} Ӊ1҉`;d;l6Ӊ΋!ى! 66 6 6D664؋56ؙ69~A 6Dž|=6h jQ 66656l;`;d#l66=6ux9mx9p;É4 6dƁd=p;ut;\x;`t;`` x;  6696~?h56h*56h4hXhQ x9`;#l66195x9Dž$Dž 9p;~d$0|9 =l;u 0p; t;Q 6f 9 p;$F95x9pdJX66ؙ=6ӉƉؙ=6׉6 =6ؙ=6׋p;=6 =6 =l;u:|9Ӌ t;Q 6f;u5=l;t x; 6À;q=l;tx; 6ǀ; ۃ=l;u|9p; t;Q 6ӊ* ۃ=l;u|9p; t;Q 6ff X6)Q6=6ÉL6tCL6666ؙƋ=06=46L6K5<6щ9~6 Љ։,!86(ʉ+ 9|UX6șW)Vh h56h jl  6)񉍐 9,!(9u$X6R6Rh7 j X6VVh8  6Qhz L66ؙ=6)66ؙ=6Ɖ5 65D6Dž||t7=1u. 66 6I6))PhW  46 6L6`;#l66P6ډ66~6ѽ56jnÉV|;T  `6\6x6 6 |6Vع<Ɖ5d6686666666U6SfÉ6=15656h56D66Ru h 56T6 6Ƀ$565L6 D6Ƀ$h. <=1u hc Dž\195L6}uV[=16֋ <6! 86(6 6RhW Ëڃ 9\h DžWh h{ F95L6Z=1u h =5t=1u jS u U@6h 65 =5PDžWVR+5P69~St666P P669|195L6~Uh 656֋ <6! 86 (66P7 F95L6UB  T6JX6B f 6fJ=1t1j`} ] jѦ jʦ jæ h)` [^_Panic: cylinder group too big U0WVS] E6E6‰U5D69~u <6#M 86M (6ME46E}u6J5T6=T6}M VM56h1> 11U E1L6J9u6=6f1 6f16f1u+u51=D;~=X6P242 6M܍82 p;HU<2s}suƉ5@2M 6ș=6aM 6M܋6șEEy MMEt0H2t5L2=6]EܙÍ{}{Ɖ5D2D2-196}h: j%讧 6 2}uV1}_=1U u<21ô4}w$) 2Gv1w1P69s 1`6ÀFP69rh65P6M 6<6#E86066P =X666E6ؙ}9a}i19uU=X6S=1U u=@215Wh 6 =D;~*߅}{L2)116=6߁=1U u421426ؙ=6Ӊljؙ=666]]ؙ=6p;ӉU܋Eܙ=6EE܁=1U t}䍜2Ë82B1]f5X69uM H61+EH65X6Eׅtv)2EX6)9u}Y]}=1U u@21ø5}}$M)2E9u|uX6MS=1U u=@215Wh 6 =D;~*߅}{L2)116=6߁=1U u421426ؙ=6Ӊljؙ=666]]ؙ=6p;ӉU܋Eܙ=6EE܁=1U t}䍜2Ë82B1]fX6ƉÍ3E+E9]+]9}f)2}~=1U u@281Ǹ5u܅}NM܋E$)2F9|=D;5H21L21EL21EE1U9P2~\M܅MtE&}tD;E9E~EUEte MCEG9=P2}tD;9]~]E16 2 616261M1Q 2EH2P h15P6M 6<6#E86 ,6M6EP8 e[^_UWVSU0V8V@V=1t f VC f VAf"V=5t jhtjhdÉډ(V ,V VR5T6lj=HV(V ,V`; d;l6É]u#U#M Vh15T6 6R?jh V?e[^_UWVSMEE11E H9}S1fDf $fD%PuRUM MDE)E UFE H9|f}f|D $PuR谎 e[^_cg 0: bad magic number first cylinder group ran out of space internal error: can't find block in cyl 0 U WVSu h156 6,6P =1U thj=1uhZ19=1~K=X6P=1U u@215Rh 6` u!=X69=1h 15 6Q=1U u@215Rh 6MMʅ}QL2) 1 1 6VJ @t166=6=1U u421 42 6Й=6ƉЙ=6 66ʉЙ=6p;]ӉЙ=6Ɂ=1U t2EƋ82B1f ]9P6T6TЙ=T6VX6)Z X6)ȉE62295X6~c>}=1U u@21¸5U>х}JM+M]E]F95X6h156 6,6P'e[^_fsinit: inode value out of range (%d). U WVS} \UËEXlh1566,6P =1U th j輛 2<21h1566,6PA 6VJ6 L6 9rWhe j . 1Ƌ6ދ <6!Ή8606156Ƌ 6扵56㍅P5P6S156=u 5P6SZ[^_Ujf getrlimitsetrlimitUWVS]=1ujؚ 譝 P1 2!)Q蹚 ƍ}}Wj=O } hl UMUMujM } hB })=51 ҉!Ӌ59v)ډ5t S3 1e[^_UWVS}u VÃtVSWa W71e[^_UVS]] SSV. e[^Useek error: %ld rdfsread error: %ld UWVSu] }=1tSW55RƇ |j-5EUuu5Vo EU}}Vh h j!t SW5V 9tVh h j"D e[^_wtfswrite error: %ld UWVS]u }=1tV55RW =5uj-5EUuu5V蒕 EU}}Sh h j#藗 VW5V诓 9tSh h j$d e[^_isblock bad fs_frag %d UVSUu ]B8t>tSutuj<3%p؃ ‰0؃ E‰ك‰0 8%r8h h,|+ 1e[^clrblock bad fs_frag %d USM] EQ8t3 tLbt uVb  E - q8h h,|+ ]setblock bad fs_frag %d USU] MB8t3 tL^t uR^ʃ ʃ U)r8h; h,|n* ]COLUMNSUS1ۍEPhht@j近 t]u"h  tP ÅuP؋]Uuu u_@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $Id: ping.c,v 1.8.2.14 1997/09/14 19:40:04 jkh Exp $I:LQRT:c:adfi:l:np:qrs:vinvalid count of packets to transmit: `%s'-f flaginvalid timing interval: `%s'invalid multicast interface: `%s'invalid preload value: `%s'-l flagpacket size too large: %luinvalid packet size: `%s'invalid multicast TTL: `%s'cannot resolve %s: %sgethostbyname2 returned an illegal address-f and -i: incompatible options-f flag cannot be used with multicast destination-I, -L, -T flags cannot be used with unicast destinationmallocsocketsetsockopt IP_OPTIONSsetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFPING %s (%s): %d data bytes PING %s: %d data bytes sigaction SIGINTsigaction SIGALRMsigactionping: recvfromUWVSjjj\z X <d PD XDžhDž`Xh u uK -$Pht@ , W jV5LAË 8u9Lt wu5Lh! j@8|  X W@/ t<hL jMM{ Wjh{ qjV5L2AË 8u9Ltv5LhT j@{ WP5L u5Lhr j@e{ WjV5L@Ë 8u9Ltv5Lh j@{ # t<h jMAz Whn WƅV WH W5L`( W W W WjV5L?à v Sh j@@z 8u 9Ltu5Lh j@z jV5LV?Ë 8u9Ltv5Lh j@y ؈ W= W-} 7raE)Ѓt M 1V} jhXv" XhXSȦ t XujS萣 ƒu5<蘸PSh jDy Xz vhjx BXh2S EX WЃu hJj@x t'X%=uhjj@x Wt'X%=thj@[x v ,XlP ƃuhjEjw Wu)9~Ћ`A`B9 %XX}d=<hjGw DžW@tjPjhR =W}jPjh5X\ W t@ƅƅ'ƅj(Pjj5X# } hjGhv Wt+jPj j5X } hjG4v Wt+jPj j5X } hjGv Wt+jPj j5X } h2jGu DžjPhh5XL =Xu,55Xm P5XhM 55XhjƲ DžDžDžpjSj譅 u hjGu DžjSj脅 u hjGt Dž"jSj\ u hjGt ]Sj t2U4$XUSjjЁ hhuWu jXg WtPDžtDžx'X牽|tPjj|PBP蕄 ~bDžppPSjlV5X8q }=<t,h^ SPV0 Xt9X} X3 UX@@US Xt9W} 5|=Xt3}E Em$[mu  EpEEjEPjU u XS7 ]sendto%s: partial write: %d of %d bytesUVSXXfXWfXXfXX=uу 4X=,XtjhXZ ShX?fXjhXjShX5X |9tI}0Wt=<7uh NHh3r PS5Xh:r WWujhj΁ e[^packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%.3f ms (DUP!) wrong data byte #%d should be 0x%x but was 0x%x %x %d bytes from %s: LSRR: 0.0.0.0 %s (same route) RR: NOP unknown option %x@@UWVSj]S蜩 MME9E },WdMqh Pu hVq FM)M }π?<G9X!XEE=,XtyGPSipM}UEEEu EEu G=4XÃs(X XÈ4X1ۡW5tjhjR GPMqf Pu h/ MAPh =,Xtuuh t h W t hګ _EX95M8tq%PPVh蜫 _95}F$)ȃu hd PhS FC95FCE95sqWt =Xt;X9GG 9XMq Pu hŪ W ]}; t=tEh.f EC;CCCЉCЉCuh6 P Ph? En {x{ {념h{j H pC;C3E9~$95VuOE9uEVhVSi u2Wu)hCk F}Fƃ)u5VVhVSo hQ0 CCЉCЉCuh6 P Ph?ܨ E~O {x{ {느h{j ( thW薨 Ph\肨 MC}Wu1 {x{ {h{j Č h{\ e[^_USU ]1fE~u EE ffE%]UUM B+ABy B@B ) U0X %ld/%ld packets received (%.0f%%) %.3f min / %.3f avg / %.3f max Y@U0X0XPRX(XtP4$$t$Wt#R $P4$$5W5Xh"h,| --- %s ping statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, -- somebody's printing up packets!%d%% packet lossround-trip min/avg/max/stddev = %.3f/%.3f/%.3f/%.3f ms U4SjjXx jjOx  {x{ {h{j  h{Y 5Xh#{ 5Wh#k 5Xh#[ (XtPh#D Wt=X9~h $$ %)ȍљPh/$  {x{ {h{j T Xtm=,Xtd(XP$U=$:$PRuu̡PRh@$^ ,=$Xt']Sjt teSjjt =Xt jz jz Echo Reply Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set (MTU %d) Source Route Failed Communication prohibited by filter Dest Unreachable, Bad Code: %d Source Quench Redirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Bad Code: %d(New addr: %s) Echo Request Time to live exceeded Frag reassembly time exceeded Time exceeded, Bad Code: %d Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Information Reply Address Mask Request Address Mask Reply Router Advertisement Router Solicitation Bad ICMP type: %d US]]$,)x)++)<*L*++*h+t+*+ +,+8+D+P+\+h@&Π C $))))))*$*$*$*$*$*$*$**hL&:hi&2h&*h&"fC%Ph&'h&h&6 CPh!' hA' Ct t7tt(hP'ha'ho'h'Ÿ CPh'譟 s.Z Ph'Xh'莟 Ctt h'h(f $CPh!(Q CPh>(= CPphc(& bhn( Vh( Jh( >h( 2h( &h(ޞ h(Ҟ Ph(ž ]Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1lx %04lx %02x %02x %04x %s %02xUWVS]4{h+ fC%PfC%PCPƒR%Ph+ߝ fS†%P†% Ph+諝 fC %PC PCPh+舝 s X Ph ,u sW Ph ,b (PGh,M N {x{ {h{j 蜁 e[^_%s (%s)USWujjUR à u umW 'u`W P3h<-hhV- V]TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) US]S C <u%AQPQPh-'<u%AQPQPh- ]patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x UDWVSM ʀ9t3=wm1uhb.j@^ B:u΍UEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPRh.Q8 ƃH~31ɸ)9w&E19}D}:C9|9MsWu:h.褚 1ۃ9}};Ph,膚 C9|h.t e[^_usage: %s [-QRadfnqrv] [-c count] [-i wait] [-l preload] [-p pattern] [-s packetsize] [host | [-L] [-I iface] [-T ttl] mcast-group] US]j/SI( tj/S:( XSh/h,| j@up Uuu uhaltlnpq???halted by %srebootrebooted by %sshutdown~SIGTSTP initSIGTERM processesWARNING: some process(es) wouldn't die (can't restart init): %s%sUWVSh0j/M 1' t@M P txX11E1ېh0u u4*  2$2333333333333333333333333333333333333333333333232322E@ t<jjY tVjjjY ub{ÅuX P20t=xXtj"jh0葟 Sh0j"jh0z Sh0ju h1h1h 1 , }ut jjj uh 1jX jjh jjj uh1jX jM }u j8 j jOj u =<t(/P Ch,1h,| V$5<[ Pjji 1uT1Rhk1jX usage: %s [-nq] U0=xXt0Ph4h,|f j/l Uuu u./restoresymtableTAPE/dev/rst0b:cdf:himNRrs:tvxyillegal blocksize -- %sblock size must be greater than 0%c and %c options are mutually exclusiveillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specified.Begin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure UVS 5j?T }h25a Ãu75E PMQhA5u u%ƒ "B+ $078090909x80909090909090909090909090909097<8L809\809h8x8090909809090909x88x809909x8 9j P5L肕 ‰ 8t5LhT5jnU hl5jXU LtPRh5jU ]M=j P5L謔 ‰ 8t5Lh5jT h5jT {a)EE =u h5j5T hЃPxV u jjN -UP6P* >t'}uU-BUEUUBUEU:P}tUUue[^_/addcd%s: not a directory delete%s: not on extraction list extracthelp directory is used If no `arg' is supplied, the current help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%slspwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help U< WEEE@E0tE$TE|tETEThPhP?l h]St4}tEEEP蟶8]EPhPPP9$hCBFIIIIHIIIIIIIIIIIIIIIIIIIIIIIIIIIIPDIDDEEIIFIIIFIIIFhGI4HIIGtHG0HPhR?R赂 WyB=tWoh,VPW'0HPhV?RA *WxP4uWhY?h,|) WPς 0HPhn?R W"7t@uWhu?h,| 4h WpW&!0HPh?RQ :Q j/=t0HPh?R h?h?h?h?h@h-@hS@hu@h@h@h@h Ah#AhEAheAhAhAhAh,| L)0HPhARU >PP0HPhAR uhAh,| PhAh,| m0HPhA0HPhAR} f}0HPhARI 2=t!hAh,|N h Bh,|- 0HPhBR~ jo-f0HPh$BR~ u~R/0HPh)BR]~ uJ=t!h/Bh,|f hCBh,|E PhVBh,| restore > %s: out of memory UWVS] u~=8h@Ih,| h,|4 5xhh|XF x@ tAAC]=|X t0|XHzXzXJ< t< tBSh|XN‰^4:uuu} 8h|X58ƒ:u 88=|X/uuuh|X 4uSe} hP?S  h|XS~ uuS{$FPjj@uأ}v4hKIh,|_ ~t@FFF+FV4u| FHNuFPj[^_command lines cannot be continued missing %c UVS]C< t< tu ntr<\uCuhEKh,| I<'t <"tCF8C8tt CF8uCuPhhKh,|V K < t< u؍e[^../canonname: not enough bufferspace ..UWVS]޿LtjhLSz uLU ,;/ufLU ffLU fLB0} ҉ЍD9EwhLh,|p j-Su | ] ރ;tC/u] ;tlCހ;/t ;tC;/u)u>.u NSVz )ujh=LVy uNE @9v N>/t9wSVsz 돍e[^_ls: out of memory directory reopen failed %s: U$WVSuV ÃK=uH $V &EEEEPS&} 0M܉҉U]ӋEU9~u44މuV3lj}0҉UfEfHfECEud$ÃtEꐐu%M IP1F EuhMh,|@ -V%Eu hMoVhMh,| EMM u#Ãtoti=uJ sɃ=u)SֿLtֿ=LtuE SE낐u$}tBhUj uuU uu}t0} w29}vhMh,| uE e[^_Warning: undefined file type %d UVSu] FP1Cƒ:t=u <^v?B:uf+SfS=t!H rC ^!39*t@tC *C F w;$QtQdQlQDQtQDQlQDQQDQ\QDQdQFPhJPh,| .C @*C ="C #6A(uC /C e[^%*d %sU(WVS1EEEE @M M]9s>S 39usur9}z tE: tE 9]wȃ}tG}tG=t+Eu؅~E ƅE|8GQEuEM ETЙ}E19EM9MvuE@M=t%3uhQh,| fCf@fEfC}tLC E 4|4|}9D|} t,|E؈,|h,|u[ fCshQh,| }tMK M 4|4|}9D|} t,|E؈,|h,|uC[ fCE@ E9rhMh,| Y[9}< 4|4|}9D|,| ,|h,|j Z C9|ċMMEE9EF9ume[^_UVSuVÃtYt=uP sɅt-|\C\C@Ph\CP; |\1e[^UVSu u<Ãt#=u"H r3$ufF@fF1e[^UUE prs restore interrupted, continueU=iu=]tjh]hUhujh%leafdir %s%10d %s UVSu =؍F s?=t#U}uUPhUh{` uVhUh{J ؍e[^%s: not on the tape ./%uUlWVSu}=%EE H r =VhVh{ w=u'u h$V]SX ރ u u VK!Gu `$ÃtS&PVq tWu V'à uS_KEe[^_UVSu =؍F sV#t`؍e[^Mark entries to be removed. %s: REMOVE UVS=thRWh{ 95hVj#ÃtwVr^=tS%PhoWh{Y {uSr`S(S ]s$]C ][uF95hme[^corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %d) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state UWVSEE1E H sGu"ƃt,vO!Ãu hJXd9tEu &!ÃtCt9t,@uuO9tK}uVC^V%/׃=tVY#PhbXh{ VZ1t%t C9Eut F9Et2$Z]![t[`[|][Z \]]]\][]\KM}uVl]V% VZuu u=# }uPE[EH=P}ufCu6 fCCu*uS)"PZuS%K{uES!PuhX E Pu u"H =P`PuW+PhXe}ufV`\V $E Pu u="}uPEZEH=Pr`PuWPhX}uNN=`VfCthXS^?{uVu ^Ãt+{thXS^S[S<#[uuu uh!SY5 u SXs]C ]uu u+!ÃK=Ss_PuWPhXh{ w=tuWPh Yh{ EIu uh$YuWcPhFYh,|x uWCPhcY`Ee[^_|NIL|ONTAPE|INOFND|NAMEFND|MODECHGUS]]]^]]th^h]Xk th ^h]Ak th^h]*k th^h]k ]]Find unreferenced names. %s: remove unreferenced name unreferenced with flagsUWVS=th^h{2 9=hWƃth~tbW sI^tBf{u1=tS*Ph^h{ SXS [uG9=hw5]td^tT{uFf{th^S[=tSPh^h{N SmXS [uv ue[^_Remove old nodes (directories). cannot remove, non-emptyUWVS=th*`h{ 1]]t*{ts C SWSoGuمu]thK`SZ[ ue[^_Continue extraction of new leaves Extract new leaves. %d: bad first %s: not found on tape expected next file %d, got %d unknown file on tape unexpected file on tapeUWVS=Ru=t@h`h{ ,=thah{p 5u!jiXƋ=VRXƃ95$vKVÃuVh)a\SiPh8ah,| cVXƃ95$w$9tPVhOah,| =XVÃu hna\CuhaSXCt SUcSP9c9tPu ==h9$e[^_Extract requested files UWVS=thch{ ,j/<jVEhHPWE uVEuVE9E29$v(,j/9<4M9 $w5$wVƃ=95$s9=u <95$r;G9t9X95$vIVÃu hJXcZSJPh8ah,| cVUƃ95$w95$9uV|Ãu hJXZSP7c9=*;e[^_Add links UWVS=thdh{4 Dž9hvyƃtH^tACt3VDPWb ~ujjS(PWT c[u9hw[^_Check the symbol table. incomplete operationsUS=theh{E 9hvVSt?fPрfHxufPfxthePE-UE@uC9hw]Warning: missing name %s missing inumber %d type should be LEAFUWVSuVÃuVhvfh,|k 1Su ,9t1t9t@uuu hfW{u}t hfSNTe[^_Extract directories from tape /tmp/%srstdir%d-XXXXXXwrestore: %s - cannot create directory temporary fopen: %s %srstmode%drestore: %s - cannot create modefile /opendirfile: %s Root directory is not on tape US=thPgh{ 5hoghughF  %d) UWVS=t;}} ]9Jf;tVS#V= 9r"19u ]=dtShoC=t;t=duCCC%)fCu9C $9=thoh{ Ct=thoh{ SC $9s=t/PRh1oh{ =thsoh{ փ;S[^_US]fCf $fC%"=~8"f)f5tmhjh"CP"PS ""C‰"]U塘"f)f5tmj5"hi5tmpm"UWVSu] hS CjV{WT 0ȈC%f f%fCe[^_bad seek pointer to rst_seekdir %d UWVSu] }V/9tV)ySh/rh,| jځQR6O, ځVthV R6* Fe[^_error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d UWVSUzu;hE P2T* UB =t`hrh,| OUr9r B먋U\2 fKft)9~"=tPhrh,| 1XUrusgB9hw&=-Ph sh,|5 ؍e[^_UVSugIt,Pbƃth_ËFPPS1e[^US]3^) ST! ]US]jjj3D* +SC]USjuޞ Ãt"h J t @S( 1]Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rcannot open mode file %s set owner/mode for '.'cannot find directory inode %d error setting directory modes UWVS=thth{W [^_End-of-input encountered while extractingWarning: %s %s U=#t!=,u5 hChm0  },(h$=#t#jhvc=Cannot have multiple dumps on pipe input ioctl MTFSF: %s Ut~=uu="thh,|ߛ jhfEHE=#t Pj+ÐEPhm5" }5< Ph,h,|肛 Dump date: %sthe epoch Dumped from: %sLevel %d dump of %s on %s:%s Label: %s Uh` PhКh{ =dthd Phh{ߚ =t8hThh5hh,|诚 hhh,|蛚 %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) %s: cannot create FIFO: %s extract special file %s %s: cannot create special file: %s %s: cannot create file: %s UWVS] ,(@E(JȿƉu(@E(JșƉu=(7`+ 53@t\&t VShj=Shқh{诘 =t/St ASh =tShh{S 5$SvzhĤhPt=zu$=Shh{ jShv+VSV}5< PSh9N(ptppSGVS`k =tShUh{s =u|(p(VS轳 }5<o PShn(ptppS˷VS=tShh{ =thhS$t v |I(ptppQtV5v舳hȣh<5v EPS두5< PShh,|X +1e[^_U\ttU,h0h0gran off end of tape not at beginning of a file Missing address (header) block for %s at %d blocks UWVSDž =\u hC=tlt hX=#uhv(6#19Ftw P"Ѕ} 9 PVMDžo~A~  PVMDžPhrM у*C9~.t WC9C9h\ u=~4=\=t5v5 hth{蓓 ~ PPMуh\r#[^_write error extracting inode %d, name %s write: %s U=uHu u5v u/5< P5 5$hh,|Ȓ jQseek error extracting inode %d, name %s lseek: %s UU jQR5v u6u15< P5 5$hh,|: jsymbolic link name: %s->%s%s; too long %d UUzE z=~&PRhv5 h"h,|ʑ jSRhv% unallocated block in symbolic link %s U5 hh,|t jUS] S5vu* v]hole in map US] hv]Umid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %d continuecontinuation failed: %s End-of-tape encountered UWVSr9r~hu rRr.1ۋ 9}r1ҐDC9|=ru r5 uE=#tuUrR~à uUrR5" à ="uB9r}+~'=th5h{8 r="t u}*~g 9tZ="t])]}?]<t=tRShRh{Ž ؅} rhwh,|蔎 ,t:t#thhh,|a (5 h5$h̥h,|7 =uhu j S5rO =#tjS3+jމQR5"b 1ɃuuAt"5< Phh,|蓍 j=thh{l ="u,BrRSux}t RWhR HhUrRhr rhu5rr v#e[^_tape read error: %s is not a multiple of dump block sizeTape block size (%d) %s (%d) Tape block size is %d US1 9}r1D@9|r=#t P5r P5r5"* #5< Phh,|谋 j9t!hhPhթh,|臋 j r=tPhh{Z ]U"|=#tP Note: Doing Byte swapping 8l4s31ll2lNote: Doing Quad swapping gethead: unknown inode type %d UWVS]=SzSltBR=l=du%=th h{g dSI=dKSh;RhCxRhEVhSA SS S S{SSf fS f"fS"$&(S(K,,SHTS0XS8\S@`hRdR ku Vu1@ClK(u{,tS,w uFv>fS ff@u.=zu.S(K,uthH z=ztS(K,ȉщ‰S(K, Qwx$<ffOC S(K,19~A@9,xu CQhcY=t{${&=tS[^_oldnewVolume header (%s inode format) begins with record %dDump mask headerRemove mask headerFile header, ino %dFile continuation header, ino %dEnd of tape header; predicted %d blocks, got %d blocksUS];ud=tPhh,|譆 |tPhˮh,|萆 hh,|~ #=#rwi$,<X$h:h25#h5#hh,| h:h,| vHr9tPRhMh,|Ņ hh,|賅 1҃;t19}tB@9|rvrC#]unexpected tape header unknown tape header type %d resync restore, skipped %d blocks UWVSu },($~lt#Vt9FuH$ܱt<hP\19~3t WC9Vbt 9Fta#ᐍV (F$Eh$8 ,  h > 5\h!+ >#~Ph>h,|蚃 #[^_Checksum error %o, inode %d file %s UWVSu1=du>Ku6VǃKuIu !5 5$Wh˲h,| 1e[^_UE Puh,|` UVS]u NxKNy؍e[^UVS]u Nx#S BJJB Ny؍e[^US]M xht89]0|Xst# lt0Fwt=ҍDC;uRQ8uRQT uC1Ҁ;u]UURhC_EUVSuj/VAQ tNÀ;tG;/u9Vu"jV0VPEEH/C;ue[^mktempname: called with TMPNAMEUWVSuF thVHN V_PS 6[VUPlj>0ȈFV"PS[^_not on ino listRSTTMP%s%d%dUVSu1vRt9tC@uuhVvShhhzR ze[^warning: cannot rename %s to %s: %s rename %s to %s UVSu] =u0SVM}"5< PSVhh,| =tSVh?h{ e[^newnode: not a nodewarning: %s: %s Make node %s UVSu~thVVÃ=u4hS՞}"N@5<C PShɶh,| =tShڶh{~ e[^removenode: not a noderemovenode: non-empty directoryRemove node %s US]{thlS{thSfC $fCSÃ=u-So} 5<a PShɶh,|$~ =tShh{~ ]removeleaf: not a leafRemove leaf %s US]{thNSfC $fCSÃ=u-S@ } 5< PShɶh,|t} =tSheh{W} ]warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d symbolichardCreate %s link %s->%s UWVSu} ]u,=usWV蘚}e5< PVWh/u;=uBWV'}45<y PVWh/h,|;| 1BSh\10=t!VW~uuPhh{{ e[^_US]9hv#St xt@u C9hwމ؋]US]vSnt xt@uKw؋]bad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s NODELEAFentry type: %s inode number: %ld flags: %s US]u hҺh,|z SPhh,|z sPhh,|z ,CtPPhh,|az CtPPh h,|Az CtPPh"h,|!z C tPmPh6h,|z T{uOPhYh,|y shih,|y SFPh|']|NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTEDUS]~~~Cthh~ C thh~ Cthh~ Cthh~g Cthh~O C@thżh~7 ~]%s is not on the tape UVSuV:1ۅttC rVhh,|ex ؍e[^%s? [yn] UVSuVhh,|8x h,|~ xBHJHy R C;xBHJHyR  u tx@ u uytnn1e[^abortdump coreUE Puh,|{ =u4hu"hu{ jѻUWS]0P tSP hj v =|1e[_Lost connection to remote host. on %s: %s%sU0VSh=|#j ]Sv 5|# DEEEPjjSFVc tOhS5|#e ~1Ƅ(( uRS5hj tcpkshellshell%s/tcp: unknown service who are you? RMT/etc/rmtlogin to %s as %s failed. Connection to %s established. IP_TOS:IPTOS_THROUGHPUT setsockoptUVS=#uwh=tP #u%=tPhj [ P@#uhjp j@5 Ãt*5Vcuj= C #0h ÃuhKh|#SV#0#@PhA}V5h 5hh,|s  E =~EE+jEPhh5X }EE=jEPhh5X EjEPjj5X (} hC e[^invalid user name %s UWVSu>tZÀu9vS  zD5%u_t-tWh1 F>ue[^_O%.226s %d UVSuu VhhS5 x#SV[^C closeU=x#uhhQx#R%d readU$WVS}u h/j]Se5 Sh4ƃ} 5<619}.)P;P5  EE9|ԉe[^_W%d writeU WVS] ShjuV4 0HPV5E Su56 (he[^_U WSuhj]S}4 0HPS5 e[_Uu u5 Uh{L%d %d seekUPSu uhjP]S4 Sh]S statusUVS=x#t11hh}1CF?v򸨋e[^I%d %d ioctlUSE |'PuhhSi3 Sh&UWS] 0щHPS5 ‰0щH 9tuDe[_%s: %sProtocol to remote tape server botched (code "%s"). U WSj]SU<w8hSSuh}Fu x#GAt70ЍD9v H8 uEPhEP [_UjEP5 tEProtocol to remote tape server botched. (rmtgets got "%s"). UWVS}u ~< u C'CNh WhTe[^_Uuu u -i count in_fmt -o count out_fmt [arg0 ... argn] scsi -f device [-v] [-s seconds] -c cmd_fmt [arg0 ... argn] scsi -f device -r [-b bus] [-t targ] [-l lun] scsi -f device -p [-b bus] [-l lun] scsi -f device -m page [-P pc] [-e] scsi -f device [-v] -z secondsusage: scsi -f device -d debug_level%s %s %s %s %s %s %s %s Uhhhh0hehhhhh,|k (j ceprvf:d:b:t:l:z:m:P:s:unable to open device %sUWVSU2U :1hdWVH ;|$``````````````````````````````````h,`````8```` ``` #j5L\}5Lh|5<Zjj5L   2jj5L # jj5L # jj5L # jj5L # jj5Lq # jj5LU # jj5L/ # bV+5aU2aNjU :ue[^_Expecting an integer argument. %s: %d UWVS]} 9C|hh,|jh 5jjSC4 C =#tt?t VWh* e[^_Expecting a character pointer argument. cget: %s: %sUWVS]} 9C|h0h,|g SC4BS=#tt VWhY e[^_%s: %d %s Unknown format letter: '%c' UWVSu }E=#tt8tPh4 ct$ bt[itztLuhHGP WuSO zuG|: uJHyShVh =#t% {x{ { h{j e[^_get "%s". Uu hh 1-o-iNeed either "-i" or "-o" for data phase; not "%s". -readWarning: only read %lu bytes out of %lu. writeWarning: wrote only %d bytes out of %d. U WVS} ]um>E]uEu=]ShWjjjuLE 9E|EUB EjjShÉ޿1t FO)ȃuEu@޿uEUShh,|d j]SAuF EjSEu~ F }U&utÃ}~ uSj E ~ )EÃ}}uh(4 5< }uGUB P+EPh-h,|d Uu)V uPWd ShuuK#uFVuCWuVjh,|*U5< UBXuz\tujh,|T }}E&unUZ}~"uSj= E ~ )EÃ}}}hWh3 5< }uZuF P+EPh]h,|b >jhuuB {x{ {h{j 4 e[^_Your kernel must be configured with option SCSI_FREEZE. SCIOCFREEZEUjh Q u u6=<uhh,|2b hj2 5< Hit return to thaw: U}uch> h{/ jh Q 5d {yh|{ |{jh Q 50ÐsURh Q5 =#tC {{}9{{{h{j h{{ jh Q 5 =#tC {{}9{{{h{jT h{ 1A 0 v:2 {Page Control} v:6 {Page Code} 0 v:i1 {Allocation Length} 0UWVS]uSu ` "9SVuhju SWGPuS0uWjh,|Q5< GXu\tWjh,|xQj W莿 e[^_15 0:7 v:1 {SP} 0 0 v:i1 {Allocation Length} 0UWVSu]k8VSh^ju VW^FPuS$uWjh,|P5<A GXu\tWjh,|Pj Wھ e[^_UVSuFPVHyV"  vS zD5u#u6FPVHyV   tuzVS]e[^/usr/share/misc/scsi_modesSCSI_MODESr%iExpected %c. Stupid program: Buffer overflow. U WVSh t#h5#1 ƃu1?EEVEPhVːU9UuEV~FPVH}V {u%{tj{hh,|{] jD FPVHyVZ  uj}hh,|3] {uG}uOt?}t1 t,}vhh,|\ j UBUw}UƂ1}te[^_UVSE]SEPj 5jSj t:5n t h, h t h, e[^tmpnam failedwUhuhH, 5< h&h uh, 5< h`Can't edit format %c. edit table overflow UE itbtPhh,|`[ j) ?vhh,|>[ j  } BUE UitbtPhh,|Z j @Can't report format %c. %s: %d UU t:itbtRhxh,|~Z jG uuh5^Z fgetsExpected "%s" and read "%s" UTWVSu E5jP]S uh,* 5< 0щMD щHPSV ƒ tSVhh,|Y jZ jj0)ˉ]S vЍe[^_EDITORvi%s %sUWShͺ Ãu5 0ҿЍDPͷ hShW W\tWj hh uh( 5<s e[_editdisplayNo mode data base entry in "%s" for page %d; binary %s only. Sorry: can't edit without a format. It only makes sense to edit page 0 (current) or page 3 (saved values) %02x%cUWVS]u ǃu3=#t*tPu 5#hh,|W uhh,|jW j3 #tth(h,|CW j #u jhSu\sjhWPV7(u jhuOjh8WPV6jhWPV6<jh WPVE>CPPS ƅƅ ~?ƅ=#%PDPu7j u 5#hSuStuk19}6Z u P2Pho ڋ9| {x{ {0h{j "#jhWPV\5[^_12 0 0 0 v 0For bus %d lun %d: %d: nothing. SCIOCADDR: %s scsireq_enter: %s s8 c8 c16 c4%s %s %s Ut6Ã>uSr /rwrorq%s: unknown mount typeUWVS;UÅst݋st(stsusmushaPo0{P褫 ƃu jjJsVg .1Vut1e[^_%s: not currently mounted%s: not a directory or special device%s: unmount from %s Cannot MNT PRCBad MNT RPCUWVSuSVju VS ލURVO) }8SjVǃ SjVǃ u~VhdfUff`u RjVmǃ uLVh2f@u%RjWDƃ u#Sh Vh虣j@V Ãt%uSRT@@j:V Ãt#uV!s: Dž7`=(tWVho =;5,Wg}Wh.jj]S EfEq Q2URa Dž|DžDžR|jhSC Ã0uh#t oOGDžtDžxSxtjh VhjS҃ th2S J RQҋSSR1h[^_getmntinfoUWVSjEP1ǃuh9蹠191ۃ} u6uEP u}t ED,UE؃LM} u6uE؃LP u}t ED,UEF9y1e[^_UU u$Ð=%Ð9t8u=%empty type listUWVSutuhYjt ;,uGC;uPO Eu jj1tAj,VT ÃtCVUuVhjcGuUe[^_tfsext2fsdevfsunioncd9660afsprocfskernfsumapnullportalfdesclofslfsmsdosmfsufsnoneUVSu$=$t&3V u -$ ;u1e[^US]t?$t63P, t'j.34 t!35$ u P[;tC35$ߠ tj.3 t35$踠 t;u1]UhE PuD umount -a [-fv] [-h host] [-t ufs | lfs | external_type]usage: umount [-fv] special | node%s %s Uhhhh,|E jݯ Uuu u$Id: mount_msdos.c,v 1.5 1996/09/14 02:57:52 bde Exp $unionrdonlysuidexecdevautoatimerwrou:g:m:o:"%s" is a relative pathgetcwd/using "%s" insteadstat %smsdosvfsload(msdos)msdos filesystem is not available%sUWVSu] 8DžDžDž Dž$jtjEP設 hSVdiƒ mta?gt1otku5LEDž롐5LmEDž 냐5L]fEDž_j$Ph0%5L;aB9tt>/Vhh(SuhjG0щ)PhSd0щ)PVSdVh葚 EE$t EE tt u],PVM u VhjGPu 8E u nu~ou EE] ;ti0щOWRV ƒ ut =t;uƃ;t)U{ tUE9Cu [ &C!=%uVhRj>19u| e[^_Uuu u/$Id: mount_cd9660.c,v 1.7.2.1 1997/08/17 13:30:23 joerg Exp $rripgensextattupdateunionrdonlysuidexecdevautoatimerwroego:rs:vcould not determine starting sector, using very first session using starting sector %d cd9660vfsload(cd9660)cd9660 filesystem not available%sU|WVSu] 01EEjpjEPg E hSVb d7L$\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\0<\\TMMEPEPhp&5LM5L EG_a)ƍtD3[]uEMEEE}u=V1Eut h EtPhZq htÃuShtt2ht@t h{jG轐ht9Ãu hjGLEPuus$~Y}VhjGrj詤 usage: mount_cd9660 [-egrv] [-o options] [-s startsector] special node Uhxh,|~9 j@G U,WVSju ÃPhc@S趠 uSȠ )ǍGdƅ ‰PhcSO tSa |+ DuHy|D[^_,-o %s: option not supportedU WVSu Eu jj̎uhV}:ƃ>nu~ou EE] ;ti0щOWRV艓 ƒ ut =t;uƃ;t)U{ tUE9Cu [ &C!=x'uVhj辎19u e[^_Uuu u{$Id: mount_nfs.c,v 1.14.2.2 1997/05/14 12:06:34 dfr Exp $nfsv2port=tcpsoftnqnfsresvportmntudprdirplusnfsv3intrdumbtimerconnbgupdateforceunionrdonlysuidexecdevautoatimerwroUUE Mt8} "t t@t !"t  t@t "t@ t@t @ "@t  tf8} "Bt  t@t "Bt  tt Ð"BtÐ 23a:bcdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:Uillegal -a value -- %sillegal -D value -- %sillegal -g value -- %sillegal -I value -- %sillegal -L value -- %sillegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %snfsvfsload(nfs)nfs filesystem is not loadable%snqnfs 1/mount_nfs:nfssvc err %mUpWVS')'EE}|)u}hu uLY d΃FP$0000000000000000p0000 00\00000H 00000000000Xd000P00000<`00)j W5L^ ËE 8u}5Lh@jO^4N a )TNKj W5L ËE 8u5LhWj^E ESuujh jh jS҉ƃ SSR҉ .e[^_no : or @ specbad net address %scan't get net id for hostCan't contact NFS serverNFS PortmapCannot MNT RPCMNT RPCbad MNT RPCnqnfs 2can't access %sUWVSEjZuh) j@u tX!j:u誽 uh f]HMwm1҅t&S 4uHSh 谂1zS覫uh 葂1[p h4P2 )tuEEM IEEM a@ M quh0 _=)u)|h j輀1of2f )fMfu;5)uhh0;fEfu)ch vf2 1=)t'M yujjURuhh0URWVuhh0XÃu)h, |W&E EM AtH HM DSuuh@huhjS҃ tP u'=)h; SPhVjJ)ut Ft t#F j FPu| F Puz V B?wvRFPu| tbEPuz tO19}~"EPulz t5F9EuGC9]ޅI} ~9P.1e[^_usage: mount_nfs [-23KPTUbcdilqs] [-D deadthresh] [-I readdirsize] [-L leaseterm] [-R retrycnt] [-a maxreadahead] [-g maxgroups] [-m realm] [-o options] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node Uhh,|$ j_ ,-o %s: option not supportedU WVSu~ Eu jjzuhV}&ƃ>nu~ou EE] ;ti0щOWRV ƒ ut =t;uƃ;t)U{ tUE9Cu [ &C!=*uVhjz19u e[^_Uuu uy/sorry, arguments too long (%s) UWVSu,0׍_vh }uh-Ӷ ƃ, h|{)P,Wa u|0щM\ ~+ uƃ+Y$9ȉE ȍe[^_Already connected to %s, use close first. tousage: %s host-name [port] %s: bad port number-- %s asciinon-printstreamfile8SYSTRemote system type is %s. 215 UNIX Type: L8binaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transfering binary files from this machine. UVS=Tt5hf}h%E PMQ UBw4\f@~FE p衴 f1E pphD覴 E 0h(藴 >PE p@$T^fbfȺddhhflflnfrf t"(uyfzft=(tE pC5=Tu h|EuXtTj hd Ãuj hO Ãt{.uK Mhh tM jhhۯ ud=t ĺfftZhh蛲 I=t ĺt"j hh9 u hP 5e[^LtenexEebcdicimageIAusage: %s [ %s%s | ] %s: unknown mode TYPE %s %sTYPE %sUVSEu ~\6h(̱ 48*=8*t3Ph6觱 ; ;uh?荱 hhh 8*=8*t 3v薯 t;u;uvhC OC t8tPshUfC sh`SCu3h臮 CȺe[^ftp: internal error: unknown type %d UVS]5u9Ⱥ=Tu} u 8*=8*t9Xt8u8uSh+ Cu=thphUxBph`gBuȺ5e[^typeU*h*jU*^h*jU*h*jWe only support %s mode, sorry. UhhR We only support %s format, sorry. Uhdh  We only support %s structure, sorry. UhhNʮ local-fileremote-fileusage: %s local-file remote-file STOUSTORAPPEUWVS1}uEU BBG}hE PMQ t}9hE PMQ u E 0h E pHMP'uE P9t9puPE 8at=Xtt>=`tE p+‹E P=$tE pH-‹E P1ҋE 9puM9HtRE ppS"Fe[^_local-filesusage: %s local-files mputContinue with%s: not foundU4WVS}:h2E PMQ u!E 0h>螬 ]E h&j~ hx@ =ju ǃ?u ؃=tWE 0T%t=;t9=vPe  zD5uC;ù;uNt:=vPve zD5t CFuƍ=`t Su)Ã=$t S5+Ã19u =HuPSW=XtP D==DHHhUhZ$tHp9}e=l=3E 40#=`tE 4v( E =$t S+*1ҋE 9u =HuRSE 4=XtPB==DHHhUhZ#tHVj,j jh E 4u u%E 4hhm =PE 0^"=`t6'=$t S(19u =HuPS6=XtPA=u;=Dt2HHhUhZ!tH%G9}jz [^_r+wUh)"ju uwU=,8u =08t)"G"Pju uausage: %s remote-file [ local-file ] local: %sMDTM %s%*s %04d%02d%02d%02d%02d%02d%s RETRUWVSDžx}uEM QQx}hE PUR t!};h} WEP u U 2h}" EU R} E P ux =U Z;tB3vVI`  zT5уuC;uƀ;unU ZtJ||vR_ zT5уt CFu} Gxt:=`tU r#U B=$tU r%U B}RU r }u9}U rh"%i,8 08G<=Tu U rh"k7RWPRWPh"hB R5~ ƋNy~ؿdӋFx9j9xu Q9|WQ9u 9V A9V u 9V+9Vu 9V9Vu,9~"hhh" L1ɋ] 9Su 9{tQuU rrh"H,8081l[^_ USh&~ h{W =tJ=DtAHH5hZtHjhx6Hjhxremote-filesusage: %s remote-files mgetU WVS}:hH'E PUR u!E 0hU'袢 E h&ju hxD 5u e8u Ѓ=tE 0Wt=tx_GvS[ zD5t#v S腔 z4؋Fu=`t Vƃ=$t VR!ƃ19u =HuPhG"Vh"E==DHHhm'hZ6tH~j[s [^_/tmp/ftpXXXXXXNLSTarcan't find list of remote files, oops UWVS]=u?=luW*GP1 *2=lu7=uP@O@=*})fuV U=\\} t=%PZVG"jP3Vh)C);u} t=%PVU=\h)]S1 *S^ =*uh) 1L5*hh臟 u5*ŧ *ɐj h贝 te[^_onoffU帻+}t+Connected to %s. Not connected. Connected for proxy commands to %s. No proxy connection. Mode: %s; Type: %s; Form: %s; Structure: %s Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s Store unique: %s; Receive unique: %s Case: %s; CR stripping: %s Ntrans: (in) %s (out) %s Ntrans: off Nmap: (in) %s (out) %s Nmap: off Hash mark printing: %s; Use of PORT cmds: %s Macros: %s UVS=Tt5h+֜ h+Ɯ =uAjS=Tt5h+藜 h,膜 j`Shhdhhh2,[ 5lP5HP5dP5Ph_, ,5ؿzP5XnPh, 5LUP5IPh,˛ =`th@hh,諛 h,蚛 =$thhh,z h-j 5<P5\Ph-B =,~8hM-, 1ۃ9,~!VhV- C9,e[^Bell mode %s. U=d%dP/Phc/贚 dPacket tracing %s. U=ܿ%ܿPPh/l ܿHash mark printing %s (%d bytes/hash mark). U=\%\PPh/ \ thh0 h0ۙ Verbose mode %s. U=%PPhw0蜙 Use of PORT cmds %s. U=<%<PPh0P <Interactive mode %s. U=H%HPPh 1 HGlobbing %s. U=l%lP;PhX1 l%s: bad debugging value. Debugging %s (debug=%d). US] }~+sK }+sh1W ]=T%Tt  %TPPPh1 =Tƒ]remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD XCWD %sU}7hg2E PURM uE 0hx2S ÐE ph2)u2=u&=t h2 E ph2j)usage: %s local-directory Local directory now %s getwd: %sUSU]  B4*Ct3hX3艖 zCP7u ]s`#}sh"Z5St Shs3 Sh3uZusage: %s remote-file DELE %sU}7hE PUR uE 0hU4諕 ÐE phl4'mdeleteUS}7hH'E PURE uE 0hU'K E h&jg Ehx ju Ã;u ؃=tSE 0tShl4.'=u=DtHHh4hZ tHfujf ]from-nameto-name%s from-name to-name RNFR %sRNTO %sU}h5E PUR t}4h6E PUR uE 0h 6̓ ËE ph!6 &uE ph)6&-usage: %s remote-directory local-file LISToutput to local-file:UWVSE] @C@C6~3h6 E68nuE)s6tVSUR ts6t/C8|t'uh tsh6 ojhG"ssu6e[^_usage: %s remote-files local-file UWVS}hH'E PuV t}:hE PuV u!E 0h7 CUE \]Dؿ6t);|t$EPh tuh6 tE E6xluE)h&jc Ehx, =EH9}xuEwEajEPE 4uum5=u;=Dt2=HHE 0hZ t=HC=uuj6c e[^_SHELL/bin/shsh-c%sTry again laterU8WVSjjb Ejjb ÃSc C~jjb jjb h9] ẼuE9j/ufÃu]f6fECSU؉UR2 ޿91t FO)ȃtE+=Ttuh"茏 h{C }~j5ph9uu juu  uh9Sje ~uԐV莜9uuja Wja uh9h9R e[^_usernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. UPWVS1ۃ}h;E PuV! EvE 0h; E ph;p }h;H‹E PEE ph;6 uc}Eh;讍 h{A h|{jO]SD 0DE X EE p h;th;h{G u}uE p h;e[^_PWDPWD command not recognized, trying XPWD XPWDUSh.=Bu =uh2=贌 h[=]directory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD XMKD %sU}7h=E PUR uE 0h= ÐE ph=\u2=u&=t h=ŋ E ph >"RMD %sRMD command not recognized, trying XRMD XRMD %sU}7h=E PURA uE 0h=G ÐE ph>u2=u&=t h> E ph>^command line to sendusage: %s line-to-send U}7hd?E PUR uE 0hy?苊 Ðu uhqxarguments to SITE commandSITE U}7h?E PUR uE 0hy? Ðu uh@U WVSuP苇 } 0щKEpPU 0щ\ 9u ~I CE4P 0щ\ F9u Pjt[^_modefile-nameusage: %s mode file-name SITE CHMOD %s %sU}hJAE PUR t}4hOAE PURv uE 0hYA| ËE pphsASITE UMASKSITE UMASK %sUSE pB}uAP]SITE IDLESITE IDLE %sUSE pUB}uKBP,]HELPHELP %sUSE pB}uBP]U=Tt jj3j->=Tt jjj] QUITU=TtMh(CzhtP hT 8=u ,%s %s? U=Hu Ðu uhC萆 h{: h|{hP u11ntNt@Uuh9jIU,VSu=ltRj,j]S\ Sjh 6lu}u6hh[JSA1E0L S*e[^Account:U }hzVi5 EjEPjjW} hV,5hVWJw XhVW:w h=XtuhV5-=t5hVp j~1Xt Py ht Py AEjEPhhW}=Tt hVU4 W D 1e[^_Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$initUdWVSEEEEEPEPEPu?}1}]ƅuPƧt0tVuhYso uhY_o h|{jOSo 0D }uu]}{uhZuI}uh Z^EuhZWuEhZ6EPh&Z4 th.Z31}uEtPh&Z=t4gAZ,fEZf0E8h5$IF81 ,9})E PASS PASS XXXXNo control connection for command QUITUWVS$8=TtYh~\mm u }jWh\2j uh\Im VWh{ hB\+m h{q! =huh\01hD\j|? Íu }VW5h_ h\5h 5h !  \%Pxƃ=$8t tjӃSj> e[^_%c%c%c421 Service not available, remote server has closed connection %s:UWVSEE1EhD\j|> EE1EXBHJHyRr  XBHJHyRtr |~ 3XBHJHyR0r Sh.XBHJHyRr Shhh]5h 5h FuB},0=th]j h{ p ~s}5um~h=t!t uu5h3^/j  {{} 9{ t{؈{h{SqN 3wm1tTډu=u~'u"wm1tu# t)t؋MAM Mu-u}t E}u]}R؋MAMB ~Q}5uK {{} 9{ t{؈{h{S9M h{ }t79Et-}Euj ; 1bM}1t uj: =t }uc.=$8t}D\t }tjMыEЍe[^_UE EEEPjjuj ; send aborted waiting for remote to finish abort U$8hwbg h{ jh}tlocal: %s remote: %s -%slocal: %s%s: not a plain file. STORAPPEREST %ldr+w%s %snetoutsentUWVSDžDžxDžt=t8}t2} tM 9-tQhbf }tuhbf =tuu u! 9Ⱥt jRҵDžDžDž|DžpVhstn=tj=u 8|R9  8tjj8 ||j hbj@8 u b1t VO)ʃuDž|{] ;|u`jj 7 |hVu FV>u%Vhb )j7 |j BDžx hVu e u*u hc(jh7 /DžP URQR |fUfft/u h ch{ j7 im 돐;t;j6 |t|j 6 hp=,8u =08u!ctu&cȺuj5,8l 8|3.|)j08R,8RQR8 ll}'u hc&',8085,8h+ct,808,808Džp4c}thuuh8c@ jG5 |t|j .5 uhbtKj4 |t|j 4 pjR] jj u4 |Ⱥ1<hhhQR4 ƃ xhdVdQRA4 ǃ ~ )dԃ=\tt9x|T {{}9{{#{h{j#dE tt9x}h{ =\x~zx9 {{}9{{#{h{j#D  {x{ {h{j D h{w }u hc#SJKJySf 2 =\tgt9x|Y {{}9{{#{h{j#C h{ t=\uC @SJKJy9S j C xQZYJy 9Q tʈVHC x=\t{t9x}8 {{}9{{#{h{j#B  {x{ {h{j B h{ C @tu hc!A @t =< t h>c!DžxjVY tӃf jj20 |t|j 0 xVjR:Y j/ |t|j / =T 8|R0  8te jttуx~RRxhEcT[^_ receive aborted waiting for remote to finish abort U$8hm7\ h{} jh1iRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode File may not have transferred correctly. receivedUWVSEDžpDžlDžhu0n׉҉xtA=t8}t2} tM 9-tQhb[ }tuhbZ =txtuu u EEDž|Džt=Luxt DžthpgtI=tj]=u 8|R-  8}hmj, Eu b1t VO)ʃ} ?|jWU j/WUË<t tWhc tj9] t5nt E 7nPU ƃt/}u hcH=ؿu@=< u.hu }u hc uj+ =ؿt:=< u1u E uX=ؿtu E t;xu=Ⱥt jj9Ⱥt jR& tuj4+ =hneWxt.=,8u =08t5,8h+c}tuuh8c tuhb㐐hV Eu bu E{zM 9|uUjhкFU=Tt`ht$j@P5hB h 8| jP5 8  8 Tj==Tt7ht$j@P`5h-B h Tjftp> sorry, input line too long ?Ambiguous command ?Invalid command Not connected. UW}u* {x{ {h{j  =DthMa8 h{ h|{hh,8 u jjȰ0,Ѓ5, u!ƀ,P=uIhS7  {yh|{> |{|{ u=$5ǃu ho"uh t=TuhO7 h5$G Ѓ=dt?t9 {{}9{{{h{jl  \hhtj` hj T }U WVS11EEL3 L3tU]]UA8Eu:tCBA8t:u+E9~Ǿ]]9uFE] u E Ee[^_US$̺,@t $ꐐ]!$UWVS1ۋ̺5@=9tWG t W Ӊ]u=t+u95u ]9t+hK5+juu59 W )QTR59{0E u1R}}h4o+=t]ډ W LUW }uu5|u5W BG =t%W  :MI9uMypMMxA u}ty uA] C]uuFu𰀅tЋ]AMy9Mt"+U)W =t) 9=9t-WQO9G99z=9x9W #D:e[^_UU9=9t9PuË=9u1UWVS]u jhVS"ǃ=t9u95t Wt=tjhVSÄx1e[^_U=uRPtÐu1Ð=tUjjDu1Ë 99u Ð9tA9B}ы9uAtx1U=ujjj59 Ð|USt xщȉڋ]U9t9Bux9B ~Dt"x=x~xtU xyAt~=tHPux1Ðx t9t9Bux9B ~ DÐ3cannot allocate %d buffersUPS]<9}D)‰Pt1+Phת]S* S0=u]O'V} uO9=9t@=9u|jj]UWVSuhV` u }<ʉ9s#ÐzB9rDŽ99Q9 91e[^_U =u ÐH PvR  zD6u F wF 1UWS]} DSEW /0He[_US]9u H9=  @=vP  zD5t tƐ @=vP  zD5u tƐ @=vPd  zD5t vtƁ= %9|uKt  sd9| Cc vS zD6u#j^<-?t @S-1]: file %d/%d line %d byte %qd/%qd pct %qd%%: END (next file: ): END (%qd%%)U0WVSj.uPuKjjbuu 1tjjRj8uj`4=Dt3=u=`tlB9"BB=-B5!,h,=u%5lBRh]ScS+=<tj>Ph]S;S+j,Éփu VShʮ}WW+=uhGEЉUԃ}u}tQډΉډuuQR+RPuuhԮWW+AA5*=`tD=t'h*5*h* h*=u}j+ÉփuteJEЉUԃ}u}tNډΉډuuQR.RPh]SS!*@e[^_U塈t Á= v,j%+uu=t øgÐ+EUS c?&)t` t9 t5$5 hj55$5 hj`5=vP^ zD5tCS%P^=vP zD5tCSBtPt@C]UUttsxusj€u6wm1uJ9tB9|t:9t2 h\  1Ð t u5ÐRu Ð/?!/!?helpTag: Examine: Cannot edit standard inputmark: goto mark: UVS4=@p =tr?=t -u jÃ=u=tSXt~tSoƍF$<,TԶ4tp|,\̹8hj8;%= 8=  4=I j5 ;r%= 8=  4=I j5 s;6%j PCS;%j PS3;$ ~pj5p+;$ ~pj5p+=ujj:|$,:f$=   5 h{:>$ }  d~  d5 -.7:#  +P2,=   ) u'PV$Ã!. u+PV$=   =$t) u'. u+PRL(9"5$5 j= %Pd/8r9h1$#8"} h6j.8v"=* h<jÃ=thF"IS8"jj #=   5 =   5 R7Z8hajÃ99|S,78hhjÃ9\9|PS,B=thtjWvS zD6uj^!?t @S!Ã%7EDITOR/usr/bin/viviemacs%s +%d %s%s %sUWV=hܺ t8u j/5vƒu Bпtֿu =t1jt#5P5hP 55hPcPh^_No files provided as arguments.-stdinUWVS h 1E9461t FO)Ⱦ8t40Ћl9u}ǍG9dC}u*9u j[V9lu j]CEj A}t j 9lu j[V9lu j]v}C9j \je[^_U:(USE:::5:h9Ãt؋]UVSu U(9s: 8u u(B-u Bt Bu'BC9rƸe[^/usr/share/misc/more.help-more %sUSh0hJSSUVSUM utQRu TÅu =u݃ tuÉ*Su ʐÉփj=Xt<:u1à u=tdt~É։؉e[^UWVS}u} td} u\}vVUM QRu<=XtfE@ uK{à u=tu됐Ɖ׃-=u*à tυuƉWVSt뛐ju}dÅj=] tSgu9} u9uwjMEUe[^_U<<<D@UWVS]DHwk$8Ph<P<@/<P<@< <<D<=<0=[DM$ |H@<=z J9t"__< @ @9d*~+>v#z uB@H@W<PP<@55@<) @\@9d~+<=>vx u@@H\@n<PP<@5\5@<D_tD <Q_t19u*<@<@<Dk_u <X<D| <Q9t4_t_u*<@<@<D뛐<D"@9dlD@\9d/DuD<B<@@‰@~a<8 tLUuDS<B<@@‰@~<8 u J@<D uK=D5ud <@@tE9>@@@uݡ< u3=Dud9@ @t8.6v SV  zD6u#@=Du9d|@(@@=Dt9df@<<1e[^_USUM utQR5u u E< tuF;s ˆCV+<]USUM utuvQRtG3;;+ ttځ<vK]UhsBrdhLHHHX\PT`US]Ht=HtSH+JKH J K]UWVSE] uH 9BHtJ 9u9Zr߉Uz}dt ыd }9}yYq A}O}Q;u3W-=uMHJZ:Ht$B9u9Jw JZ:Hu܋JHJe[^_Calculating line numbersUh)T;U WVS=<_}u } O}u} u =HHt.W 9U  u$O9Mv?HtW 9U u_9]wM9Ou] 9_ uG\UR"OHtGO_ +M] M]WM] +JZ M]]9]M9M]9] W ORQDjEOM_]_ ]M9M ]9] M9MuuEU=}u }}|0E}d~'Ej.NU9| @EE]9] M9M u ]9]zT;M9M |]9] M9MMW ORQ;ueE_]OMO M]9] |M9M ]9]uu!EU=u }u }u1s}|0E}d~'Ej'MU9| 9EMM9M |]9] u M9M{T;uuuEe[^_Uuu uGRPNo current file#no previous file-Can view standard input only once%s: %sCan't take input from a terminalstdinUpWVS]EEt;u! l9 h|4F޿u1:u hKRË=P}=T}SÃ޿u=thc11Xjd}}WSi t P<ajjSE ƃ }%5<PShuWu(V& t'h ~ V S 1;9~ R ht Ro )jPT҉tj/S蔊څtP l9  T59j5<D=tJ=t=~ S }u}tuue[^_No (N-th) next fileU lM9 0=ujl u uh4 Ð l4No (N-th) previous fileUl+Uyh Ðl4US=Xt31ېt; tPT 1ۃ吃j @ CҐt P)  ]MOREmoreU VS]u Yhjh E tEEEPj$VS4)É5lj  u\=h=9|4-j=9|l9l|j j%j7"=t'tP,t $tF?=h&j=9}l9l|ڃ=9|Hge[^cannot allocate memoryUWS]0P ǃuh< SWte[_U}jljU $Id: option.c,v 1.1.1.1.8.3 1997/09/15 09:20:52 jkh Exp $0123456789/:ceinst:ux:fUVSu] ڃ;t8+u x/u-:uah SV謈 bIF$ 0\@P`p=<aT:-uB9u zuBR a@P94=<NL=-t <X5L5L<<[ae[^usage: more [-ceinus] [-t tag] [-x tabs] [-/ pattern] [-#] [file ...] Uhh,|` j ! /dev/ttySHELL%s -c "%s"shUVS];-uC)hPLSFhR< jljjvEj jjhT< } VREh] t$8t;uSPhcS5;unSzj VDV jjD9[^UhtÐHuu u H}UjFCjhzecho "%s"%s -c "echo %s"rUWVS}?#h] Et8u60}ЃPܼ ƃt`uhV 90UЃ P褼 ƃt(uuhVhVÃuEiV" E}s=Cx{Hy Sf tt}G}rƋ}SZe[^_%s: %sU`VSu] EPV|: }5<PVh+S0fEf%f=@t1EPVSh?<S؍e[^UVSu]Su VDe[^UWVS=tDz=u =t<tt<1=?tHt!t,~to tuxusj%u`u\LPWVY}u5==t'=u=u=u (kMZ}t=u `}tp=je[^_UWVS}] uE9}t4=J9~E`OxMVSqÉփut5VS}u"=t r4GOy:}tje[^_U=`t jÐju u`u RPuOUjrut u RPuU`jU MRQ4=JRDUjRPCannot seek to end of fileUVSth2É}HVSajVS4=JR0e[^Cannot get to beginning of fileFile has only %d linesU(WVSjjt+}huRPHh K9]~4}ؐs tuVhW&WC9]RPe[^_Don't know length of fileUVS]0EU}u}uh^pxؙEUEeÉ֋UU֋EEjjdVSLӉމVSu$g t u uÉVS&e[^Cannot seek to that positionUWVSu uǃ|jjRPWu uth%|jÉփu 9u |9]MMM M19u | u39]s.4=J9}!uuEUG9u|u9]r9u|u"9]s uujuuWiu uxe[^_U@JyChoose a letter between 'a' and 'z'UEw1Ðh>US]Suj5$(]Ujmark not setUS]'t4SruN$ (u4u/h'* uu QR]U=}=u 4=HÐ4=No previous regular expressionNothing to searchPattern not foundUWVS] ;=$t h=ttRSh7 t8hShP豫S$hÀ1{$=$uhmjiuuDžDž$}ujj1u!uhhfǃ=@}tAtBG?#tOu 1=<tW =ttyހ;tlЁvR zT5t.Ёv Rz4CF;uހ;t95s ;uCF;ujjj5h_҃}t u]TM}G*[^_U,WV}tNuVjǮ  UU|UeMEE}Ծ EPjj e^_TERMunknowndumb:co#80:hc:lihccoamxndbsgpctitececl cmsoseusuemdmeho|^ll alsrbsbcU WVSh誫 uPW)fPhht@jK ufft %4=h޿4=1ۃ=4=|htt 4=Phht@jذ ufft %dhjd=d} dPhqhbhSh@} @@\Dž0Vh0txVhhu hVhվlu lVh贾Hu t8u HPh脾Du t8u DPhT@u t8u @Ph$Luu LPhPuu PPhνTuu LTPh製Xuu PXVhx\uuL\P`#VhE`u `Ph 4u t8uV@8u4 @jjPvP40‰Ph袼<u t8u[@:u<D4=HPjRP<0‰Vh!8t8uVh8u8t8u8=h譻uPh 赻dt8u d[^_Uh54=5hDZUh54=5l諱Uhj54蓱Uh54=58wU=Ltj Ðhj5<FUjU<=t<=t<=th54=5DU<=tS<=t<=thj5H豰Uhj5L藰 <=Uhj5Pw%<=Uhj5TW <=Uhj5X7%<=Uhj5\ <=Uhj5`%<=Uhj5dׯj phj5d辯Uhj5d觯UhjQ =Ht)Uhj% =HtUU}t'hj hjר hj˨ Ðjj迨 jj趨 jUWVS5t?d=4=9du9=4=t4=@pDthjj: jojj jj jΩ P訩 $hj j:EDe[^_tagsrNo tags fileNo such tag in tags fileUWVSuh5=Ãu h 0ЍxShhpp WhpV uҊp< t< upp :tB< t< uB< t< t:x:t B< t< uB< t< tGB:^uBt B 9uz$uJSSh$e[^_Tag not foundUWVSjjǃ=tq]uuusÉփtGuuh9=<t VSW 55{uuu1e[^_U8USjEP58à u }uE]Uuu u@(#) Copyright (c) 1983, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. rsh8KLde:l:nt:wrlogin/usr/bin/rlogincan't exec %sunknown user idtcpshellshell/tcp: unknown servicecan't establish stderrsetsockoptforkU$WVS1EEEE1EEEj/u 6_ƒtBu п?tUE}u}~u F8-tEu !WÃu huj }u3uu E܃hhu hjёhuu3pEPE܃} j2 =}hj菑}tRj]Sjhue} hjSjh5<} hǑWRXh@jje thjQ jjE thj1 jj% thj }u+[E} hj]Sh~f5Ġ Sh~fu趠 uuuWuH,}u j uQ jߣ selecttimeout reached (%d seconds) UWVS}}5Q <hxSj ƃ j }xW8 ]|M牽 |jjxjjq }=<thDj譎||tVu |)0a=<#SjuSj蒢 ]Džu uj EP7  DEM T Ӊ}u}t PjjjEPjK }=<hDj胍uuhKj!5Dt\<hV ƃ '=<#t/!DVj^ \tN<hu茝 ƃ =<#t!\Vj D\l[^_UEEjEP5蛜 UWVS1ҋ];t;0щMʃ;uRC ƃu jj];t63W3Wǃ?tG?u{t G;ủe[^_ usage: rsh [-nd%s]%s[-l login] [-t timeout] host [command] UhBhDhEh,|4 jy Uuu u$Id: compile.c,v 1.8.2.1 1997/08/12 06:36:11 charnier Exp $Uhj5C@P"@P"%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw command%sread commandbranchlabel%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform commandUWVSEhhAÃu^}t55h]j蒈EtM0=vP  zD5tC;uͅt<#wojƋM1uf1Ph j{FPSà t;;t6=vPj~ zD5tC;ù;,Ct8;t3=vP&~ zD5tC;uGjFPSgà tP;tQ=vP} zD5tCFFFu55hjF>=>t8t :u:uP55hj蟆JM9~WQP55hjtB $4Bd  ,  x 8 Ct8;t3=vP| zD5tC;u͊FҀ$ЈFCt8;t3=vP^| zD5tC;u͋MuM;N}u55hj^EM0Ct:;t5=vP{ zD5tC;u͊<;;FP55hjCt8;t3=vPf{ zD5tC;ù;\t FP55hPj臄Ct8;tX=vP{ zD5tC;ù;t FP55hj' F OCt8;t8=vPz zD5tC;ù;u55hj較hSF =tFhh S F Shj贂Ct8;t8=vPy zD5tC;ù;u55hjhRCt8;t8=vPy zD5tC;ù;u F hSF Ct8;t3=vP&y zD5tC;uhS2F 0u55hj/VVCt<\u55hjj qFPS`à u55hZjÁKvSvvSÃt9;t4=vP&x zD5tC;ù;;WCFPSm Ãt;;t6=vPw zD5tC;u͊<;u Cuv,55hj܀e[^_%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])UVSU Epu\u55h j u'55h jE@xM<[u+RuVƒuf55h( j<\u4A<[t!8u AM.<\urFPh菸tL\CMʃЋM At#9Psu55hj|M 9Q}@Q;<&t<\u.\C(8E< u55hjC|CF>Q+ENjE)=MɉMQEhh~55hj{FC+EWugM Ae[^_%lu: %s: more than one number or 'g' in substitute flags%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'UWVS} GGG DžEtA8t<=vPjq zD5tUBEzuċMp zD5tEX]Uxu < tEBE8u9u55h"j9yV|G=u+hh V'G uVhjGxE+EP55h>jxE[^_%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same lengthU WVS]t<\u55hjwPS[Ãu55hjwPKS*ÃuG55hMjQw=vPm zD5tC;u0JH9t55h{jvhNǸJHyt:AF9uu >؍[^_UWVSh Džht3=vP~l zD5tC;u1Ҁ;t#;\u{t C; uFC;u߉+t)+=BW ,@P [^_%lu: %s: unterminated regular expression%lu: %s: expected context addressUSU] <9<0}U<$tEt< t2‰=vPj zD5C;utu 55hIt)@PVP/ Pچ e[^%lu: %s: undefined label '%s'UVS]u 9C$@                      YC u CIP"Cus 55hjrs z 3s 9e[^%lu: %s: duplicate label '%s'UWVS1}O 4Au}tA9su3Cp }w uw 55hjqujO Ë}s}{C }e[^_UWVS}1t4Aut,9suCp Wsu C Cu1e[^_%lu: %s: unused label '%s'UWVS1t7;{ uCp 55hX rS/y uF~e[^_@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $Id: main.c,v 1.3.2.3 1997/08/29 05:29:53 imp Exp $ae:f:nstdoutUWVS}] hgjװ1hhSWl> 4/$5Lj5LjaÃ=uutPjR;t3m;u jYj5xh{ thojomj襁 sed [-an] [-e script] ... [-f script_file] ... [file ...]usage: sed script [-an] [file ...]%s %s Uh|hhh,|L j r%s"%s" ..."UVSu] x?rX4֐4Pt tQh pu4ph j7l4@x?_ph jhv (f f,4@ x?5SVөƒ t.=u>#u~nu 445ձx?x=u 8#uxnu 򐐐K~ȋ t< t(>x?49HT4  B   B떐1e[^stdin%s: %sUS]=08 u0|{5"3h Pا0u5h j*j0BHJHyR耮 u 50a8@8X50P}=tC13EP50~¡0@ @tM<uPmP5h;"j"j1u uRS0BHJHyR舭 up50i8@8tu0|{5"뙐h PH0x5h jh50P|]UVS]u j ‰Zrp?p?e[^US]jnBt?t?]$Id: misc.c,v 1.1.1.1.8.1 1997/08/12 06:36:12 charnier Exp $mallocUu p uh %jgreallocUEU u RÐRPp uh6%jngUWVS}u <t PQp jhv%VWnSh<SPVWzn<e[^_$Id: process.c,v 1.5.2.1 1997/08/12 06:36:13 charnier Exp $%s %lu UWVSjhT \ ulMAC$&o,o,o,\,o,o,o,o,o,o,8(o,o,((o,o,o,o,o,l)o,)o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,''',o,o,(((o,o,(o,)o,)`** +8+o,o,\++0,o,'o,o,MI9||!@P5v|[ MIy\XMyt =IMq h &1=\<XHPj 5T, à RTB)ȋ X)ȣXPCPR9x j5D5@hT2j5D5@hTjj5X5Th@Mq h &k5T `=u$=\uh{5Xj5T6:jhTujw \ jhT=u$=\uh{5Xj5Tn6jdw =\h{5Xj5T?6=\vXHPj 5T* à t XMTH) Xh{5Xj5T5M X=u$=\uh{5Xj5T5jv 9||!@P5~|[ MA D0My H DC|Qu$ 9=*MI=\Myu2hh q $MA uq h &j?a5X5TMqq 9XMq h &ja=@ujjh&h@p }TT@@u@=\u6T5XNt'MQCNu5h&M M}=u$=\uh{5Xj5Tu3t\뽍e[^_US]Su{u{CtXSu5Xjj5Tru 뿐uB9t 묐=tc두Su5Xjj5Tru MuB9t :=t/C8u@9r'K1=u5Xjj5Tr2uB9%Ct %]%lu: %s: \%d not defined in the REU WVS5T]KY]u9t/R9Qv'I ]Sr5Qh&.j^5XjjVumu 1lX]]SUt%u Q9uQ 9Qt,j2Vhh:]SrVhh9BuJ9J tJ R)U1Fuu jBRVjjRhhB)U}ujjVu[,juVhhJ R)UujjVuMuϋ T)jRPhh,]SrVhhJ R)UjuVhh,}TThhuth]Szth{5Xj5TJ/]SJtz=\uqz u3hh QSB uSrh &j[5X5T]Sr l 9XtSrh &j[e[^_rstdout: %sU WVS19=|12ttqh{t2jt2T.Xhm1t2莘Ãt>Sh jth{Pj.ΐS* G9=|k{@t"<uP&^Pho1j1[|[^_COLUMNS\ \ \abfnrtv%03oUWVSu=?uYh2e tP\?8EPhht@jj ufEft %? ?<1ۀ>E9?h21ۃvRP  zD6tK<\tE {{} 9{< t{{h{P){C2 {{}9{{\{h{j\zPWctL)2 {{} 9{< t{{h{PzPh2F> {{}9{{${h{j$4z {x{ {h{j z{@t$<uP[Pho1jXe[^_first RE may not be emptyRE error: %sUSUE Mu=uh4jJXt| uIB1ۉJZ MQR}u B1RP5[t t !15PPh5jW]U WVS}M7wu+&u1\u+=wm1t A}W\u <\t<&uAWB9Gr&GPw MG GEMuFuG<u|tw|u| tit+4uW)H9Gr'GPw MUG GEMuu 4PuMi uuw MAWB9GrGPw G GEue[^_UVS]uSB9CsCPs C }uCVu CPi SSe[^UVS]u 9Cu>PRh">h,|91{{D[]p9uv=u}thc>h=6h|J9}ch>щh>ljh>轉h!?賉1 M 4h=M 4h=茉1119ujh?M 4.à uh??h,|>Q$KMt4GS 1~M DP1~M DPMEs Cjh| "value" must be from 0 to 255 Valid options are: "%s" '%s': ambiguous argument ('send %s ?' for help). '%s': unknown argument ('send %s ?' for help). '%s': bad value ('send %s ?' for help). UWVSu1h`;Vƒuhz;Vu h;BhZB݆hyBӆO=OtG;0щσ7A~hB藆3hB胆;uhBjhOV7Stu VhBh,|=t-OZT8<A< v9tu VhBh,|Bvu VhBh,|%=tjWEи hc>誅1e[^_%-15s %s US?=?t!CtP3hDl ;u1]U00setsockopt (SO_DEBUG)UP~$5TNjhP݈} h EDWill send carriage returns as telnet . Will send carriage returns as telnet . U=l0th[EhEvAlready operating in binary mode with remote host. Negotiating binary mode with remote host. Already in network ascii mode with remote host. Negotiating network ascii mode with remote host. UE|h06x$ < u h0u h0=h0%u.x$ < uhE@?hF2j+*x uh@FhqFj+Already receiving in binary mode. Negotiating binary mode on input. Already receiving in network ascii mode. Negotiating network ascii mode on input. UEuxЃu,xthXG!@h{Gj *xuhGhGj Already transmitting in binary mode. Negotiating binary mode on output. Already transmitting in network ascii mode. Negotiating network ascii mode on output. UEu xЃu)xt hxH=hHj*xuhHрhH€jprint hexadecimal representation of terminal traffic(debugging) toggle printing of hexadecimal terminal datatermdatashow option processingviewing of options processing (debugging)optionsprint user readable output for "netdata"output of "netdata" to user readable format (debugging)prettydumpprint hexadecimal representation of network trafficprinting of hexadecimal network data (debugging)netdataturn on socket level debuggingdebuggingdebug recognize certain control characterslocal recognition of certain control characterslocalcharsmap carriage return on outputmapping of received carriage returnscrmodsending carriage returns as telnet crlfsending of binary dataoutbinaryreceiving of binary datainbinarysending and receiving of binary databinaryskip reading of ~/.telnetrc filedon't read ~/.telnetrc fileskiprcsend interrupt characters in urgent modeautomatic sending of interrupt characters in urgent modeautosynchflush output when sending interrupt charactersflushing of output when sending interrupt charactersautoflush%-15s toggle %s display help informationUSB=Bt7Ct&8tP3hM+| hB|;uhB|hMhz;hD{1]enabledisable%-15s %s %s UVSuB=BtGCt68t$PmNtfNP3huN{hBz{;ue[^Need an argument to 'toggle' command. 'toggle ?' for help. '%s': ambiguous argument ('toggle ?' for help). '%s': unknown argument ('toggle ?' for help). WillWon't%s %s. UWVS}E8hNh,|1Vh%OVhVOh,|p1E t~M 1M jhBVSlutS t5: Ct!PC O8tORhOy Ct j!EOuEe[^_alternate AYT characterforw2alternate end of line characterforw1character to use for XOFFstopcharacter to use for XONstartcharacter to use to erase a wordworderasecharacter to use for line reprintreprintcharacter to cause a Suspend Processcharacter to use for literal nextlnextcharacter to use to erase a linekillcharacter to use to erase a charactereraseThe following are for local editing in linemodecharacter to cause an EOF character to cause an Abort processquitcharacter to cause an Interrupt Processcharacter to cause an Abort OutputflushoutputThe following need 'localchars' to be toggled truefile to write trace information totracefilerlogin escape characterrlogincharacter to escape back to telnet command modecharacter to toggle local echoing on/offechoUjhXDuz Telnet rlogin escape character is '%s'. Telnet escape character is '%s'. UE=t5t8t Pr%PPhSvÅt8t P=,(%PQPhSuFormat is 'set Name Value' 'set ?' for help. '%s': unknown argument ('set ?' for help). '%s': ambiguous argument ('set ?' for help). onFormat is 'set togglename [on|off]' 'set ?' for help. %s set to "%s". %s character is '%s'. UWVSuF|hz;U rruh`;U r[tXXD=XDts3hDt ;uhBptjhMhz;hDUt1U rÃjhBU rà uU rhTS2 C trtTU zu&:U zt hTTCt!PC O8tOQhOs CjЃthtTUs1SvtU rhTh,|*1vCtU rs 3h6UG:U ztr%C C P2P3hGUrXe[^_Need an argument to 'unset' command. 'unset ?' for help. '%s': unknown argument ('unset ?' for help). '%s': ambiguous argument ('unset ?' for help). %s reset to "%s". UWVS}hWh,|1hz;M qxuh`;M qatvXD=XDts3hDq ;uhBxqjhMhz;hD]q1VhWVhXh,|<1E M 1M V_ÃujjhBVà tSuC t.Ct!PC O8tORhOp CtUjЃLSCCtjs 3hAXC C PP3hGUYpO(e[^_UNjj"?jjq>jjh>U=Nt jjO>jj">jj:>U=Nt jj= jj"?jj{=?Need to have LINEMODE option enabled first. 'mode ?' for help. UEuhZHohZ>o1Ð} tD0ˆU "D0EjjEPNUjuUjuPrint help informationkludgelineDisable literal character echo-litecho+litechoEnable literal character echolitecho-softtabs+softtabsEnable tab expansionsofttabsDisable character editing-edit+editEnable character editingeditDisable signal trapping-isig+isigEnable signal trappingisigThese require the LINEMODE option to be enabled(or enable obsolete line-by-line mode)Enable LINEMODE optionline(or disable obsolete line-by-line mode)Disable LINEMODE optioncharacterformat is: 'mode Mode', where 'Mode' is one of: UShW]lE=Et6Ct&8tP3hDl hBzl;u1]'mode' command requires an argument Unknown mode '%s' ('mode ?' for help). Ambiguous mode '%s' ('mode ?' for help). UVSu }t h]_jhEvà u vh ^Stvh5^h,|;{ t"=uhc>wkhZmkCt s1e[^won't %s. %-15s [%s] %-15s "%s" ?Ambiguous argument '%s'. ?Unknown argument '%s'. UWVS}B=BtFBFt->t(8thS;h_j6h_j;uhBjXD=XDYdD8 t5{uPP6h _Cj3Ph_/j >uEU9U} 7EjhB7Vu St 7h%_uu7h@_i1t9C t2{t,8t hS;h_~ish_nit@t:8 t5~uF PP6h _=iv Ph_*i EU9U`qe[^_Deprecated usage - please use 'set escape%s%s' in the future. new escape character: Escape character is '%s'. U4VS]u >~FP>~dKPhMaZh ~F haBhh|{j2]Sh؃t,(=u,(PsPhah h{C e[^Deprecated usage - please use 'toggle crmod' in the future. %s map carriage return on output. U=H0ƒH0hibbgO=H0tOPhbAgh{ USHhEPEP.jj;; EPEP.t"=tuE9EuE9Etep*jg]Fork failed SHELL/bin/sh-cExeclUSgEPEPO.%Evt thc蒢hc3 Ãucj/S<u@}~jh hcPSJ jPS; hc*j< jAsEPEP- t$=t}uE9EuE9Etc]Connection closed. fromquitUWVu =t>j5PzhdHe5PY-ND}uvd tjhdN re^_byeUjhdhdehdj萁Ujj2#Verify remote special character definitionscheckUse remote special character definitionsimportUse local special character definitionsexportUSG=Gt7Ct&8tP3hDc hBc;uˋ]UjhGuNeed an argument to 'slc' command. 'slc ?' for help. '%s': unknown argument ('slc ?' for help). '%s': ambiguous argument ('slc ?' for help). UVSu }thfh,|Sv0Ãu vhf-Sus C.Fvhfh,|1e[^List the current environment variableslistSend an environment variablesendDon't mark an environment variable for automatic exportunexportMark an environment variable for automatic exportUndefine an environment variableundefineDefine an environment variabledefineUSH=Ht7Ct&8tP3hDga hBVa;uˋ]UjhHu Need an argument to 'environ' command. 'environ ?' for help. '%s': unknown argument ('environ ?' for help). '%s': ambiguous argument ('environ ?' for help). only Need %s%d argument%s to 'environ %s' command. 'environ ?' for help. UWVS}u h ih,| 1vÃu vh_iS&tvhih,|1US B9t:3 >u>PRG>9}iQhih,|1v vCиe[^_UVSutVs]uu1e[^DISPLAYunix:%s%sUSERLOGNAMEPRINTERUWVS5<>tuh kC@ 8:tjhkPq[ j:r hVGQE0щЋDP) VhkS)C$r ) Z hkvu1h#ketp hk/hk% h kh+k[^_UVSuVÃt%Ct P) C t7P( ,j-( áCtXVICCV#Cu #C ؍e[^USu|Ãt9StCBCt Pc( C t PS( SJ( ]Uu)t@Uut@Cannot send '%s': Telnet ENVIRON option not enabled Cannot send '%s': variable not defined UVSuu VhmVÃuVhnh,|Es'FjHe[^%c %-20s %s USt,s s {t*Phn[u֋]UU }tHË@ÐHtHxt9Pt܋Hu1Uuu1Ð@ Connected to %s. notmuchOperating with LINEMODE option LocalNo%s line editing %s catching of signals Operating in obsolete linemode Operating in single character mode Catching signals locally Remote%s character echo %s flow control No connection. UWVu =#5xh=oY}~vOo9ZtVhWoY}otwoPhoY}otwoPholY<A=Nt{u hoho:Y=p0t ho$YptwoPhpYt1}otwoPh!pXh2pX,(P"PhaXh{ e^_statusUjhOohqhDpW?Already connected to %s open (to) -l-ausage: telnet [-l user] [-a] host-name [port] Bad source route option: %s tcp%s: bad port number telnettelnet: tcp/telnet: unknown service Trying %s... telnet: socketsetsockopt (IP_OPTIONS)telnet: setsockopt (IP_TOS) (ignored)telnet: connect to address %s: telnet: Unable to connect to remote hostConnection closed by foreign host. UDWVSU] EEEEEEjEPUŨ=t5xhqVgtq f5qf5 hq]Vh|{0ҿ щMȾ)V щ PV  Jh`;3UU̅hz;3UU̅uq3ruJtV3uF3ruJLNw}u E}u3uԃJQhrNU+}tE؊@t !j:uxuj@uxxEEPEPu ‰U uuVuuh6rTUEu4E‰UtSUEjjEPBE t hu6 huhP  xkuAEuu&VE@EĊEĈEuv F0uVy* hE0hMP x}uԀ>-uFu uSfEfUfu:hSruuVE܃t@EfufuuhWr[S;ІfEi}uWhSrhlr'VE܃u-hsrh,|qP{1hrE܋@Efufuui PhrR jjjPPP|Mt"uQjjRǣ} hrƎ=?} ?=?t3jh?jj5P聣}=<*t hrw=TNt(jjh5PU} h EFjEP5P }tqE@xte<uK Rhrh,|譽<juvuȃEpUp uvR' 5Phs覍1=u5xu =LNtS}uShk EЃtPsÃt*Q9Ct GP!ÃEt]Ѓ}tuhk)hk jhOohqhDp~hx]u uI5Pjh %s ?Ambiguous command ?Invalid command UWVSu }P}u- {x{ {-h{j 3jj! jj! =u5`NhzNtT ~FB< tO1 t/J: u) t!=ueh hzNQ=t5`NhzNh|{hh $O u{`s= tv2 thPgS_thz!uhz{ t=uhc>Mh 5 CЃ}u=ujhdNZjNe[^_Commands may be abbreviated. Commands are: %-*s %s ?Ambiguous help command %s ?Invalid help command %s UWVS}h| MJ=JtpCtP3jh|L;uJE U 2V St Vh|uVh|shzLO1e[^_HOME/.telnetrcrDEFAULT?Ambiguous command: %s ?Invalid command: %s ?Need to be connected first for %s. ULWVS1}0щHE} 0щHE=PNxu]SI]=Lufh}U ‰Lt*0щȃ wRh@ GI @ h}h@ JL@ h}5LuKǃWhh K  #t҅t;ʉʁvQ zD5ƒu1 ʁvQ  zD5ƒ]uuh A u+EPE PTuu h  u+EPE P'jh}h  hh h |F   t < RS t 5 h}.u5 h}{ t"=u5 h~IEh 5 CЃ,WnRe[^_UWVS} [}QU tU :MU E}?!uGF?@FFGEE}:u1@C8Ut1},uC;@uC}@tҀ}:tCUuր}u1W9tE&W5tUAUq 0R EtߍF9E[CU (ˆP~FU +2U2E#U :1U Ue[^_U8G [host-name [port]][-r] [-n tracefile][-8] [-E] [-L] [-S tos] [-a] [-c] [-d] [-e char] [-l user]Usage: %s %s%s%s%s Uhhhh5`Nhh,| j rlog8EKLS:X:acde:fFk:l:n:rt:x%s: Warning: -S ignored, no parsetos() support. %s: Warning: -f ignored, no Kerberos V5 support. %s: Warning: -F ignored, no Kerberos V5 support. %s: Warning: -k ignored, no Kerberos V4 support. %s: Warning: -t ignored, no TN3270 support. %s: Warning: -x ignored, no ENCRYPT support. -lU WVSu] ^ j/3%`Nt@`N1jh85`NYB u~LNh=SV @ȃ@($888888888888,8888@888888L888888888888\8l|8888І88888888HN,( HN5`NhWLNPNqTNa5LeM5`Nhv5`Nhf5`NhVLN=L5LmG~5`Nh5`NhKh,|# =LNu= LNa)ƍ~`NEMMtEy}MMMM~ CMMhdNdOt j:_EPM)Pku1*!hdN"Ojjj e[^_Uhh$h| t j hh$ h tj P{selectU(VS]j S5P DhMSjjFV u =<t}h}tPDu1e[^Uh|/UVSh|Éރ~0h|(ujSjj5|5P'Ã}D<7t8#t3A5x|5Ph|jhM1ۃ=$(ttES5|j>3E t0Sh|9uh|t$1e[^UWVS]u }j jS {s3sSSS e[^_UUJA9BvB@)ȉBUU9Bt1ÐUE@UUBE 9B w+BBMMBUUM tRBt+x9| B9}B9B w+BM MJB9u 9JwBBUUB9uB9BrBÐ+ByBUMQ9r uA9ArA )yAÐ+AyAUMAt9u!9AuA9AvAÐA+yA)yAUSMQt9u$A9r uA9Av A )A+9s Y )É)‰Ѕ}A]UWVS}u ]tDW9| W PVwEa EPW4E)ƃue[^_U{L0{P0j h j h j h թ<Uu u5L0X Uu u5P0 UUUDD9u.9=ED9u=Nt9"9.uEPuMS Mt}u>u:C |t]E t} E^сvRM MzD5t'=v Pz4C }u9~u70}u%EB9Uw}u>uu^u}?u9} tu 7EU}9sB9Uwu>uNEe[^_UWVSu0}׋] 9s"Wu3 u19re[^_US]uhxuwt1t]TERMUWS=NNNt=Nt Ph̡ÃtMEPjS] uShxN/ h"e[^_lm_will: no command!!! UE}  h~"NNh|Gv#jhNh|"jhNj>0/Ðh."lm_wont: no command!!! U}  h$"lm_do: no command!!! lm_do: not enough room in buffer UE}  hQ!NNh|wv#jhNh|RjhNj>`.Ðhg^!lm_dont: no command!!! U}  h1!lm_mode: not enough room in buffer UE} D09tnuiȃD0N}u Nh|v&jhNh|yjhNj>-h! j|!Up0s%@@ rjtjtjtjgtbj3t  j t B j t!!j (t$-$-j c4t0909j /@t<E<EjLtHQHQjXtT]T]jdt`i`ij_ptluluj+|txxjtb=Nu TÐjlocalremoteremote defaultSpecial characters are %s values UNt{uuPhlUNtUEuN NtPslc_import: not enough room Uh| vC}t!j hNh|jhNj>(j hNh|jhNݐh;UVS2UslFtO;uFtPPځЉPA rBje[^UWVS} uUU~FjjRUR<VUс8uʃC9tzu UVC 9uFCMC 9VʀSuK $<tKCPCPu E E}  tje[^_UVSseFtK8tE$ h]UVS1s6P}Pt 8 t  r҉e[^UWVS11U:} ujW9] ~JUt(t!ut W^U|Ct UFC9] t W/je[^_env_opt_start: malloc()/realloc() failed!!! U@0thP@0hF@0@0u-hS@0Ð'UDt@env_opt_add: realloc() failed!!! UWVS]=@0t;u^jj jjÃtS㐐jj۹jjϹÃbSߐSƉ0щJt(щTU9rЃ9s~@0)WR‰@0u/h@0+E+ESt A7ʅ|'~u Cut1ᐐe[^_USERPRINTERSYSTEMTYPEJOBACCTUWVEƿt_ƿwtLƿt9ƿ t&ƿtƿu 1e^_UVS+5@0^}u~]h|9~(S5@0h|V@0Pj>h@0t$P$@0e[^RCVDIn SUBOPTION processing, RCVDUWVSE11hTu;tVhE1UhlǃUBUOF,w$ 4,V u9yu0=H0u'=802=%X u, OxBUu0BUOF=80=X $yu3 u.EOF=80={X =80u =uX jhT=H06=80)=X ,=80u =uX jhTh=H0=80=X !=80=XjhTs!$ĺܻ@ܻܻܻܻܻܻܻ 0, ,,,hhh80j&80T0d0T0\$$ ,{=802=%XjhT Shhd ShhLS2Shh4Sj,Shh S6u = !~j`ShhS((j,_u,E$=$4$'tl$=$s$$=$s$$$($$ Shh, 4$=$ $$=$s$$=$s $$$($$ =,*t Vh1}ute[^_z U=Nu1NNjhj芼close UWVSE1Eh|uA}tuh0'EE=0h0ƃIGڊ xMuNE M=Nt'N9NK=NtwN.t N]U塀jh|5jh|!hhh ((=XNtb=tU塀jh|jh|hhhI ((=XNt=t4U塀jh|]jh|Ihhh((=XNt=tU塀jh|jh|hhhq((=XNt=t\U塀jh|jh|qhhhU塀jh|Ajh|-hhhUSEPEPsEEEUE] ]US]t jjt jj]US]t jjt jj]Uhh0(hTY t jJhh$$h04 tj% XNUWVShTxhTÉރ~p}tS5TÃ~N=t0tS5Tj> 9u%9~!)ރ}uV5\Sƃ~ShT1|9ut 1)@e[^_U1҃=t Ðyu=txtt=Nt){u=t\09X0~t D0US]htP]UjUIACDONTDOWONTWILLSBGAELECAYTAOIPBRKDMARKNOPSEEORABORTSUSPEOFNEW-ENVIRONENCRYPTAUTHENTICATIONOLD-ENVIRONXDISPLOCLINEMODELFLOWTSPEEDNAWSX.3 PAD3270 REGIMETTYLOCOUTPUT MARKINGTACACS UIDEND OF RECORDTERMINAL TYPESEND LOCATIONSUPDUP OUTPUTSUPDUPDATA ENTRY TERMINALBYTE MACROLOGOUTEXTEND ASCIINAOLFDNAOVTDNAOVTSNAOFFDNAOHTDNAOHTSNAOCRDNAOPNAOLRCTETIMING MARKSTATUSNAMESUPPRESS GO AHEADRCPECHOBINARYEEOLEBOLEWRECROVERINSRTMCEOLMCBOLMCWRMCWLMCRMCLFORW2FORW1XOFFXONLNEXTRPEWSYNCH0UVSuMvS^ zD5t!v S% z4Fue[^UjEPuu uQM-wCannot open %s. (standard output)UWVS]Pt={t PtJ޿9t7h;SPtShPM1Sh=h,|gP{PNfe[^_%c 0x%x %c%.2x%.2x UWVS} uMMEuEPh5Pg=40tJ~9s.P u*Ph5PfC9r҃E8 ~ 9sPh5PfC 9rE P={u h h{hPQf"5P苮e[^_%s IAC %s%s IAC %d%s %s %sEXOPL%d%s %d %dUSMU ]=1u6w4KQhSQh'5Pet4t$t1utcPQh15PQe'w4Oh8)uh;5P e1ShA5Pe SRQhD5PdP={uh h{d5P hPd]resp DO_DONT %s: %d resp DO_DONT %d: %d want DO %s want DO %d want DONT %s want DONT %d DO %s DO %d resp WILL_WONT %s: %d resp WILL_WONT %d: %d want WILL %s want WILL %d want WONT %s want WONT %d WILL %s WILL %d UWVS1K`'wP4lSh!wP7h PVhQ dt-'w4lShxw 7hhVh^'w4lShKw 7hPhq5P [ F9u{ h.5P[} h=n}u M A3} GO RQPh5PZ}uGPhq5PZ } GO RQPh5PkZ9u } >Phq5P@Z F9u h5P Z} h=M A=t2=t!|=t ohhhh5PY} h} GuLh5PtY9uM Ph5PHY F9uPh5P'Y 9u} >Ph5PX F9uWh 5PX$M <w%4`Ph%Ph5PX } D7tt7tt+hhh*h45PHXM T1G t=PG@tHPG}QPhV5PW} D7tPh]5PW M D1Phd5PW } |7u|7uFE99uM Phq5P|W F9uhi5P\W} ho} WGtQPGt|PGtPGtPGtPhPtPh85PVM A tPh5PV 9u} >Ph5PpV F9uM APh5PHV 9u} >Ph5PV F9uwh&5PUM AЅth<uh]5PURhc5PU 9u} >Phq5PU F9u Ny NP={uhh{hPMU9uM >$4X`HPF} ><'w%4ORh %PRh5PTP={h h{h5PTF9u~-M < uC9Et|uË} ;:CB9]։)PE Pj( 9u~h5PTރsP={u h h{hPSRh5PS F9u.h5PSM At t3E PEPh)h 5PtS} GPPh5PSSh5P8SM At! tt{hhh5PRDž9u} tt jt't2\ .$P5P]RDž=vP zD69"t8PBxzHy9B "Rj"PDž=PGHOHy 9G t؈BS1P/P5PSQDž F9unPBxzHy9B "rRj"dM <'w%4Oh7 %Ph5PP 9u~"} >Ph5PP F9u߀t(P={uh h{hPiP=P{u h{蠘[^_U,VSj ]SPhTg u4L0M܉ƒM TjjSj@P&ThT"tCj5L0u؉ DjjEPjMAQֶ뭐e[^Uj32h謤uh{覗h,|蜗jI_US]SUWVSu] h,|0HPjVxS边Uuu u@(#) Copyright (c) 1983, 1990, 1993 The Regents of the University of California. All rights reserved. $Id: rlogin.c,v 1.13.2.3 1997/09/15 10:19:44 jkh Exp $1152005760038400192009600480024001800120060030020015013411075500rlogin8DEKLde:l:unknown user idtcploginlogin/tcp: unknown serviceTERMnetwork/setsockoptsetsockopt NODELAY (ignored)setsockopt TOS (ignored)U(WVS] TADžDžDžDžDžDžj/3ot@ƿtu}~C8-tDž4hVE+P3r wȃ4c$\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\$\\\\\\HPDžPPDžP5L Q Ls aauuK ;t> 0PƃuhjʡuhhTǃuhj蓡hhѫtRSEEPht@j膱uhSdE4QSSh|0hht@jOhLj [h .hlj? hj0jS6wP‰P }j@t*jPjhR.} ht,jPjj5PT.} hߠDžjPjj5P.} h詠/g@forkconnection closed.connection closed.closed connection.US]EPht@jگEP PPE0EPhPh|t@j蘯hPht@j臯P>RP?R$hPhtt@j[jjjjjiPuh脟ju@jqSouhjOj*hj4S.,hj1hjHUVS]KP,h S觭 u jS藭V+e[^USj=P~7jjaj 5P|]S"~9PuukU=Puh0j PUjjEP t(|9PuEt׊EU P5line goneUVS1jEPjW =<tt,1ۃ=PUQ9뫐ts1E<.t8PuP8Pt8Pu PEPTQ9tjhQ5P8 jEP5P$ u h*W=1ۊE8Pt$8Pt8Pt8Pt < t< e[^UUQEE^@UEuE^E?EUE @ @U)PRjpUS]j:jjj8Pt覬1P|hjȪj j]US=PtB]Shht@jx u+jh|0S tUM|0 0]U UEEEsEsf|0fEf~0fEf0fEf0fEj R5PiioctlUVSDž1jjP5P }o=<#Pw, )P0P5PV 럐hP5P- u}j5P=PtK]Sht@jfE$ fESh tj?R>RhRhuhP5Pڨ PjhPuh.ڐt=PujhPK[^readUSwjj褧hj蘧+aPSj5P(hP u%0/PPSj赧 }=<t tÉ-0P)‰Ѕ0PPh h05P跧P t}=<th"1]U S]EPht@j芧EPh|t@jzt tNfUffUfPf Pf fUPPPE0EPE`E=Pt€ €fUfPff!fUf% f= ufU 8DELusage: rlogin [ -%s]%s[-e char] [ -l username ] host Uhhhh,|T>jillegal option value -- eUWVSu0҉߈҃uC>\u*Bw"jjFV ƒ Ft<vh ZЍe[^_Uuu u@(#)cl_bsd.c 8.29 (Berkeley) 7/1/96UjhjOUYth&jP h{聅ÐsmkxrmkxU0} t+P th&jP躩h{01U\kflashUS]uhPYt P0h0t P11YYt Ph+et P1YYt P›h~-t PÖ1Y]~|yurnkgd`]WTNK0HC@:7+4/,sosmsokstismcupsermsoketermcuplilineskRkrikPkppkNknpkHkllkFkindkAkil1kIkich1khkhomekEkelkSkedkLkdl1kDkdch1kukcuu1krkcuf1kdkcud1klkcub1vbceelupcuu1cmcupcocols0123456789;123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzUE 0uPUS]hHjjhLS&au?;ku={fu7CP?& EkEFEE]XEXEPSXuЋ]US]hHjjhLS`tXSmt‰Ћ]@(#)cl_funcs.c 10.50 (Berkeley) 9/24/96UWVS]188puDCHS@K49s 9t /D9u$C9u9St588euu 588i ut 588e1e[^_smcuprmcupUVSuM UFX$t2tTǃu"PhVn h&jǃuPhV th&jP h{CtGu dt h&jPh&j h{q/t588=d588Ud #1e[^USE] @@$Pa=tF Kt? 2t8Fnt/=t(6=,t =t"=Xt =t X%1]UEtjhj76tP@|8u t1U588o%US]U M88@88@[H)1]UWVS}G9u 9W88x}@E}OHG@W49sL M11Vu588m88JB$R@PU‰ƒ =vP zD6tCC)Pu588Em tj 588/fKuEP588fF}9w8Uuu588l 588m%e[^_USEU @X$tNct h&j)Jh&j-PjR2 P tQ {{}9{{ {h{j Xh&j蓠1ې {{}9{{{h{jC~1ې {{}9{{ {h{j īC~ {{}9{{ {h{j 舫h{K{ #1]U588j`%UVSEU M]@@$trtt2<ƃ31e[^Error: move: l(%u) c(%u) o(%u)UWVS]} uVCHP588j t1sHVWhjS膃e[^_UE@@$t1Ð} t d:H0@588u%xterm]0;%sUSE@X$P\}t*tHjhRP u4u t$RhGh{y1]U8WVSuU FX$tTtEPj輔PjjĔjj.EPjj蛔88HM̋HMj-JRPh588s}WjEj588` jjVjjVPjj)$jj}t t Wjj jjVjF pVZj588 uu588=hjVEPjjjVMt }tF@$1e[^_usage: ex [-eFRrSsv] [-c command] [-t tag] [-w size] [file ...] usage: vi [-eFlRrSv] [-c command] [-t tag] [-w size] [file ...] %sUhh9h,|.@(#)cl_main.c 10.36 (Berkeley) 10/14/96TERMunknown]0;%sU WVS"Y=Yt辐U 2:ÉT[Shƃ uV3jVC\C` u j3jEPEPjjt jECHCDECt $ 1e[^_UWVS}1_$u1tW* t%=uWt%=uW2tPjj膄e[^_016|Vi's standard input and output must be a terminalTERMLINESCOLUMNS%s%s: unknown terminal typetcgetattrtcsetattrU WVSuFX$TtjmuhjVdqdjj?V6 t GtV@|8h EjWhhE tV@D8PjhhǀE`tVX@D8XPjh<h|{h{Wu,=<t Whj WhjV>p>}u hLH}u h9H}u h&HVvb\]Zj588Mj588-ǃjj„ \Pjt ht \t \hƃwƃuƃvƃ{ƃzƃ~Vou'\Pjjt t!h#jV o v1e[^_USEX$j5889uzǃtP!zǃ]%luU(VSuE tjPuhj(]SjSVdBe[^@(#)cl_term.c 10.22 (Berkeley) 9/15/96}{jdbVRPB=;/+) ywjdbXcursor upkkcuu1cursor rightlkcuf1delete to end of screendGkedscroll upkripage upkpppage downknpcursor lefthkcub1delete lineddkdl1insert at cursorikich1go to sol^khomego to eol$kllscroll downkinddelete to eolDkelcursor downjkcud1delete characterxkdch1insert lineOkil1dVdXyjlakahajaUWVSEH=PPE0"Ãt\tWjjV0щHPR0щHPS0щHPRuƒ$lE>uE=E0ÃtntiPRV9PRt 9utJjjjMQ0щHPS0щHPRu\ƒ$E>oE=EE0Ã޿tqEPu jjjjjj0щHPR0щHPSE0щHPRuƒ$t NEEE8HE@Dt&G$tw wwwwu?u1e[^_USEDt@$t Pf؅u1]UMЃ u1ÐЃtuuuuu QAÐ1kf%d233|This terminal has no %s keyfunction key %dU@WVSE@PPh!j@]SSƃtt0u1tIE@P迧Ph"j@]S>ju uu0HPVRSuh!ujune[^_UVS]U uCH$t/ ttk?tJt.^CTK>%PQS5>tjjC t@t jPSJ1e[^stderr%s046|messages not turned on: %s045|messages not turned off: %sU`WVSu} jָÃuhk#jVcEPS}Shr#puEt}t'fE %PS2}>t3Shu##fE%PS2}tSh#jVKc1e[^_TERMlinestigetnum: linescolstigetnum: colsLINESCOLUMNSU WVS}Mt11ۍEPhht@jMx Mt]u} ttuB7 tW@9\8t9`tWX@9t8t9Xttufh$2rtUu%h$%}h$jWa Åu(h$}h$jWa ƅuuPh$qtj jPEà h$qt j jP%ƃ}tU}tU21e[^_UU {{} 9{ t{{h{R@(#)cut.c 10.10 (Berkeley) 9/15/96U WVS}E EE1ۅEMut!u MM9tEWE=vP\zD5Ãu5}uEUv Rz4EE=vPf\zD5t+E=vP(z4UG@tM8VtD6uECtKtMCxET!9EsPEPuV E}GUJ)‹MME@RPQn EH+GEuu} 7V/5upME9s_uV1uTFdEd1u+FTu0jjjV'u FTuEHMH} 9r1}t)1tFtM9Htu Tupb؍e[^_@(#)exf.c 10.49 (Berkeley) 10/10/96/tmpUWVSMIM} t~Y0ȃ09trǐCuM39u CMA4CFS9u MA0Ct PaSau Pw9ujjÃujjutS u1q} t>u 3t*u r\CuSFajju*S1.U0MA4C9Q0uY0 MA4MY4؍e[^_%s/vi.XXXXXX237|Unable to create temporary file238|Warning: %s is not a regular file%s239|%s already locked, session is read-onlyUWVS}DžxDž|M fQ tfQQW3;f] fSj\j\ƃujjWQFFFHFTNXRURu WM It]ut $jj Wr xtOpRT8pRh4hhQ-hru h4P2g] {uKh/ZM A tyuHhZ] Cu0M Q t R^jjWPh] [ tDžhMu] KVDRjjURURkӁlpjhpl7h v Džh hu Džhh NXUV5tjWWxu) u ] CuEtjsEtjjjjj*W躅wM O W 1] StR[CM Q tR:] s k[C FX@t vLVLtRC[FLVt RR҃V#[|tURuu W\[^_%s/%sUWVSM qu}s jWIRs VC {}WOMȃ09u CA4CBOMȃ0S9uA0Ct POVSFVG FPt.P҃t$}uh>sjWQVW+VW:DFX uNFLt P褹th>vLjW]QFPt P}th>vPjW6QFHt P]FTt P]FLt PpUFPt P`UVWU1e[^_244|Read-only file, not written; use ! to override245|Read-only file, not written246|%s exists, not written; use ! to override247|%s exists, not written248|Partial file, not written; use ! to override249|Partial file, not written250|%s: file modified more recently than this copy; use ! to override251|%s: file modified more recently than this copy252|%s: write lock was unavailableaw254|%s: WARNING: FILE TRUNCATED256|%s: new file: %lu lines, %lu characters315|%s: appended: %lu lines, %lu characters257|%s: %lu lines, %lu charactersUWVSu}Nu jjS5e[^UEDtP<@|8u <u<jut1=<#uÐ@(#)key.c 10.33 (Berkeley) 9/24/96079|No non-printable character foundUVS]shSSjzSSjjSjjS$jjSjjShbj5ShPRu ƆRPR(S+R9sRAh_6h`.h9`&hS`hp`h`h`h`jRW& 6C tPK4]UWVSE} 1ۋHtN@Dt1Huǁu؍e[^_UWVSu^M @‰UI9v%PEPV.u E11e[^_UEU HB)@(#)line.c 10.21 (Berkeley) 9/15/96UWVS}u ]tuujVWMu19wEPWIu}t VWE te[^_UWVS}u MYujjQ%MMtWQxJMMA|@9uw19r-9ut 𐐋9ButB}BU 9v+E)‰U E 9CuC CM MESjEPEPRB Ѓt u4Mt u u)t}t M,E CEC ECtE}tCM1e[^_003|unable to delete line %luUVSu^ujjVu jV! uu jVN uju V M MECjURP@Ѓuu hdjV"돐C9E wCCtHCCXt VnKXjju Ve[^004|unable to append to line %luUWVS}EU_ujjWMMEEUSjEPEPRBЃuuhejW!C9EsCCt@CCXt W蒐KXjE@PW1ۋE@PjWk tE@PjW6M t1u juWute[^_005|unable to insert at line %luUWVS}EU_ujjWM MEEUSjEPEPRBЃuu hfjW C9E rCCt@CCXt WbKXju W1u jW?tu jW L t1jju Wute[^_006|unable to store line %luUWVSu}^ujjVtju VM ME}MMSjEPEPRBЃuu hgjVd;C9E uCCXt VAKXju Vojju Ve[^_UVS]u CujjSPu1GHt)tS|CxR+P99jjjVS%e[^007|unable to get last lineUWVSu} ^ujjVKMt"F|Vx@+BMMESjEPEPRBЃtt%h6ijV>2EUSSEC ECt F|@9wE1e[^_008|Error: unable to retrieve line %luUu hEPEPju VtBE t PVEEmEPEPju VE9C sPC PsV豛CCjE PC@P2uuCP2K(MECEMMSjEPEPRBЃ(tC(HK(@C$1hh2lVe[^_UVSu^CXt1{,tjVC,{ wjC PsV迚tpCCju C@P1K(MECEESjEPEPRBЃtC(HK(@C$1hWh2lVe[^010|Logging not being performed, undo not possible011|No changes to undoU8WVS}wFXthHojW~(u*h{ojWhh2lW FXN(MEEM؉MȐN(VjEPEPRB Ѓu]H?$@p`p pppp pp8q}tjCPu T0fX1 EjCPu30uWGd[EjCPu/EPCPuWG\EjCPu/EPCPuWu`E9GXGXG`EjCPEPz/EEЋEEjEPEPWYu'fXe[^_012|Logging not being performed, undo not possibleU4WVS}wFXthqjWd~(uYhh2lWC FXN(MEMԉMN(VjEPEPRB Ѓu]H$\r|rr(r(r(r(rr sjCPu>.GL 9Eu+~(u#jCPu.GL 9EkF(fX1jCPEP-UЃ 9WLuEPCPRWuME9GXtGXG`jCPEP-EEԋEEjuEPWu 7%fXe[^_013|Logging not being performed, roll-forward not possible014|No changes to re-doU8WVS}wVXth]sjWF$9F(u,hsjWhIh2lWVXN(MEEM؉MF(VjEPEPRB Ѓu]HC$dt0tttttu0t`u}tF(jCPu -,fX1 EjCPu ,EPCPuWG\LEjCPu+uWGdEjCPu+EPCPuWu`E9GXGXG`EjCPEPR+EEЋEEjEPEPW1u"fXe[^_015|%s/%d: log put error267|Log restartedUVSuuu 襔PhujV^CP@SV u hujVe[^@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1992, 1993, 1994, 1995, 1996 Keith Bostic. All rights reserved. @(#)main.c 10.48 (Berkeley) 10/11/96exnexnviewviewc:eFGlRrSst:vw:only one -c command may be specified.only one of -r and -t may be specified.only one tag file may be specified.-s option is only applicable to ex.window=%sUWVS]Džhu ǃha u ǃ0f CC CCCCC|ǃC|C|CpC0C4C0,0,ǃ@ǃDDž3#wt3&wu 73*wt30wu Džu3Y t YDžDžDžDžDž1T@h5wuu ƒ 8$y\{\{\{\{\{\{\{zz\{\{\{\{\{\{\{\{\{\{zz\{\{\{\{\{\{\{\{\{\{\{\{\{\{\{lz\{z\{\{\{\{\{\{z\{\{\{\{\{zz {\{@{L{ L TDžDžt_DžrhDžYDžIr+t&DžtL LиaEtuhwjtTt DžPjS` t7CCB9C uS CPC\CCB9C uS CPCP;tDžDž7t *t t 3P.t|hwhW|0҈щHDžDžjP:tbjjjjnBjjjj)[B(jjjjDEBjjjjH2B( tQ@T8Q4`tQX@T8XQ8u2t)8+ru+E8u#0ltAdRD8 d@ꉑ u щtteE8H t]0ҋyщQƒEEuj5<3" @ pRHEA(A$Ѐ ru `y Q$ujQƒ+2Q̳ƒw@tJ jjR\IC|xt4MtR^tmPjRPjjjEP1Ut&u Ut tdЃ뵐 ʉt4t VVu?u17hEwhkwhkwhwj3S!t[^_ex/vi: %s%.*sUVSuFtjjPvK]FV9tP6]F9uFV9tP]F9uTtSh|h,|L?s s{u~Phh,|tCBS^lue[^---c$-sUWVS] 3V3<+ue~uj‰tjY0@P]t=-@cFPPEf<-u_Fu=j"‰uj5<uW=f]f_Btxp4,9uX19Tv"1Ґ`49t t @9TwP4 8)Ήt8{P`C;uD(Dž`T9`sPp1t4D00|Dh `T9`rD+(P(H(hH\\9l} uO5<Phɇl)PH9ihHƉ\9lvE \\9lWH }t u Fdt$\Lu udL\h·h,|%1}t}GtL9Htu T LZ[^_UWVS}Uuuu W=Y<EPRW Ɖ<Vuu W}t'1tGt9ptuT Ve[^_\PD9/#299|yanked298|shifted297|moved296|joined295|deleted294|changed293|addedzp301|lines300|line%lu UWVSM#AX(tQ @T8 M 11MD\Fv9w9Qts1MD\Fv1ۃ}tMYt Ut-EhEPjuCvxED{xw"hCxPstuvHCtKtMCxET]E1E1MMM|\}t E;C CMt\hjSeEuhM|\tl0u uPS  E C|8uM1u{ uPS}  ENjMD\(EF? GuoBMAWujQЃ1}tMAtM9Htu T u e[^_317|%d files to edit021|new file022|name changed023|modified024|unmodified025|UNLOCKED026|readonly028|empty file027|line %lu of %lu [%ld%%]029|line %luU WVSu0ɋF X߈IM1ۅt^t Ut8EE v_QEPjVsM@ 9KxsQCxPstVsuKtCtESxUT}}F X;tu wFэ ] PVE wXNPVuQu-  UUC;u}}:G G}tnN$tg1ۃ9t C9u~FSjh̔V Qub0ɋ]߈щM؍D:@ @E 1ɋV UfZt=fZ}WhVcuSua  EE t.URhV(uSu&  }} tE,@ @EF@XtEPh EPh Và uSu UUF @t@t},G G}EPhVuSu UU tV@|8uLt@t},G G}EPh(VuSu UU t}:G G}EEPVp}u/URh5VuSu }} EPhDVËU U< EE1uPuu Su0ɋ]߈щM؍DE BURh`V!u Su0ɋ]߈щM؍DEU BU+MM]}tO9N8sJE9s;/uU)ڋF89vC9]w9]uF8])K K.K.K.U)ډUV<FuSjVЃ1ɅtNt}9ytuT ude[^_LC_MESSAGESLANG%s%sVI_MESSAGE_CATALOG030|The file %s is not a message catalogUWVSu j/VսÃtP{uJht8uht#8tPVhhSz^jjjjS8u= ShSjDžDžjPPB Ѓu utHBЃ= St SHhSjuL/ SUB@htP@ЋUBPh1[^_UE@htP@268|confirm? [ynq]269|Press any key to continue: 270|Press any key to continue [: to enter more ex commands]: 161|Press Enter to continue: 275| cont?271|Press any key to continue [q to quit]: UMU EwW$d|PhQ4ÐPhPhPhPhPhUWVS}] u=wm1C=wm1C=wm1ti{|ucMMES+E1tGt:Pht3jEPEPRB ЅuEttHUEDEt0H؍e[^_UWVSMu >t:=vP>zD6tF>ù>uE \E7}tMAt9xtuT WEE}uuǃt~MYt Ut-1E}v^uEPjuit>BM9KxsQCxPstuitCt{tCxET yMEHEu >tN9]vIu9]e[^_@(#)options.c 10.51 (Berkeley) 10/14/96&4ڧЧç|x|m|e[UPKF@61(!4 44ئPѦʦĦ z@pg\@SIA@72- ' P p   Xݥեʥwriteanywrapscanwrapmarginwraplenwindownamewindowwarnw9600w300w1200verbosettywerasetimeouttildeoptersetermtagstaglengthtabstopsourceanyslowopensidescrollshowmodeshowmatchshiftwidthshellmetashellsecuresectionssearchincrscrollrulerreportremapredrawrecdirreadonlypromptprintpathparagraphsoptimizeopenoctalnumbernoprintmsgcatmodelinemesgmatchtimemagiclocklistlisplinesleftrightkeytimeignorecaseiclowerhardtabsgtagsmodeflashfilecextendedexrcerrorbellsescapetimeedcompatibledirectorycommentcolumnsceditcdpathbeautifybackupautowriteautoprintautoindentaltweraseީ ۩ ة թҩϩ̩ɩ"%&,*024:786>=B<?y?wItNqInKkLhMwswmwlwiwawttytypettytstotltagswsmdsmslowshsectscrroreparaoptnumodelinesliichtgtexedebdircobfawapaiCDPATH:cdpath=%sTMPDIR/tmpdirectory=%sescapetime=6keytime=6matchtime=7/usr/share/vi/catalog/msgcat=%sreport=5paragraphs=IPLPPPQPP LIpplpipbppath=%s/var/tmp/vi.recoverrecdir=%ssections=NHSHH HUnhshSHELL/bin/shshell=%sshellmeta=~{[*?$`'"\shiftwidth=8sidescroll=16tabstop=8tags=%sscroll=%ldwindow=%lu031|Unable to set default %s optionUlWVS]EEEEUjjjj?u0 ujjjjV  jjjjV `jjjj3Ve dhtWhhSpM0ɉ߈щJUjVu tDž hB tWhhSL0щJUju> tDž t-!%)0щJUju tDž  *t#*.f2f0щJUjua tDž4t!48<0щJUju tDž>h@hWhScK0щJUju tDž at"aei0щJUju> tDž.jt߾j0щJUju tDž&,hhhSSJ0щJUju tDž'hhhSI0щJUju@ tDž+t߾f0щJUju tDž2.hǪͪtWhժhS=I0щJUju~ tDž4ުt߾ު󥤉0щJUju( tDž5kt-0щJUju tDž6t.f f0щJUjuB tDž9t#ff0щJUju tDž<h2hhSCG0щJUjVu tDž>E t$PvT8JꉕuNu Džh hWF0HEjPu tDž0E@Ru`։ Xw DžIw Dž4E tPvL8 UIh+hWE0HEjPu tDžI3Dž1ۃ=}DžNtdt7IjjjSu) jjjSu (*t3E@URL8u0QjjSu t7URu0v|8uEtqjt2uvE4@L8UQj Su   C8gU :t[u 69t QS0HEjPu uE E 8u1.U h6ju3[^_all032|Usage: %s291|set: the %s option may not be turned off313|set: the %s option may never be turned on034|set: [no]%s option doesn't take a value035|set: %s option isn't a boolean036|set: %s option: %s037|set: %s option: %s: value overflow038|set: %s option: %s is an illegal number314|set: the %s option may never be set to 0039|set: %s option isn't a booleanU0WVSEEM xmMMԋ0uE5aE11ҋtJ=t?u69u"}tuhju u؃=t FuE}t MAMSUƃUЅuD;nu!{ouESUjƃUЅuSuaE^-E@MEu"uM Axu8?u M FrF t}t höF t}u hmt h]xF }tDMIMtQ@|8u[uMuHbMIMtQ@|82MVtEPjuu҃uVjuuVjuuMAVjuQЃ}tjjjjuu}t hJ0(M=wm16j EPuuOǃEPSu.ƍEPuuÃrtt)/SVhmj SVhju }t/1}tMAt9ptuT V}l1}tMAt9XtuTFS5EЁvR zD6EPSuƍEPuuSVhju,}t/1}tMAt9ptuT V}1}tMAt9XtuT^SMF @t}u h׷F uIMIMtA RM9L8 EM9 FtuuuuЃuuuuuuuuhMAuuuQЃiujjK}t"hSju&EGuu}uEMI#F MIMtQ@|8uYMtJu؋MIMtQ@D8 MP FtjuuuЃuejuuu&uNjuuuu7MAjuuQЃujujuuHtEE M x}t uulE܍e[^_UWVS}E Mu@t8@W\8t(VMƃMujjWQt' tu CtPs,US! tu tP^3U1e[^_305|No %s edit option specifiedUSM] [tQ@D8 t8u(}uhjQ^1]%ld%*s UWVSDž\ EH81\$d =Džd\\Dž`DžlDžp=p븠hpP } wi} t} =TSpSv7h@ ] tSTIL8 ]h@4]3t%STv9L<]9h@ ] tSTIL8 ]h@4]3t!STv9L<]9h@ ] tSTI|<u]h@ ] tSTIT< ]Rh@ ] tSTIT8 ]R|u)"h@]'h@PE؊Ӏp80щNpKtcrZt+EPPT[|8+]Pt#]SPT@T8EPRh+jtWd40щTtt']SPT@|8unEPtYh@ ] tSTI|8 ]0щTtd9h`C`hlClpp;D`\9`~E`\Xt8@X/dd1\DžX19X19\~rPuLhLX9`~7hd+hPh/uLGL9\F9X l`h3uK19l~:PuPF9l~h3uʐh3u@[^_no%s%s%s=%ld%s="%s"UWVS]} 1-Gt^r7ItS@|8u t PhItS@D8P7htItS@|8u>t2ItS@D8P7hS Ɖe[^_set %s set no%s set %s=%-3ld set UWVSu E=MA -EAtrrMIMtQ@|8uMtM1hC M1hKVuuSuju_u MA\11}t}GtM9Htu T uX؍e[^_@(#)screen.c 10.15 (Berkeley) 9/15/96UWVS}u Uhj7YÃujjVتUGPW@CC {C,CxCxC|uǃtP謳f}ƒtPS - tPS, tvtPS, tFtm<Wu jjSx ujjVb qW& SV0u5 SVouSVu U1 Se[^_UWVSuF x~ t 1Xt2NA9uFA FBNAV9u AEV|tEVTtE u.F$t'Ã;t35;uv$"~xt FxPLt Pt P@tPNt P迵tP#t P蔵t P聵VVrEe[^_UVS]KQA9t9u9uA9teqA9tV‹9u BABCAZ9uAAAB9A uQ APQ1e[^@(#)search.c 10.25 (Berkeley) 6/30/96UWVS}]MyLw(EPQue}uMtWjuKM t)u}tGu>8Guq}tM9uujVM@MuPEPjjuRVBAEG}Kt1 M9Etv\u B9EuBKuBFu͐}tM])Mu}} Mt PEPEPEPSWu:M@t M u1e[^_Uu:tOR|8u u] tjW됐u 6Nu%uuPW@ ] Uu vuEEdEE]̉]АM}uSWTjjjWsuWT|E tuWEEd}t Uu 9w M}tE DjatOR|8u uE  j)URW^UuE jWBUEURURjQWzEEU1ɉUM9Uu9Mt RURjuu襨1tE #}t]1ډE99U}tE!t jW]1]uĐuu؃EUU1ɋE9u|9UswUM}utRURjuutAtE wWWd҃n}tU9Uvu ]9]hUuE uU9Ur1ɅtJ]K ]؋u^EMEIu tjWaEԍe[^_072|File empty; nothing to search073|Reached end-of-file without finding the pattern074|No previous search pattern075|Pattern not found076|Reached top-of-file without finding the pattern077|Search wrappedUUE wZ$ (0hjRǜÐh hThsސh֐hΐC078|Searching...UEPu h@Ph@(#)seq.c 10.10 (Berkeley) 3/30/96U WVSu} ju$uujEPuÃtOU(}tu 11Wuuƃ t@CtPީ{ sj(jJÃujju袛 u 5<} tu C !Vu uXC u 5<usuuu3C u 5<@MK}u C1]WuuC uF5<s C t PS5<jjuΚ{ U$SM(K$uu:UBDt BDXMADQDStXECCw3MIM%E؃ЋMU H1e[^_Ujuuu jjunt P ÐUS]tCBSC t Pͧs§Ct P貧S詧1]UWVSE} t U E@D}uRs}8U9SC$K9MsM}1t FO)=KU}G 8wsrdU9Su\C$uVC9EsEPuQ9 G|8C9Ert} t(} tU} 3} t} ]#} t}U :1e[^_UVSuNC t P[Ct PKCt P;tCBSSDue[^ UWVSEMADEM }9OG$E}Mq1ۅ~M} u )<~ N9w F)SW蘞 9u1)u} t5Pu  thju݈ 1,} u ATt [^_.recdir: %srecover.r+066|%s: malformed recovery file%.24s: %s vi: no files to recover. UpWVSjj+u t JMtQ@\8 MSeWuh7茣uh9SjuWDž腱ǃjhD_S uhMSƃtjFPjjuRt r  Vh6 ttjhE u[j aÃtEVh t-jhn uj uhPGPju |<EPPHt=<uGP;EPFP躂PEP:PhpDžVqiu h{U'1[^_%s/%s067|%s: malformed recovery file068|No files named %s, readable by you, to recover069|There are older versions of this file for you to recover070|There are other files for you to recoverU WVSjj+uȽ t MtQ@D8|M||Juh|jSM IDžDžDžtDžxDžDžplhjhDS" uS|hhpjjppǃ tjWjjusNtr  Dž DžWhl tvjhl u]j lƃtGWhhR t/jhnh9 uj hUÃu hpjuW[<EPPvt#=<uP7 PEPW~xt9Mxtp%xujjux htu(jju謁x豏xt@tV薏S萏MttRW^B葈xu!h<ju踊t;~hoju 9~hjuǀ jtPu uE.t*x諎t蠎虖2MAxHPHTu M fIHX@1\[^_U WVSjju  tJh Wוà ~"1S>Pu _ |)ƅuƐu1hujub[^_UVS]uU JRSVi t)j S tj)BQRV膖1e[^UVSu VÃuhuju҈ EPVeN؍e[^/usr/sbin/sendmail071|not sending email: %s%s -t < %sUtSEPh thhjuQ'u hhhSvSH@(#)util.c 10.11 (Berkeley) 9/15/96UWVS] }Et 9re=s7ƅu Vn VS蕌Åujju} t)RjPT7 1e[^_U WVSuEPEPEPu uXt}%HEt<9s8M)ȉEt!U< t< uABUEx}uȃ}uH1e[^_US]j/SNt@؋]UVSuFP[Ãujju| tVu SՕ1e[^US]<uuu G<u "uu 1]US]<uuu <u ("u=u=u 1]@(#)ex.c 10.57 (Berkeley) 10/10/96script 170|InterruptedUWVSM1~VQtFuss sVЃtCBSs 茉S膉_luTtLJLJ  tujvLVň V.<tV4@|8u 4t@tV@|8u t@FTSj:FxPV?FTujjjVwMu(FTth VVs jtjP贒Vx zuLJ LJBBLJVt T-FTujjjVLu&FTtFTh jVy T| tM1Ht,%PjVR0 VMVr1e[^_!#&*<=>@~080|Unknown command name1bca1082|%s: command not available in ex mode083|Count may not be zero084|%s: bad line specification085|Internal syntax table error (%s: %s)lr086|Usage: %s088|Flag offset to before line 1089|Flag offset past end-of-file090|@ with range running when the file/screen changed091|Global/v command running when the file/screen changed092|Ex command failed: pending commands discarded093|Ex command failed: mapped keys discardedU@WVSuvu܋}}u܋v|uă~tV }܉Vu@t.ULRu{X }GPut}F uċj3jUăQR Vu>]EFE~`}ċW uuG 0vSr zT6tE}GWrwu}ċW:u$$EnUu8u@Uz}R8tltpt+t-t ^t#umuċV)‰FVEă$nljuF0Euсv R_z4}Sum*uĉF }kt st!u{uNFF oE@Ktct gtru@Iuu?S})WWJډWEă$qljuF(}ă$~ M}t0uсvR|sz4}SuuB( uā~ ru}tF r}t9uċV B uot0puE}t}ċW B VuċV B tJ}dtO\R|8u)u\tj}ċW 2uI *uċV lu}?>uL}uă~t}ċW9u OGuuċV+URuVua8}ċW lu uF(&(ou }G(ou uF(}āUuF o}( ~`u)uu}G`vLFwd}WPuĉVh}āutNR|8u%}tuāfN|}āut+}ċW B u}t2hjunuċV R }u EE}ċWWW 8ntPntot ruă~ V:!uBVNfN|VV}ăuċVсvRWj zT6t}OGuuă~V:+BVVz~vuȉu}ċWt t>_wuNӀ St!B}W8Rr2SWC=u#uċVvEJVVz~Z+vSni zT6uڋuFu}OGAuċV+}ȉ}؉Vpltnt ruċvu}ă[uċN\u6Vv.y u(EJVVz~Zu}G  ڋuFu}OGupt sEuă~}ċWvS=hzT6tEuNF~u}ăm!d pt }QuċV: BNF~u1q%}ătGuċVсvRg zT6t}OGuuċVсvRKgzD5҅u }ċO|u.Eă$qljuF(}ă$~ cuă~tXANVz~t>t9uċV:\u~v BVN}ċW9uIuNF~uE}ăt W: tE̋uċvu}ăuċVt t>{w}OӀ St!^uV8RrNSV9u?}ăv6WRU t|uFu}G EԋuNF]$ t|u }āuN!ڋ}G}uNF~*}ċG}uċVV~VVN}+OUB)щʉW 8qu wut}?\uJEuuċʃw t*}ċW` ttwuF` t/URuI}uFd}WLuĉVd}WPuĉVh}G`WlOpWdOhjuă~`\}ă`G`u~u GlUălRu IZ} tluGd uFd}GpGhuċV`F`}Lu9 t4URWfH}uFlFduVL}ĉWlWduVP}ĉWpWh%uF`VdNhVlNp }ă`B uā~ Xlu}F`}LG~duFL@tN8RD8‹}8uĉVl}WPVpVhURWGUt 9WLs9VlvVluF\V R U:/}?!u,uă~ V:!BVNfN|}ăFuċVсvRa zT6t}OGuuă~}҃F'$"#$$)))))))))))))))))))))))))))))))')))P')))))))))),%%))&)))))&))))))0')))x)uă~E}ċW^t7+t( #t1"-tlt;ptNuF\S}O\KuāfN|}O(,ufN|}O(ufN|}O(uNF~V}ăuċV.t/+t4-td=t;^t*S}ĀO| :uĀN|@.}fO| uĀN|}?3uĀN|}OGzuċV+t-t ^t#uj1u}ċWwm1҅uċVVQFNN|~E}ċWwm1҅u"u>+H}ċW+t -2uċV-uN| +u}ĀO|j URuvUR3o Eu }?0( Mʋu+V)VN}?auVlNpVdNhVdJVluĉFX}ĀO|uvvVu+URURURuu } } UtRuA U}ĉWT#uċNt&~ plRQvVu)>}wwW!uFN}ċWUUuċVt t>cw}OӀ St!FuV8Rr6SV0u'}ċWvJWWrwR}G}9vS>\ zT6/ڋuFu}OG9MU)RQuu (auă~C}ċWvS[zT6tuNF~u}ăWUUuċVt t>_w}OӀ St!BuV8Rr2SV.u#}ċWvJWWrwR}u}OGEmMU)RQuu&=DuvvVu+E}N҃ЉUou u~$}9W$uwҍ X}GRu+PuċV 2h.ju]E}?uă~tQ}ċWGvSY zT6tuċVz~uuă~uhWuțt}ċW rhZju]uċV`Vlu1uj}uuVjjuv Ru=u4}G|u jjuURu>iUuĉVl}ċWdu.u?uuu+jj}w Ru+=u jjuu}@u}V`t*uq}OLVlt9u ^tWuċVl&uNL}ċWdt9u 6t/uċVdu}WLGPUPRwLW uċVVVV.}t2uVLUVPU쁧jURj'V%Y}tG,u~tu V?}ċf}Ru~t<t3}Tu'u uā~ Xluju}܋|҃uā}ċW WuR҃u.uVTujjjVg-u0VTt$}T(u}t Wdu~tj}ċO\t`}9VLwIhhjVuFL9sjjjVRu:u h\}ċw\}wL}LufV|}fV|}tfg|ufF|%uG}u;tOR|8uut}@tt"uVLUEPURRuV踡}}tu؋}Ȁ|7tFWu؋}ȊD7C@=wm1uC8+uFNKCS<-t<^uBSKE Ej EPsEPwuB}U}2)9' ~U~)9rtQjjun}t+uuU+C)CSZ}?tItE}"؋}9s3h,6juLK }9sjjju}71e[^_UWVSMIMMq|9u+GXMǁ*~FP^VjWQ1tGt9ptu TV Ve[^_US1u u[t=Hmt=pru؋]USUE |!t1H1PRt =ru؋]UWVSXl=Xlt)]]88U|u uM t 8u1e[^_099|Address value overflow100|Address value underflow101|Illegal address combination102|Illegal address: only %lu lines in the file103|Illegal address: the file is empty104|The %s command doesn't permit an address of 0US]M UEt(rttjjuh@jh@b{uj1Sqwj$AABA(B0Bh@&EPSR'u6EtPh@h!AjSESV1hHAjSE]@(#)ex_abbrev.c 10.7 (Berkeley) 3/6/96105|No abbreviations to display106|Abbreviations must end with a "word" character107|Abbreviations may not contain tabs or spaces108|Abbreviations may not mix word/non-word characters, except at the endUWVSM Axu-jjuy hwBjuSDtTM AtHPvR{@ zD5%u"M AtHȀx_t hBTM At;t7=vP@ zD6C;uʋM AtPU{E=vP? zD5%u;_uE1=vPr?zD5%u?_u9uuSMGC}djjM AtPr2p0jjuou*MAT1hBhBjuBe[^_109|"%s" is not an abbreviationUVSuE @tFTtjs3Vth`E3jVK1e[^@(#)ex_append.c 10.30 (Berkeley) 10/23/96Uju uLUju u8Uju u$ 273|Entering ex input mode.U WVSUMIMMyu j=M ydMyLBwtOuEM ydt tFKu9uu@Mt)Ѓu:.u FtOKB)PRWGjuNu}tFKujhFFWGju,u[utM qM YM`juM􋁠ЃtjM A 0uDM4thGFQdjhIFuUPuIhGFu<u谎 M A}u2M tQ@|8uMtM<tQ4@|8uM4t@jjuVWuuSjVu ]9t&ssWGjuE9uڋMyLujQt MAL1e[^_@(#)ex_args.c 10.16 (Berkeley) 7/13/96111|No more files to editUWVSM yxu!MA(txuhWIju M tXyxuBMA(P0HPRu usu u[u ujM fA|f%%Pu M yxM u1A$t*Ã;t3K;uMq$oKMA(jM Ax@PMA$ujjQ"=ËM qtp0u tԃxuMA$A(0Qt1ۋM,MA(pQtM@tH  M A}t$RjPuDtMA(M1e[^_UVS]u EPSs t juSc u@Ft0ut 1F}tRjPuotjufu0jVS‹EP$P(C1e[^112|No previous files to editUWVS]u C(9C$uhTLjS?;t/P0HPRVSukVS8XgjfF|f%%PS uCC(pSt0 F}t$RjPSNuC(1e[^_113|No previous files to rewindUVS]u {$uhAMjSR:`jfF|f%%PSn uCC$C(0St. F}t$RjPSu1e[^114|No file list to display ][%s%s%sU WVSuF$uhMjV9EEEÃ;0;HU9^(uUF8H9ErUEh N}tEhNV踇EV(N9uNP3N9uNPhNV$FTu+jjjV u FTu ;>h NV?1e[^_UWVS] tCxj@Pƃujjue8 t0u00}HPuu"t~314[tp0u tރxue[^_@(#)ex_argv.c 10.26 (Berkeley) 9/20/96UVSEu C$jPT CFtC$Fx1e[^UWVSE}uVP S$CVW0JPS$CS$CpC$CM AtC$Ax1e[^_U WVS}1ۅt_t Ut2EEhEPjW苸E>{xwhCxPstW]trCtCtECxETEuEPEPEPuuuu W!$t61҅tWtBt9Eu T uDDEtT]49s4=vP^2 zD6tC9r9tuuu WL1҅tWtBt9Eu TuC1e[^_echo UWVS}1ۅt_t Ut.EEhEPjWt*EH{xw&hCxPstWٶu CtCtECxET:RE>REP]EjEPEPEPSuuu Wy$jj4Wm jj5W{m l|tWt@D8E tM];tk=vP0 zD6u<=vPr0zD5%uC;uEXuxt.PuHuNCu=vP/ zD6uI=vP/zD5%uPutuNCut t6]EEPSG;*uEPu Wà 5EPEPEPWv tuuu W=Ã1҅tWtBt9EuT u@؍e[^_U WVSuMMMvS. zD6tNEu̅JMM1MM t t>GwMQÀSt!*MA8RrSQu vEN(vS. zD6u ENGkWu2MQ$AxAtuM t M9tMNM MwMQESt()MAM8RrPuuEOMAMCuMA$zMAM AtMA$M Ax1e[^_115|No previous command to replace "!"116|No filename to substitute for %%117|No filename to substitute for #UWVS]M 1M$EM}M<#G 19^ ~/Ft@ t 08F4w8C9^ vf8FF F$1e[^./%s304|Shell expansion failedU8WVS}EEj/WƃuE]E}39uE]E}0}HEFu0}HEuDEEuh]uju3^][$]𐐐u\SE}u x.tމǃ0щK]1U0щK]ȋE9r֋}Mu]Eȍ\SuEP$XU܋2}t$uuVA u}wE8/t/F]CUSRV}A EP$XE]ȍDB]C$C] CtE@$Cxu/]S$9Ut"h_j+UURC]S1h]ju (e[^_UUE 00h289|Shell expansions not supported when the secure edit option is setpiperfdopenvfork-c118|Error: execl: %s119|I/O error: %sU,WVSUdtJ\@|8uU\t h_jMptQh@D8EMhMj/uEuUUEM MUUEEEPz}h6`ju&h;`unEu h=`Et tOhD`ju=& }t uqEt P.<}tu<tjuNu<u;j;juhJ`uu(hM`uju]/j>?u;]1MAPQHy Qo M8}1ۃ}tUZtM9KtuUTUU9CxsPCxPstuҦCtKtMCxUT%M9vSQuu菦tqE]U)UȈCMF9]s C< t< uKNU2UM MA @u Qothb`uju.1jjuuuݑt]t9E=vP} zU܊D6tCNuͅuuh]ju#%e[^_@(#)ex_at.c 10.12 (Berkeley) 9/15/96UWVSu @F|t^Q@t*u Mf| jjQ}MÉ=vPzD5t'É=v PUX z4ڋ}G@EtM8Qt 9}u}uEjwÍXMAPu\PuDZhjEE<}GV37 4F1!̽B'vq҅O*%tB#~~'~v~~~~~}~n~[~V~tIR~3~~~҅}}}}w}q}H҅M}?}:}o4/}}|o4||||3||v|tL!e|4|0|TqU|{{!{{{1{{{}~u{`{Y{V{F{${{dM!{zz/zzzfzCz>] [file]wqwrite the file and switch to the next file[line [,line]] wn[!] [>>] [file]wnwrite the file[line [,line]] w[rite][!] [ !cmd | [>>] [file]]writedisplay vi key usage statement[viu]sage [key]viusageedit another file (from vi mode only)[Vv]i[sual][!] [+cmd] [file]enter visual (vi) mode from ex mode[line] vi[sual] [-|.|+|^] [window_size] [flags]2c11visualdisplay the program version informationversionexecute a global command on lines NOT matching an RE[line [,line]] v [;/]RE[;/] [commands]vdelete an input or command mapunm[ap][!] word!w1runmapdelete an abbreviationuna[bbrev] wordunabbreviateundo the most recent changeu[ndo]undorun the tcl interpreter with the commandtc[l] cmdtcldiscard all tagstagt[op][!]tagtopmove to the previous tagtagpr[ev][!]tagprevreturn to the previous group of tagstagp[op][!] [number | file]tagpopmove to the next tagtagn[ext][!]tagnext[Tt]a[g][!] [string]tag[line [,line]] t line [flags]tsu[spend][!]suspendsuspend the edit sessionst[op][!]stopread a file of ex commandsso[urce] filef1rsourcesuspend editing and run a shellsh[ell]shellset options (use ":set all" to see all options)se[t] [option[=[value]]...] [nooption ...] [option? ...] [all]wNsetrun a shell in a screensc[ript][!] [file]scriptsubstitute on lines matching an RE[line [,line]] s [[/;]RE[/;]repl[/;] [cgr] [count] [#lp]]edit the file containing the tag[Rr]ta[g][!] [string]!w1ortagre-edit all the files in the file argument listrew[ind][!]rewindgrow or shrink the current screenresize [+-]rowsc+resizerecover a saved filerecover[!] filerecoverappend input from a command or file to the line[line] r[ead] [!cmd | [file]]readexit ex/viq[uit][!]quitappend a cut buffer to the line[line] pu[t] [buffer]putedit the previous file in the file argument list[Pp]rev[ious][!]previouspreserve an edit session for recoverypre[serve]preserverun the perl interpreter with the command, on each lineperld[o] cmdperldorun the perl interpreter with the commandpe[rl] cmdperldisplay lines[line [,line]] p[rint] [count] [#l]printenter "open" mode (not implemented)[line] o[pen] [/RE/] [flags]openchange display to number lines[line [,line]] nu[mber] [count] [l]numberedit (and optionally specify) the next file[Nn][ext][!] [+cmd] [file ...]!fNnextwrite a .exrc filemkexrc[!] file!f1rmkexrcmap input or commands to one or more keysmap[!] [keys replace]!Wmap[line] ma[rk] keymarkmove lines elsewhere in the file[line [,line]] m[ove] linelmovedisplay lines in an unambiguous form[line [,line]] l[ist] [count] [#]listmark a line position[line] k keykjoin lines into a single line[line [,line]] j[oin][!] [count] [flags]!ca1joininsert input before a line[line] i[nsert][!]insertdisplay help statementhe[lp]helpexecute a global command on lines matching an RE[line [,line]] g[lobal][!] [;/]RE[;/] [commands]globalbring a backgrounded screen into the foreground[Ff]g [file]fgdisplay (and optionally set) file namef[ile] [name]filedisplay ex command usage statement[exu]sage [command]w1oexusage[Ee]x[!] [+cmd] [file]exbegin editing another file[Ee][dit][!] [+cmd] [file]f1oeditdisplay buffers, connections, screens or tagsdisplay b[uffers] | c[onnections] | s[creens] | t[ags]w1rdisplaydelete lines from the file[line [,line]] d[elete][flags] [buffer] [count] [flags]bca1deletecreate a set of tags using a cscope commandcs[cope] command [args]!scscopecopy lines elsewhere in the file[line [,line]] co[py] line [flags]l1copychd[ir][!] [directory]chdirchange the current directorycd[!] [directory]!f1ocdchange lines to input[line [,line]] c[hange][!] [count]!cachangeput a foreground screen into the backgroundbgdisplay file argument listar[gs]argsspecify an input abbreviationab[brev] [word replace]Wabbreviateappend input to a line[line] a[ppend][!]append@ [buffer]@shift lines right[line [,line]] >[>...] [count] [flags]>display line number[line] = [flags]1=shift lines left[line [,line]] <[<...] [count] [flags]<execute a buffer* [buffer]b*repeat the last subsitution[line [,line]] & [cgr] [count] [#lp]s&display numbered lines[line [,line]] # [count] [l]ca1#filter lines through commands or run commands[line [,line]] ! commandS!scroll lines^D@(#)ex_cscope.c 10.13 (Berkeley) 9/15/96ʈUP2#̆Discard all current cscope connectionsresetkill numberKill a cscope connectionkillhelp [command]Show help for cscope commandshelpfind c|d|e|f|g|i|s|t buffer|pattern c: find callers of name d: find all function calls made from name e: find pattern f: find files with name as substring g: find definition of name i: find files #including name s: find all uses of name t: find assignments to nameQuery the databases for a patternfindadd file | directoryAdd a new cscope databaseadd309|Use "cscope help" for helpUWVS}8uu W(t 8M Atp~3=vPzD5tNCͅ]~3=vPzD5uNC̀;t;0=vPFzD5tC;uuuhjW Su W@Ѝe[^_CSCOPE_DIRS :U WVShB} E0}Ѝp1ۃ}tUZt Ut(1EvYVEPju~t!?9sxs&VCxPstu~u Ct{tCxETFPuW }hNEP-t8tPu uN Ր1}tUBt9xtu TWn 1e[^_cscope.out%s/%sUhWVSuUU Zx0HPVRulU Jx9uhu"C9tjVu~gU Bt0}WV蟇tVju:fEf%f=@uFhVhhSVmWSWtSjuQDžj/V,t 0Ѝx7PjPÃujjuS4S{ WVs ECSuu\SuY uFBtBXZSSutjSu 1 Sj[^_cscope.tpath%s:U`WVShM qhhWkEPWuЍFP>M A,ujjujjW薅à |VM q,S 9t)hWju9SSM A,1ҋA,8t8:uxtB@8ujBP苧M A(tjhq,hjߩu1_M q)M A,jj/‹M Q(t A,1"M A,tPM A,[^_pipevforkcd '%s' && exec cscope -dl -f %s-csh/bin/shexecl: %swrUSDžDžDžP|P} h6$U Bt tth;ju t P t P t P tP j軋j讋j衋V K  uU rhAhSijShbhehhƳ(hpSjujp  U B$hz.?U B Bh|?U B1310|No cscope connections running%d%s 278|No matches for queryU$WVSMuhQjQmE19?u]j jJƃ:^^^ j,j+E FMY9^ uN FMHMNNEPuu7E MI MMILMMIPMEMy}M uEE_td MMAPuhss 蝣s EPuSuU$tt VuuB<]u}uhyju1MQQM fA|f%%t&PRu MIMPRub 9u>~9uwp7ƋMy9uO MHMqQu }t%VMA BVALB VAPBFMHFMH FMHt V}tue[^_sgdct efi311|%s: unknown search type: use one of %sUWVS]} 5M =vPzD6tE ːM 9QvRV zD68=8tM 8tF>u>uNh8M uΊuhuS1"Vt}~uwҁvR;zD5t+F=vP&z4VMA@t8Ptut @px0ЍxG#Pj薟Ãujju5 tBCCC KKM CC@ OKCWVP CD8K1e[^_cscope: %d lines%1[ ]%s: "%s" U@WVSE phS3ƒ vPPhSt5j S1‰tSE phju1댋HE ph3ƒ j T1‰uYE PBHBHyE p9E @' u1ېhPo ƃtOtDt <t'40щHV6C~0щHPPPu uu uDžDžFD/Pj{ÃS(St#QR S/@SPR CCt.CC@C C$Vw UE@ CE9PuX E@ EX EH-u u1Ojju:E @@ t <E phjuju u[^_U`WVSuU z(?tfu7hhS{^EPSyxu2M0?HU B9EƒM?u[^_Uuuf%s doesn't match any cscope command Command: %s (%s) Usage: %s cscope commands: %*s: %s UWVS}u tH>tCVÃuVhW9\s3hٛW9s hW99hW9l=lts3jh Wr9;u1e[^_US]um-PjS$]312|%d: no such cscope sessionUVSu] Mu5~Zt9t@uuQhќjVlCt P6C t P5jEPs tCBSC,t PSC(t PCS:1e[^1UWVSu} {thWV t1e[^_No cscope connections. %2d %s (process %lu) UWVS}@uhW7%ÐssVhW7Fu1e[^_UWVS]} u~ u vS#uwj8FEOEEjjv$v EPPSDtwjSG/u ǃECLCPCPPsLSj1e[^_UWVSu0Ѝxl=ltW3V' u ;u1e[^_UVSu] SBHJHys1 Ct >ũujSV*pSBHJHysi1>uC>uSBHJHys61 ^C I1e[^@(#)ex_delete.c 10.9 (Berkeley) 10/23/96UWVS]u {ujF 0S]jVlUR~dW1F|tFQPS-ujuWSvuFdCLEPScuE9CLvCL1e[^_@(#)ex_display.c 10.12 (Berkeley) 4/10/96buffersconnectionsscreenstagsUWVS]U Bt0ct1bt|st?ttVpHwh:u\SjH wLBu@SbNHw0Nu$S^>2HwVuS^j U B pSe[^_123|No cut buffers to displaydefault bufferUVSuF@u uhjVb F@trC=wm1uGC9Ct jSV FTjjjVuFTuF@tgC=wm1t?C9Ct jSV FTu>jjjVzu FTuuF t h8SV<1e[^ (line mode) (character mode)********** %s%s UWVSM AtPEu4M Aujj4u t {EEEEE} tUR6}hUUR}h>hu&Eu h觮Et tshȨju Ut RUt R}t u>)Ut RURUt jRqjuqjuqUt RtUt RcuXuPj/uptNhRT8 }hRu*uptNhRD8 }h@juhΨPuptNhRT8 }hRihѨuptNhRT8 }hRju $jUt RbuWU Jwk} u u=jURuuhۨu1tEUuV\} }?u u}|uVJXÃtt2thjuuuE&uhu# ujjjjuuPhۨu覼PuH} uuut9E0jURuuhۨu0tEu}w\jjhSubHtE}uB} ut1Ðuu/etc/vi.exrcNEXINITEXINITHOME.nexrc%s/%s.exrcUWVSujjhEPVvuhVRF@|xt ViYhÃt*jj0HPShVPhzÃt-jj0HPShVh:Ã;hShh@WAjjWU{xw"hSxRstu>CtstSxUTU+UJM}9}})ω}ԋM؉MЉUăG}ȐURURjuuCU9UsRURVuj>quuV uVuju]D}t*MQZ8t{'t}9{uMȉKuuu#Mă}?}؉}ԉMMЉUăURURjuu_U9UsRURVu=uuV uVuEjuv]}t'}WZ8t{'tM9Ku}؉{uEuu<Mă}<1҃}tMQt9rtu T V.M؋}OLGP}t2WZ8t({'tS9Uw9Ur Su|uۋM}Ol1e[^_@(#)ex_open.c 10.7 (Berkeley) 3/6/96140|The open command requires that the open option be set141|The open command is not yet implementedUMtQ@|8u" uhEjQÐhjQ׹@(#)ex_preserve.c 10.12 (Berkeley) 4/27/96142|Preservation of this file not possible143|File preservedUS]U CujB 0S]@X@uh;jS Ft S(u3EPS聚u"jS)uhfjS޸1]UWVSu} Gt3VOfG|f%%PV軁u@3Vhdt1H G}t$RjPVfu1e[^_@(#)ex_print.c 10.18 (Berkeley) 5/12/96UVSu] fC|%PClPCdPSVuClFLCpFP1e[^UVSu] fC|%PClPCdPSVuuClFLCpFP1e[^UVSu] C|PClPCdPSV5uClFLCpFP1e[^%6ld TOOBIG UWVS}M E]ujA 0Wȏ0]9EEtD?BwVhj ]S(] EjjjEPuWuEPEPjVWw}uEuhW  uuuuWN;GTu)jjjW+u GTu F9u"1e[^_$UVS]Uutj%PREPu SuSCTjjjS賈u CTub%t#jPjEPhSt9CTu*jjjS\u CTu hS1e[^ [ynq]UWVSuEtV@|8u3t'EjjjEPhVEPEPjM 1Vj jM q}WuV]M Y]j^jMIMM Q9UtE)PWSVouXFTuLjjjV(u FTu-EjjjEPhV!u V 1e[^_%cU WVSu8tV0@|8uu0tMutV@D8E uuu>u Fu u~Eux1u])Ӌu9~8ZKPEu PhuTuF T-jjjVuFT G딀wÍXuVUPutEwuFӍ ]Pu Ã};u9V8v~uVUU׃nu9~8u1hVEuuPhuYuF Tu6jjjVu FTuEGKuM}mu>1e[^_UWVS}EPu 4)RD4P肈Ƌ44|3 t=vWe[^_UWVSMu 1E>tB4vQMCM4P4F4 uEG>u}tQ e[^_USM4tARS4RjQǃ41]@(#)ex_put.c 10.7 (Berkeley) 3/6/96US]U {ujB 0SBCLECPEjEPBdP1B|tBQPjSuECLECP1]@(#)ex_quit.c 10.7 (Berkeley) 4/27/96UVSuE f@|f%SVxu SVUt t1e[^@(#)ex_read.c 10.38 (Berkeley) 8/12/96!!%s ! r%s145|Only regular files and named pipes may be read146|%s: read lock was unavailableUWVS]KM} Gxt tj1lM At8}@E?!uDG}Mdt\@M|8u *\tj } G  {u)jSZjjPS[M IxMjuuu SvV} Gx9Eu j G p8HEFt PŻM At}0˶Fu jjit'M tZAt}0hSu ?M tAt}0hSv hSS8u t*jSMЃtj} G GjM At}0EPjE dPQSM @ECLtCPCPPsLS.1C @Euuu Sv} Gx~ tϼM AtP:}C f@f%f=uQrWS.ƃ tC pC pC `?C H SjC pSЃ /uSCvjM At0SFhuƃtEPFPthujS빐fEf%f=tf=tVhjS덐jFPjjSuuuhjSjEPE dPVuSmt} GdCL}t@CL M IdMKLЍt[^_147|Reading...148|%s: %lu lines, %lu charactersUWVSuENMME19E쐐EPuV~ Gd1uRFTutjjjV|u FTuU}u!uPSVMh1ۃ uMq,ujVvMMEGXMA @uwQuj}tM9}uREPu VHuWShHjVD$}t(1tFt9Xtu T S&1#hu jV蠲up}ujjVMhЉ؍e[^_@(#)ex_screen.c 10.11 (Berkeley) 6/29/96UumUVS]E Vxxt @t1PEPSttEC1e[^UMU fB| t t t%1 j B pQ蒀ÐPrXQ149|No background screens to display UWVSuFEX9uhjVoEEEETjjjV,zuFT0ҋC xщHUUF8H9ErUEh5}tEh7VhC pVYEE9tFT[FTu*jjjV{yu FTu h5V1e[^_@(#)ex_script.c 10.30 (Berkeley) 9/24/96150|The script command is only available in vi modeUS]E uhjSԥ&xxtPSuSVu1]tcgetattrptyforkemacsTERMemacs:TERMCAPtEMACS-iexecl: %sUWVS}jj4W2 h色ÃujjW"C CCCK\MQj(uh2jc`cdsTVhht@j踺 uh2BVuCPCPCP uh<tt t@h@jWk Ct PnCPYjhEhKzjhPhWzjh_haz$)qjhat ssjs88js.8 js!8sٹ ptWh@\8 hj/Stu@jhgPSA`hjSjW jW^uGT 1e[^_selectError: timed outError: shell: EOFshellU8WVSj SQDžDžuF PjjSF@P3t uhj+Pv tuhjLh?9 wuVS$uF8RrPVq1t u>Pu-)PWju\{C9m9v')SWREӉ 9DžDžPjjPF@P貶t+ t"hjuѠ H)ÉPu)uSju[~tu Su[^_151|No command to execute U$WVSEPu见DEPEPjuuo{$EPuuu}E1ۃ}tMYt Ut31EEt^PEPjuA!@E9CxsPCxPstu!CtstCxE쁋TuuV* EEPEPEPu uzt }u-]Ut!EPRuutUE9u hzj_)EUMuuw!à 9]uEjhw t%u <hjuh }1ۃ}tMYt9stuGTEE9CxsPCxPstut;CtstCxE쁋T-EE9EsPEPVuujuuEP豶EEPVuu}tE}t,1}tMAt9ptuT VzE܍e[^_U,WVS]{1j EPLEE_G9tBEԐt-@ D@9~Ƌ9]uÍEPjjEPFP育tthjS賜Y1Y_G9Qt-@Dt S%uG9u e[^_UPWVSEPu}#1ۃ}tUZt Ut-EhEPjuED{xw"hCxPstusCt{t}CxE؁TUUE}}huUrG tu/uEhjuA Eu]}9su wURS$}G8RrPWj1t u')URVuEjuxsC9]w9)]čEPuVut}tqEEРj ]S@I}ȋGU DEPjjSG@PuuVu}}ĉ} uVu t uVuEjuwu3E܋UBL}t }OzP UBPju E1}t}GtU9Ptu Tu茧Ee[^_UWVS}uC t PaFP虦C u jjW1 C tVu PsC 1We[^_UWVSE} uH9rRX tQtB;u-t=ICt4;tt+t'8tNGutGC8uINut1}tU2e[^_script-shellUVSut^VZCt P=Ct P,jjhh3Vs Sdž1e[^UEPBJ9tt T Ð9u惢Tttypqrs0123456789abcdefUWVSh+10Et@EE/=/U8S4=45Sp9Sjjh0S"ƃ u=<5Stu+Ph0Sehh0Sfh0Sdjjh0S"Ã$tMU2U }th0Su}tujS̨ }tuhgtSU12VjG?EU:<e[^_@(#)ex_set.c 10.7 (Berkeley) 3/6/96UMU zxtB prtQ&tÐjQ 1@(#)ex_shell.c 10.38 (Berkeley) 8/19/96%s -iUVSujj4VT t ptVh@D8hPhHhS FjjVЋ4PjSu VDÃ0VjF pVЁ؍[^ vfork-cexecl: %sUWVSu }MYjj4Q| t MtHjQЃtjF 0u m}jju\ЋM }thutWuhuu ydt t$hjuɓj/MptQh@D8 MhPdu*MptQh@D8 Mh@juhPMptQh@D8 MhPOhMptQh@D8 MhPju茜$jjjjuPu`e[^_waitpid; core dumped ...%.*s%s: received signal: %s%s%.*s%s: exited with status %dUWVSu ]<jEPVr u"=<thju&E}t C< t< tEPSų0ЍX E&}QPMP&v'PV؃vPh,jux }E1}tUBt9ptuTVNEE}C< t< tEPSu0ЍXEP&v'PV؃vPhJju賐(}1}tUBt9ptuTZV芞O1e[^_WK A4*!   vc SH9/lFilesize limit exceededCputime limit exceededWindow size changesVirtual timer expiredUser defined signal 2User defined signal 1Urgent I/O conditionStopped (tty output)Stopped (tty input)SuspendedTrace/BPT trapTerminatedBad system callSuspended (signal)Segmentation faultQuitProfiling timer expiredBroken pipeKilledIOT trapI/O possibleInterruptInformation requestIllegal instructionHangupFloating point exceptionEMT trapContinuedChild exitedBus errorAlarm clockAbort trapUnknown signal: %dUM1Ҹl9u@ÐBvQhbj(hZZ@(#)ex_shift.c 10.11 (Berkeley) 9/15/96Uju u8Uju u$152|shiftwidth option set to 0UpWVSExujU R 2P:eMtyE̍@|8u" Muhju9jE lPE dPju:+u} tUECMtyE@L8M }}EE@EU؊Z>t9EuCtPMMǁǁ%u+St9Eu9EuCC]1;t9Et~uCG;u1ۅtYt Ut6EEvaWEPjQMMOE>9{xs"WCxPstQMM%CtstuCxETuu1]t9Eu9EC\u_S9EuC\uu\CFuG~CPtQH@|8uj9Hu_.~uWPtQH@|8u 9Ht/CuM M䋁E!uCFuGtPM׎MWM M䉁uHjjQM蛀 1MtAtu9ptuTuxWuPMG M1tAtu9ptu TuM1MuuSu Qe[^_UVS]u ujjSXXu+jPjjRS9t %jP~xt Ft1PVS^e[^UVS]u ujjSXX@u+jPjjRSt %jP~xt Ft1PVSe[^153|Count overflow154|Count underflow155|Regular expression specified; r flag meaningless156|The #, l and p flags may not be combined with the c flag in vi mode169|Confirm change? [n]157|No match foundU@WVS}uj] S 28wL _PtO|R|8u |uƇƇDžDžDžDžMDž9_҃i\$|                                   $  0   < < < < < < < < < <                                              T     h    t   u F\{] K\o<j URuFU :uJU=<"u=u hdu hKjjBu VlVdVlJVlRW[U lRWc\FDžˆtyjju @2uPW uh jWk Džtf1҅tWtK9Ztu@TBh jWjjjWzCDžx tRx[^_UWVS}EE tW@|8u tMtW@|8u tMtW@|8u NtDu ]t6=vPfzD5uFKuυuMM t"@tP KM t"tPJ}M t%EPEPE PW/M;M tEPEPE PWEPEPE PW*MtPvM}tEME@PuMu jjWh Mtuu Pj ME}t,1҅tWtBt9E u T u HvMt*E uu ux tM u uPW)M t @M t 1e[^_[[:<:]][[:>:]]UWVSu1ۋU U}?}1ɅmU<[<*<. <<\t<~+}ME}<t<~tPtVH@|8oH^PtVH@|8 HutlPtVH@|8u OHtD7PtVH@|8u Hu AEMuU}1ۅt^t Ut-EEvXQEPjVt!E?9Kxs"QCxPstVau -CtStUCxET} ?}UU]}<[<*<.<\t<~ }MEU<t.<~tH f fC  f fC CPtVH@|8uH~PtVH@|8u Ht\C}\C\PtVH@|8u *HtS| F~>PtVH@|8u Hu\C}UCEMU} )Ӌ}1e[^_^.[]$*U WVSuEM91ۅt^t Ut(1E?vVPEPjVt!>?9Cxs#PCxPstVu CtStCxETM օt#D;}E}uu;iuu]jEujju[ }7}}}uFuEEM}IEEEEEEEE|EElEw}O S#uV8RrRV*1t }9ukuRhRQ6iuu jjVZ }uLJu}<}}t$w}t#}tr}tsEӉсvR^V zT5Ӊсv Roz4^EӉсvRU zT5t6Ӊсv R[z4 iUB9Usjvu}t7uE}uukfuugEujjuX }guuu}G}EM}}u>u}7u}71e[^_@(#)ex_tag.c 10.36 (Berkeley) 9/15/96UWVSudPjjjjj:lS4,0} HPu EPS,,SVZu 1X[^_UE Pu158|No previous tag enteredUWVSMM AxFt PeM At0`Fujju^WMtQ@T8 MtC^0H9v+%~uh/juVKgMtQ@|8u;Mt,M %PvufE u!vuEE196u`j jǃ___ j,jE`GMY9_ uO GMHMOOMY ILMMIPMEt{}M uEM fA|f%%t,PMqu MIMPMqum 9u7w9vu~x>NjMq9vuN MHMqAp$p u#}t!WMA BWALB WAPBGXGMH GMH1.t Wb}t ubuu e[^_282|Already at the last tag of this groupUWVS}U 9ujjW lC0C9uh:3jW+TIfB|f%%PVW t&sCt VSWjsv$v W 1e[^_255|Already at the first tag of this groupUWVS}U 9u jjW kCpC9uh4jWjSLfB|f%%PVW? t&sCt VSWisv$v W) 1e[^_UVSu] {usVCtHF 9Cu1AjuV u*j jsVUu 1e[^UVS]u ~uvSOFthEPSsT uTjuSy tjEpP% *F9C t0ujPut7ju|u-XMCAVQ C f@fBFpjS:‹EP$P(ʀC1e[^159|Less than %s entries on the tags stack; use :display t[ags]160|No file %s on the tags stack to return to; use :display t[ags]U WVSM9ujjQR,M Axt t UM AtEj EPue‹E 8uD9tJ~9u9uuh56juzP]0}Ѝx9tE9t2C@@Ej/P(!uE@WPuq t ]9u9uhu6ujuY,9u 1$`M fA|f%%PuuLe[^_UME 9tf@|f%%PBpQÐjjQUWVSuM XF 9CuC FLCFPWjuVq u-SC BSCBF Hj jsVt 2SVCu9] u98uPV*1e[^_292|Display too small.%2d ... %*.*s %*.*s* %s%.*s UWVSEEEE9EujjuEx8"wh 9jP2NzEZjjju !uE@TEE9E9EpE9puuh#9u h(9uVu^Z0ҍJvDPjjh,9 Sjjh99u袛E9puhB9u芛E9puRXtKEP8Bv=0I9vSQI9E9puD9RhO9u0hV9u 6E9EEEE@T1e[^_UWVSEEM M89EPWu  weEPuu  M9Ou UEB]uuF C9Vu^ MA EUP u6uG9uUM ABu91u MAEuF?9}QjR"Rh>jRoHÐh ?ސ YUWVSMMSuOMYu} }t.=vPlD zD6+uj3UÃujjuG}FP UCujjuG CuSUDVuPr` CCMA CA Y OM?tG 1e[^_UVSu PV}9u PV%CuCtP U1e[^UWVSu} U=wm1t"WEPV' ujYEEhjRW]SSV芡t?j(W_t)hjRWSSV_tujV1u džEFLFPFPPvLV?1e[^_UWVS]} ;t;=vP2BzD5u CG;u;t3=vPAzD5tC;u͋};t9=vPAzD5u CG;u;t3=vPvAzD5tC;u͋};t9=vP:AzD5u CG;u0} t3}t#}tu׆~1e[^_rxxglobal -%s '%s'r162|%s: tag not foundUWVS0ҋ} Ӎ{C PjWƃFFF FF~Su P\ u qC}tnCRhsC8SFkhCS,d4(,h(覆 '(0щ$ 2 u!(щ$Ƅ 2, uhH[hZh0Z(Z0ҿH[щ$T ,$RjÃC(ChZPЂZ0щHCC@C hH[P观VF C9Vu^F ^ ,FV9u(hCu juKV(P0HV1[^_%sUWVSMM0} ȉӍsC PjǃGGG GGwSu PZ 1MYt,u WSut Kcu֍GW9u`hCu juJt=MYt3Ct%u!C <hEsjuJKuWO W1e[^_ 163|%s: corrupted tag in %smunmapcloseUWVSjjE peE } <E H `EPu<u#jjujjuj4Wtu <E H u:V tMЉMQtuxuxuxxEM9sU: t BE9EwU9UQ: HuFxEx1hFEPpƃt;t t *| pp0҉HEC~u0Mlt#tl0֍~MQuuU‰UEPM quUVuhFju>,}t41҃}tEPtBt9EuTuL}1҃}tMQt9rtuTVbLr|uEPEPpu uEED/PjPÃS(SEXtPuRV SE/EMASUQpRV EECC@C {$VlPV UMI KE9PuX MI EX utSthGju4= u=Sth Gju=1L[^_%s/%sU`WVS]U;/ttuVStcj/U r ǃtMSU rhJhS舮/VSuU zU:0HU[^_UWVS} u)89sKC< tD9r>VSu uމ)89s C< t9r9ue[^_UWVS}] u9s5VSW9 u$t9sC< t9rʐ1e[^_UVS]U u< t'8t8}5CB t9s: uӀ;u19s t t e[^@(#)ex_txt.c 10.17 (Berkeley) 10/10/96UdWVSEM 9t'9u~ wu FDj jjuƃ=} ~M 9Ouq } pM 1}LG~MIMTt+egVF{ {}t%@}VjjMqLQ賸uuVuEjjEPu iEH w@$NdNDNpR:OPNMPNPNPNPNMEEPuF@9F sPF PvuFEr$N,PtP R R R RN R R RN R R R R R R RPPEE tVtF|\E]EtOF@V9uDF|.u:9U u F} GFBV9U u M V~j jjuÃ~G{EtQ}u*SučEPjuĶuFSvVju蝶EuuSuދM AF} 99u7 M A0} wF9FEEF9FEEEtz19^v9F=vP3 zD6tC9^w9^u5FFUF@ {h{j ]vEV}t}tiF@9EEFvPEPju4Evvu\O FEEEF@9\EjuM|FF*9V'VuV Fju}|uuVuE@t?E=vP 2 zD5tE t NVE FEe[^_%c%6lu %.*sUWVS]} u@tuh}Rwt:tS@|8utwhR^wtwwhRCw h{+e[^_UWVSutV@D8E}}utV@D8E}}11ɋu F9s-~}Eu<1 u1uE)CA9MwK1u)1E9]w$1uE)E1uE)9v)ˋ}D;u 9F s&PE Pvu]u Q} G}ߋu ~F}t+u VF FMu} WG GKu1e[^_@(#)ex_undo.c 10.6 (Berkeley) 3/6/96UWVS}GLEGPEjuVj'W0uF_CX| CXC4C4tr;u>VWuC4*VWmt $C4 ;CEGLEGP1e[^_@(#)ex_usage.c 10.13 (Berkeley) 5/3/96To see the list of vi commands, enter ":viusage" To see the list of ex commands, enter ":exusage" For an ex command usage statement enter ":exusage [cmd]" For a vi key usage statement enter ":viusage [key]" To exit, enter ":q!" US]hUShUShUSh1VS hjVS1]The %.*s command is unknown Command: %s Usage: %s ^D%*s: %s UWVSU BxaPBt=vP,zD5t7E=vPeƒ z4 EEXl=Xlt4u>Kt Eu>uu>t }tCF u=}t+=v P#2ƒ z43shVUuvvhVu}rtr7ru Er EruvvhVu}EXl=XluFTjjjuuuFT}XluVnuF t_E[vR1z4EuEE]PUH]t ACuMuuvQj hWu|u>t>1e[^_The %s key has no current meaning Key:%s%s Usage: %s %s UVSuU BxBtxtj B pV~W[t]u@9uE~u/ tV@|8u tx? yPu7wÍXF SVPhYVj{R@ PvRn) zD6YtYRhYV{1ۋFTjjjVu FTug~u. tV@|8u tx? y@ tPhYVz C~s<1e[^@(#)ex_util.c 10.23 (Berkeley) 6/19/96UWVSU] u} hjRU[D[XlUZ r`MJdMJlBpBh}tfJ|Bxztte[^_UWVSMU u}AtYx2zQxZYxAtDe[^_UWVS} U<1ۋq,Q0U9r,C9v PA0Pq,uM輬MtbA,q,ދGPWHyWMatMu%G u=<u!<g 끐t u uU1FCSe[^_167|%d more files to editUM} uPA0@Q,9tEA(t>xt8Q0A(Pxt :u+A(HPh\]jQ *Ð1UVS]sjSЃtgjjS\ tS@D8C4`tSX@D8XC8$ 1e[^168|Buffer %s is empty144|%s: expanded into too many file names283|The %s command requires the ex terminal interface272|That form of %s requires the ex terminal interface274|Command failed, no file read in yet.173|The %s command requires that a file have already been read in171|No previous buffer to execute172|No previous regular expression230|This screen may not be suspended290|The %s command is not supported when the secure edit option is set284|That form of %s is not supported when the secure edit option is set174|Usage: %sUME U $`````a a(a0a8a@aHaPhj^jQ&h^PjQ0Ph^Ph^օuh_jQ&ÐPhA_h_h_ސh_֐Ph_Ph4`Ph|`jQ~&@(#)ex_version.c 10.31 (Berkeley) 8/22/96Version 1.79 (10/23/96) The CSRG, University of California, Berkeley.Uhaju%1@(#)ex_visual.c 10.13 (Berkeley) 6/28/96175|The visual command requires that the open option be set%luz%c%lu%luz%c UVS]u tS@|8u# uhbjS&%FduCLfF|%b t# t2@t=t"^I-A.9+1S CLBC @CPPsLSܦC H F|t"vXPsLhUbhP]PsLh_bhP>j PPjSifF|%=t%=ujjjj" jjjjS \u tEC CPShfbS}=vPzD6t E}?uŃ~x'}}?!dtS\@|8u\tj F 0HE}?tD}=vP[zD6t E}?uŋ}?u j F pj0UHPuVSjFt@0EPFlPFdPVSAu heSn1~dwFl@PSuM~xto}t[}?>uS>uMM}?t>}=vPGzD6t E}?uŃ~xt}?u uj0UHPuVSFx~ t 0FtP:}C f@f%f=uTrWS"E tC p5-C }xC `?C H SjC pSЃ &uSjuSuuFlPFdPSe[^_253|Writing...%sU|WVSuEURUM M}tU M1EE$i}9]E@d1ukUBTjjjRuMAT}$u,}uPuuUhE EPEPjSuVuju9ENjFHNHx  Vj `D uGCE9]VuEEPFPufEf%f=uFPHuVhu1-UB@Xuh3iu jR&VSh}$ujjuMhЃ}t U :UM؍x[^_@(#)ex_yank.c 10.7 (Berkeley) 3/6/96UMU yujB 0QÐjBlPBdP1B|tBQPQL@(#)ex_z.c 10.10 (Berkeley) 3/6/96---------------------------------------- UWVS}u ujF 0WjF|t^X$ltWd@\8dKEEVdUfF|%@t{t( tO>==2!E9v )‰@FdFdFdH9v )@Fd FdEEC9v )ډVd Fd]^lGLEGPEjEPj'WEC9v )ډVd FdMINlVWbhkWhMMNdNlVWbyhkWhEHNdDFl#tEEEFdDFl}t EPWXE9FlvFlVW/b}tMOL1e[^_@(#)ex_tcl.c 8.10 (Berkeley) 9/15/96302|Vi was not loaded with a Tcl interpreterUhenju.@(#)ex_perl.c 8.10 (Berkeley) 9/15/96306|Vi was not loaded with a Perl interpreterUhnju@(#)getc.c 10.10 (Berkeley) 3/6/96177|Empty fileUVSu] EPC PCP3VNt}t hCojVD:C t PstCCCCSC1e[^US] Ct$C PEPjH @Put CqUSC t PRTtCCHCCCC0C HS9u CJKCDC '1]UVSu] {ucC=vFPXCCSVu{u,SvR" zD6u1e[^UVSu] SVt ACttۅu+SvR zD6u1e[^US] C$qHrqHrqrt}C PCPjJ BPuJtC t Ps茳tCC\CC HCSCCSu;u C+CJKCDC %1]UVSu] SVt ACttۅu+SvRY zD6u1e[^@(#)v_at.c 10.8 (Berkeley) 4/27/96 %luUWVS@M A1tY@t*u Mf| jjQMMÉ=vP zD5t'É=v PiI z4ڋMA@t8Vt6uuEjwÍXMAPu|PudM^ F9tIǐFu9;tjjh#sjuujssju~u[9uM A1t)qh%sj]SjPSjuFf1e[^_@(#)v_ch.c 10.8 (Berkeley) 3/6/96UUM Aw[$$u8uHuTu`uluRÐQRÐQR%ÐQR5ÐQRÐ#UVS]U Bw]$uuuuuuSFIRS-RS!RS1RS s"Ѝe[^UVSu] SVFt 1K@S,tB u S] y copy text to motion into a cut buffer[buffer][count]y[count]motion x delete character[buffer][count]x w move to next word[count]w u undo last changeu t before character in line forward search[count]t character s substitute character[buffer][count]s r replace character[count]r character p insert after cursor from buffer[buffer]p o append after line[count]o n repeat last search m set markm[a-z] l move right by columns[count]l k move up by lines[count]k j move down by lines[count]j i insert before cursor[count]i h move left by columns[count]h f character in line forward search[count]f character e move to end of word[count]e d delete to motion[buffer][count]d[count]motion c change to motion[buffer][count]c[count]motion b move back word[count]b a append after cursor[count]a ` move to mark`[`a-z] _ move to first non-blank_ ^ move to first non-blank^]] move forward section]][[ move back section[[ZZ save file and exitZZ Y copy line[buffer][count]Y X delete character before cursor[buffer][count]X W move to next bigword[count]W U Restore the current lineU T before character in line backward search[count]T character S substitute for the line(s)[buffer][count]S R replace characters[count]R Q switch to ex modeQ P insert before cursor from buffer[buffer]P O insert above line[count]O N reverse last searchn M move to screen middleM L move to screen bottom[count]L J join lines[count]J I insert before first nonblank[count]I H move to count lines from screen top[count]H G move to line[count]G F character in line backward search[count]F character E move to end of bigword[count]E D delete to end-of-line[buffer]D C change to end-of-line[buffer][count]C B move back bigword[count]B A append to the line[count]A @ execute buffer@buffer ? search backward?RE[? offset] > shift lines right to motion[count]>[count]motion < shift lines left to motion[count]<[count]motion ; repeat last F, f, T or t search[count]; : ex command:command [| command] ... 0 move to first character0 / search forward/RE[/ offset] . repeat the last command. - move up by lines (to first non-blank)[count]- , reverse last F, f, T or t search[count], + move down by lines (to first non-blank)[count]+ ) move forward sentence[count]) ( move back sentence[count]( ' move to mark (to first non-blank)'['a-z] & repeat substitution& % move to match% $ move to last column [count]$ # number increment/decrement[count]# +|-|# ! filter through command(s) to motion[count]![count]motion command(s) move right by columns[count]' '^^ switch to previous file^^^] tag push cursor word^] ^\ switch to ex mode^\^[ exit input mode, cancel partial commands^[ ^Z suspend editor^Z^Y page up by lines[count]^Y^W move to next screen^W^V input a literal character^V^U half page up (set count)[count]^U^T tag pop^T^R redraw screen^R^P move up by lines[count]^P^N move down by lines[count]^N^M move down by lines (to first non-blank)[count]^M^L redraw screen^L^J move down by lines[count]^J^H move left by characters[count]^H^G file status^G^F scroll down by screens[count]^F^E scroll down by lines[count]^E^D scroll down by half screens (setting count)[count]^D^C interrupt an operation (e.g. read, write, search)^C^B scroll up by screens[count]^B^A search forward for cursor word[count]^A@(#)v_delete.c 10.9 (Berkeley) 10/23/96U WVSu F0t  PNUWVS}u dPjvu'@$E􋆘@EWu Vp[^_US] Ct t0jjjjjj,jjjjjjH|P w|PSuxUWVS]EP PSBЉ1u Sute[^_U WVSuNM1EMA|xhAj:u VlI9^xC8u&{vSVETtVL@|8u LtSVjjssjV{!Vjt) {x{ {h{j `VxVm>EPVouP}tF,tEPV<uu V,u }u1Vve[^_UVS]u jEPjsLStCLCPE9CPr 1҅tPSPCLFDCPFHF0% F01e[^UVSu^{u Vu,EPVS8C ujuV tuKE[UC@BCH J F f@fABLPRpExLu@LvEF1e[^307|No ex command to executeUS]EPEPjsLSt{LujjS\?Et)jjPujS!u"CC1hjS']UWVS]} Cxu SZuFC@s@9u17CEPSSuwwujSs se[^_UWVSu^jVhǃt?CPVSpA u-jjWsuC@`X1spCe[^_@(#)v_increment.c 10.12 (Berkeley) 3/19/96%#0*lo0x%0*lx0X%0*lX%+ld%ldabcdefABCDEF181|Cursor not in a numberUWVSM y#uA+] C<+t!<-tjC(puiM A1tA=v juԐE EEPEPEP] s4ut }@뗋M I8|9M)E|=vP4 zD5t||9Mw|9]M 9Y8tMYPjQ]+|tU|<0D Sv6z{JRs4VeC@ S,t?B t99C8u4VCroS,tB t{8u VrOC@C8K@9sS,t)B t#IK@S4K8SDKHS,t B tHC8S)t= (t*`)o\(qP]oD[q8}o,{q >o<q@B} W4UEURuMIMԅEURuMӃMԅUtt#tӐU9uEÐ9uMu}thɵjuVU} WuURukKW,t3B t-MO<}t uNw@G@W4O8WDOHMOPU|1e[^_@(#)v_put.c 10.5 (Berkeley) 3/6/96UWVS}u F1 t VW/F1ti^djVDRV4R1F1tVRjWu7VDNHV4N8WTujjjWSuWTt Ku1e[^_UWVS}u F1 t VWF1ti^djVDRV4R1F1tVRjW:u7VDNHV4N8WTujjjW诚uWTt Ku1e[^_US]M AσwW$l23456 789Q]@(#)v_redraw.c 10.6 (Berkeley) 3/6/96UEPjP@(#)v_replace.c 10.17 (Berkeley) 6/30/96186|No characters to replaceU8WVSu} MԍURURjw4VɡuE܅uh)jVFEG1tOMЋW4W to execute a command, :q to exit187|No other screen to switch toUSMth!YC9tQ"C9uhjQ訿AA1]@(#)v_scroll.c 10.9 (Berkeley) 4/27/96UVSu] C1tHsVu0{uEPV蘠u}tAC4PV%[2C EPVfuދEuC:]][[:<:]]%s%s%sUWVS}41ۅt_t Ut'1EvTPEPjW6t <9Cxs"PCxPstW6u wCtstCxEThE0hMhUuV&jj@PVu WSÃ01tGt9ptu TV؍e[^_189|No previous search patternUWVSu] EMS,t B tVut#rIuXQjuuS*jjjjjjSOSuCD$@PSuIFt 7ME 7E0ډH9D։) EEPSu fEf%f=@ul MAQduPu `U@<C9v19v,8:u B9w鉕EtIt'CAuЃt} )ww(M y(t'CFI(AuЃ} W)щG9G s"PE PRuu F} OwwG t(PQP CGu߃EPE0fEf%f=@M A(uwQ)։A@9A s'PE PRu u h} GM qA tPV@P } G HM A(u F/Dž 1[^_%s %s%*s UHWVSE@Ej/M 1HƃtAE+0AM] KEE~6ME9BrM 29Ut E KEˋ] EEE~g1M u1>tBw!E@҉UԍU]UPu|DF>u9}s}KEMMԋE1E)ЉEMtEEEP89UMQEMQuSƋ] ~%Vh u ETuKރ}{1҃}tMQt9rtuTUV EJ1uE9E vE 1uEt@E EE]19}EPM EPu|Vh uƒ}t@E}t MIMЃ}tE9ptu TVUGU؋MT]9] v1h E)Ph u=MTu^G9}Dh uwETu8EM9M h uLETu u MT}t E1e[^_UWVS} Mq5WE< uEPEPwRQu-EE}PF(EHF(NE uEPEPvQudr5w}Gҍ ]Pud>EUE9sE)ЉEnF9F sPF PvuJF]+]F(F PVUBPDP_^^(NU < uL KtW AKuHtuԀwM؍XF RV9Ph jV,k1E9uC땐9EuKuUE9ruE9ErЋEFLEFPjVDXuj@\tVT@D8TPjV=e[^_U WVS] sNKEE=vPMfMzUD6u#9st9s$u}NIE륐yUz}z$E{ )ljz C(B(U)S}tEC(S D)CC EC(C )CC C(E=vPMeMzUD6tKK9st 9s$tIN볐}1e[^_UWVSu}~(M 1ۋMxM9u^ BB,Ë9Uu9sQ)؋~(9vjEPjM puLDu%VVEWPR辁F())FF(~ e[^_194|No more characters to eraseUh$ ju~h@(#)v_ulcase.c 10.7 (Berkeley) 3/6/96UWVSU r4z8B1ZEPEPjVuuCtujju}NpEu KM AHQ;U9rHM))MIM1ۋMU JHuWuuVuttF1YU rD1e[^_UWVS}u ^4EPEPjSWBu;}t>F0u 9^EEuML9M 9É=vPhb zD5t'É=v P-h`z4RӁvRbzD5t,É=v Pٚ z4EF9uI}tuWu uxEtE1}tMAt9xtuT W*sEe[^_@(#)v_undo.c 10.5 (Berkeley) 3/6/96UUE @HBHXB@4RNUSM] A,APX|ʀPX@4C1 ux4uP4@4tuCDPQLCDPQPt]@(#)v_util.c 10.11 (Berkeley) 6/30/96195|Movement past the end-of-fileUVS]u tEPS@Eu"E9rjjSh# jSce[^196|Movement past the end-of-lineUVSu] t EPjj3V>u$EH9CujjV$hD$ jVce[^197|No cursor movement madeUh$ jub198|Already at the beginning of the file199|Movement past the beginning of the fileUUE t8uh$ jRqbÐh% 200|Already in the first columnUho% ju2bUVSu] 4=vPj^ zD6u1 FKuɸe[^201|Buffers should be specified before the command209|The file is empty202|Already at end-of-file203|Already at end-of-line204|%s isn't a vi commandWindow resize interrupted text input mode205|Usage: %sUME U$& ' ' ' ,' 8' 8' `' X' h% jQ`Ðh*& jh@& j␐h[& j֐Phv& uPQ`Ðh& 몐Ph& jQf`@(#)v_word.c 10.5 (Berkeley) 3/6/96Uju uUju uUWVS} G1twW4UW8UURufGUUt8MvQ\zT6tTW,t5B t/}t)u$?K4?URuHN}N]]uu%GU[u/MvQP[zT6tu+W,t$B tt 4uuuG }NQE}u:UсvRZzD5҅u}_t EURu FUVMvQGZ zT6}uEUсvR ZzD5҅c}_uDXMvQYzD5҅u }_u5W,t.B t(t4uqURuEt^}u/UсvRJY zT6tURu'Fu:}t N7W,tB u&W49UuW89UuW4RuIUWMvQYVzT6}uEUсvRVzD5҅c}_uDXMvQUzD5҅u }_u}unURW Ct]}u/MvQtUzT6tURWQBu@}t NQ] S,tB u)] S49UuS89Uuڃ4RW;U] S e> : d? > : uS[h}G(@tldtS\@|8u N\tCjuCTjjjSQCT<}G0%=u GvU}ujRSy E}SLEËuCjS rSЀ{}G2tY}uSUlj󥋃 uF1t}G0% wtu=t9w@t>d=t?[u@P}wDSNGH ?u@0}GHEHPuvDS' uZ Z}GDCLOHKPW0@u"tE9CLuf}AE9CLu9Mt4jEPj'SGtjSR#th8 jSrI CTujjjSOu9`w,+\P\uxXЋ\ wÍXMQSuBGNudll39\s&+\P\uxXЃ } ujjux\Ѓ uxlЋtǁXpM)MhtEM}hu$tXP|PuxpЍL[^_.U WVSu} NMXt*jhm PVǃXǃPtFjVЃt*du\w%BuaFTuUjjjVu FTu6%t PWVT PWV ?tF9t@t jjVM\Ё \vQE\V49s)EF4Eǃ\ǃXǃTEPVǃ\ǃXǃT1e[^_U(WVSu~M؃} uu EPEPu pЋT t$TVdЃt%jvLV% V"ltluRjVtCss sVЃtCBSs %S%_luM؀M؋\t'u(}tjjV M؀1=jjV~E M؋\V49s)؉EF4EMǁ\ǁXǁTt EPVJuuu 1e[^_UWVS]sS4trj\9sK@M9s ) @)‰1PSStЋC9t)jS@C49sHPSSЃ}u C@9Tr uu Se[^_U WVS]sjS@C49sHPSЃ {4uEPj&}tr}u&EPjEPjEPjS* %uPSX\LJTSljSЃ} t M jjEPSuXEttSdЃEqT}tr*}u$}quT}:u} t M e[^_+=+=+=+=+=+=+=+UWVS}w8v_jjW\Vhs WXjjW\Ѝe[^_%.*s UWVS}ujjÃtkV!C tNVWP,sM KMAPluXllC=:utXSt Sn!WVhs h,|e[^_@(#)vs_refresh.c 10.44 (Berkeley) 10/13/96UVSu] S 9SrFRЍBBjjPV,t C HK P9Ss1e[^UWVS}OM@t!Yȃ9t9t @9utW@|8u t MYZ9tOuD`ut/ff %PSE9u} ut Gu PWht R1MYȃ9t$EtjWSu 9]u߅tjWMЀ1e[^_UPWVSuNM̋MEE tFǁt jvL}jvLjjV @^@9^DFL9veSPRV6ËF@t 9vwF@9F<kV0gKF<ȐFL9-v@PRVf6ËF@t 9vqwkF@9F<BPRV1 jjVKF<떐jV@F49sHPVM̋VM̋lЃ]j+ЉPVM̋VM̋lЃN<FD9FuRjVWjSP1s8щEt@E}uEu]UEe[^_UhWVS} uAEPE PjuuMM}t} u}t E1 U8tr0}؍T8U u0u}tG UЍ4R|8} E EU UE1ۋut~Eȍ@|8uutE}"}}O}}EEE uw}uqUtr}L8 Uut'~}E@U؋u}1t8؋u1)щM5}w}E 9]MuuiEMUUӃ}u%uv8u9r} u1ۋE1)U+]UUJU} u6uEEE uw}uqUtr}L8 Uut'~}E@U؋u}1t8؋u1)щM5}w}E 9]MuuUEMUUӃ}u%uv8u9r} u1ۋE1)U+]}t M}t}uUR5u}t E)ȋ}Ee[^_UUM }t"EPjjQRuEu1HÐBTt PQR Ð1U,WVS}EPURju WA}t}u 18tW0@D8E 0MtW @D8E uE1w8U1ۋMMuuHEԃ}9_8EEE uj}udtW@D8E Ut IM܉؋w1t8E)<1E)+}wOE ] uWMI}N}t } u1+_8Mԃ}]UUE us}umtW@D8E Mt"4vuEԋO1t8u)։uGE1M)щM2}wGU ]MuW/E]9]w%u+uu9]u]K}9v}OGEEԃ}u*W8U9Ur} uE1u)U)UM}EHe[^_@(#)vs_smap.c 10.25 (Berkeley) 7/12/96UWVS} ]Mut u ujuu uGM98[98vttr t4@‹MA< HuMAL9r(H"‹MA<HuMAL9r@AL džM9yLuMu u\v MQEPEPQpЃ twt Ht+AWu Wuu #Wu/t MAuuQ1e[^_UWVS}u M_<BKu󀏬@t5EEEW<tPVEPWƒG<t 9 ]SWt EjuWE W<tPVSWrƒG<t 9vEEBEB_t40@@_0@jVW‹P 9ZSRW rڋ9rz@@9v&ZSRW \ڋ9w1e[^_UWVSM ]9t9u]tS @|8u] t)V]9w 9 uG9v]9{uju u-E M9A uo}98shWSAuZ}t@}t:U9t)VuS u EM9s"PSujS(EC@9CD9Es }}苰S uM}tMUЉUčMMuuST uE9EtPSbt}uM}uujjS ,jju S }tEPS tE}UUC@9C<uS u90tVStdM}ujjS輱Q}uEMC<}O}uE̋M @ A}11}EPS UU9tRSS}t}t&XM9s M?5tU9sUEM7}-}t/w}}}MU CT1s8tS @|8u  t MAUBHC8PM1SU }uEA}t:M9t'qS>tME}uUzujjRS耯MU A B1e[^_US]CjjSjSu^C4uPPS 9D@PBPRPPSGtjjS躮]UWVS]} s{4u SlaEPEPSpЃ DStjS@C49sHPSSuuSЃ Ou1e[^_UHWVS]Mu8uetS @|8u uxu)Av9ujS軁 %EȋC@9CD9Es}苰Su\EPEPS* u}u0tS @|8u+ u}t}uM}uujjSM jju SEtEPSMME}C@9CCF-j3Q9CuCF[C^1e[^_UWVSuM ]CtV @|8u t9O;AC'ytIIKHjPVC;%e[^_UWVS}WL39r|9spM 1j9t А9u9rEs9t9Fuŀ~ujjSWuGP9s9se[^_220|Movement past the end-of-screen221|Movement past the beginning-of-screenUWVSu}Etywg2')ڍЉ9w!Å3V詼hG 0V耼EPV~E9v9x9w񋆜9])Љ؉R)')ʍЉ؉Rэ+Љ9wy)3VXEPVۻuZU9v9v9w+Љ9vhk jV;) {ujjSV'u͋M C A1e[^_UWVSu }MtQ @|8u#M t9v)r)ljj9uFH\9v$vNX9rK9urFjSuƃ K䐋jSu+Fp9urjSuƃ C9re[^_@(#)vs_split.c 10.31 (Berkeley) 10/13/96222|Screen must be larger than %d lines to splitUWVS]u KM{4wjh jS^.jjS^{4 }t vj@Pi‹u jjS u CL@@C@9CD%EC8F8E}uPEPSSu4U+Љ@9s uE}tgK4)N4CHFH{4N4KHCFES9u Mq2sV4C@)Ѝ@PRRP2~4C4)C4CHFH^E9uMq r3S4tBC@V4tBF@}tc}tN4)K ttSyB<|[+XQQ9A%XB<|[+XQQ9A%0B<|[+XQQ9A%]-atimeUVS]%h[h4 j}jSh VaF~ u ~uFe[^USMU At> ttSyB<|[+X(QQ9A%XB<|[+X(QQ9A%0B<|[+X(QQ9A%]-ctimeUVS]%h[h0 jjShݿ VeF~ u ~uFe[^UUd[h, j/forkchdir%sUWVS} 1ۋMQ:t61MAtPwPA40CMQ<u͋Myuqu 1h{½~ƒttYhS j5x[mthX j=MAP0覄MA0h^ jjEPR訳1ۃtEu u؍e[^_-ok-exec%s: no terminating ";"U WVS] [hd jtAUUUu t| Ph j8;tEѐ]U+SM9MAS-MAS!MAU:1 9}vjQ;t@;{u/{}u)hM‹MAAC;uƀ;uAAF9}wQAU:ȍe[^_Uh[$ h[h, jUWVS} =SuG<9\[G<\[fG4ffw;j/wyÃtC_.Cfff C1ۍPwtwh^ j9t fCSUBt t#0f`[,f`[ UBt t*f`[Uf#B UfBf9`[%?[^_localmfsmsdosnfsrdonlyufs%s: unknown file typeUWVS]%h[h j ƒ  $  \ ޿O BfB޿U uBfB޿Y uuBfBt޿_ uQBfBP޿c u-B޿j uBfBShn je[^_UME P0tVh jGXh j ! Xe[^UMU At' t Ft+=B ttSyB<|[+X QQ9A%XB<|[+X QQ9A%0B<|[+X QQ9A%]-mtimeUVS]%h[h jjSh VF~ u ~uFe[^UEjU @Rpv%US]h jEX]UME P0tVh j[Xh j5Xe[^U h[@h, jUVSEu XtVSCЉƒtuЍe[^UjjUjjUVSEu XtVSCЉƒtu%e[^Uh jqUWVS}u _tVSCЃtut_tVSCЃtue[^_Uh jUVS]u ju jj>X p@e[^%6lu %4qd %s %3u %-*s %-*s %3d, %3d %8qd %sUVSuV %sUVSuhSVl uVh UƄ(Sh i[^HLPXdf:x.UWVS] gUh jCh|[C]11h[ h SuU跆 UX9w$| L L L L L L L L L d L L L p L L L | L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L 1111p[d[L h[@ aÅt h[t2h[$ h["<-tM$UJu M9}RuV04M V0ʃu6MQ0RuTECu9^`MQ < VuHMQUuuMIE1ۋu9EuM uV0RURUJM u9>M$UJu M9}RuV04M V0ʃu6MQ0Ru\ECu9aMyt uNuvUEEM9t uNIu6EЋMYKxu܋މ؋TTKyM U܋uVEE1ҋM9tM9FAujMQ0Gu9~*1M9yuu1ۋMQ ~t~RuuV0RVuF0U9T}R4V0MQ0RuDGu9~E1M9y~"]SuTRRJ GM9yuURz11U9}+uuЋMLʁ09tG9|݋uF,F(V,RF$jSURVu蹎u豎u詎 u螎u薎u莎u膎e[^_U(WVSDž=[[Džppvpy|zpD5҅th[pupp~h[j TWDžp] C$uUp9Llhdډ0UTp 򉍌L(u V wlR*lM R#] S$h|2 t | ulj GM Q$h| t@uu14[!Gv싅M Q$h| tu!u1[!Gvꋅu V$h| t u!u1[!Gv1u!uGw t19BD\Dž@d<8މ4(M Q wtnEPu .~tV8uBA:u9M}MPCPÃuă}tuVuZE tF>uEe[^_UWVSuU tu17:t/Ӑ0щHPRVƃ t;uԉe[^_UWVS]t} tjvǃu1gWz;tP]U :t7u 6U2ÃtSW8S8 t>u̓EU:ue[^_USUZJB 2]U|WVSE EE@@P1vEu1ۋM9Y|31ҡ_ _L_D _L CE9X}1ۋM9Yu1ju‹Eĉju‰T>ju‰T>juED> Mă9D>ET>}MEċECM9YkEEM9AfF EȐMI E< "R }@ $k\9uEXE 9uEuMq1ƒtEȋ1ۋMȋI9tExV;8uBC:uMI E@E}0҉HEMQ0ӉOEE9~}19]~*MM܉UؐE)؉)ڋM؊TM8TuC9]E9]}!})ߋE@UMAM9|E@ME0M1HÃE0M1sE^9ulEMȋ ?E9GE:t4Ӑ30J}I9vu;uЋEp u:ƒEE 9uЃEuԋMq6‰EȋP:tiMЋI9t^RnÃ~EpSÃe0҉HPS6‰Sr>3MԋI 9t$EpMqf‹EԉPMЋI 9u Eԋ@MqEp.‹MԉQQ :t#EЋX ;tSR‹MԉQ Eԋ@ }~ VXVMȋAQM M EȋEMȋQA@BMAjE06‰tEEME9H}0tHj pËM }0҉URp‰SuRWE@TCMYTu1ۋE9X|Ju1M1E0t>t>t> ECM9Y}Vpx[^_%s: %s: %s %s: %s US]E t"P$kPS5L`h0% h,|S5L`h<% h,|T`]Uu ujo{memory exhaustedUVS]SRoƃtu jh% e[^UVSEu tVPNpÃV oÃtu jh% e؍e[^US]=`uV`A~= \```@P聴X`u jh% X`h`l`d`]UWVS]=`u}`uq\`9v:\`9w``@Pƃujh% 5X` l`)ى\`)ډh`ABKu5X`\```)RP5d`6v…~X`\`Уl`=X`=\`=l`Ѝe[^_UU`9s8 u`@9r`%s%c%d%c%lu%cwriting outputUWVSu} ]=x`tP5P`h' 4 =|`t)VzP`5`h' =`=`t P+h``Ph' ١ h{)PjV7{@t5<h' =`e[^_US]=`uGh``;`9s:H`)Pj R+ t@j-P5` `]--UWVS}=p`u=`~ Wt=p``uh`1`9}9v N9v~ u@9|=`u =`t@= `t795`t/h) 5 )Pj V+j-XSVރ9rރ}tP19u v?E )Pj V* t@E =p`uj:PVE EC9u w‹M=p`u j:u W`` `e[^_UWVS} 1]EP)PSH`Љƒ tJ9u9}s t;9}t6=t`ujuRfF9sEPRSQu ]랐=t`t9sEPWS,ue[^_UWVSjjjusutgj h$`utrǃ tN19}.$`RkuR軪tCF9|jjjups 1e[^_UWVS]=@bt/SQt"15<5P`oS^````E11ۃS|h``=`t` l`)9)9v { tK9w=l`)9s;SRE=`t S%}t=p`t =`1ɉ9 `~1h`9v(5`9t-AJ9vz u9 `~9w9`t `)ӡl`+h`)`=|`Rzt/5l`h`)PE=`t 5l`QEe[^_usage: %s [-[AB] ] [-HRPS] [-CEFGLVabchilnqsvwx] [-e ] [-f file] [files ...] U5L`hr- h,|`j)sUWVS=UtDUU13u芚uD7D`D7H` ;u1e[^_0123456789A:B:CEFGHLPRSVX:abce:f:hiLlnqsvwxy?egrepyou may specify only one of -E, -F, or -Gposix-egrepfgrepgrep%s matcher already specified-rdefault/dev/stdin%s:%d fts_close(standard input)(standard input) UhU. jU L`t%j/P])tj/5L`I)@L`EEE`EEEDb@bEEEEhV. u uh zAЃI$ 0 H1 H1 H1 H1 H1 H1 H1 H1 H1 H1 1 1 1 1 1 1 1 x1 1 1 1 1 2 H2 2 1 1 1 4 1 1 1 2 1 3 3 1 1 2 1 2 1 1 1 1 1 1 1 1 (3 83 H3 1 d3 3 1 4 4 1 1 5 1 (5 1 1 85 1 H5 1 1 T5 d5 t5 4 `TЉ``TЉ`w5U識`5U虘`E,;``5Dbt . tjh. Db. 5Dbt . tjh. iDb. 5Dbt . tjh. -Db. kh`Uh. h,| L=Dbtjh. UDb%EEE EEEEEEE@b`p``0=UЍx]DPumE}t C]5UEEPW}E)5U. th. 5U腖|{u5<5UMMľ9ur 9usVuMEUUMă}tR BUHQ+EPjEEPMPǃMą~(}9uuuVuMcEMA t|{t Q螞]9]tU]| uJUEEPbp`Ep`E|`p`Et`TbyLbi}u7U9E~(U EU0}HE=Dbu L`Db5Dbuh. ubuuD`ЋE+U}t}u x`E}E}tE}tMe}teMU9EE̋] 0. u. E̋U9U|juȋUE Pǃ u}5<hU. @W AP`A4H wC$7 6 6 X7 o7 X7 6 P7 X7 X7 P7 X7 X7 6 q j5P`Cƃu5<5P`hV Eȃ=`t,=x`t5P`h/ 蚒uh/ 芒}tE}u}u5P`h. ZVeW5<h/ qU9E U 4. tj4;1}&}5<U] 4tUU P` P`/ VEȃ=`t,=x`t5P`h/ `uh/ P}tE}u}u5P`h. "t VdUU9EWP`/ j3Eȃ=`tPh/ ѐ}tE}u}u h#/ 訐=T`uEP^gUUM :t9uÐB:u1UVSu] M19} 2B9|e[^UWVSu``))܉SWP`U)P `PRS`U+`PWjU+```e[^_POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c U WVS]U=UU```E-u`@EA+u`E*h: z[t` ``t :{=`uv` `9t9 Utu Z U9t `U9U~+u UU9U~E :-uztޡU`U9Utgu 4u: uBBU`9`t9Utu  U`E`U=U9}u`9`t#Uu :-uJuF=`u UUy]EEE1t-uGGu `L5UE :-7z-t }'5`uEEE>tE8=t @E8uE;te`E)PR3茈 u:u:`0ЍD`}tuE0EPt p 21E@ }t*5UE 4~-t`Puup=UtLUu z-u5`6ha; h,|#"5`URE 0h; h,|`; U?``SuMHNj`M:uUt:u.=UtSu 6h; h,|U?:uz:u:uYUY:uEU9Uu4=UtSE 0h; h,|*U?u>:u:E UU`e[^_Ujjjuu uiUWVShH8Ãhh% jjS?C,C+C } j SC C s9uK(CS !‰S C)‹K)lj9~K C Cs0tjC0@C0@C0@ C0@C0@C0@C4C8ǃ<}D S> 1e[^_memory exhaustedU|WVS}O0M]] ]SDtMMU M]]MIM]]EtIM]8K t1\vDF MDF][]}uă}G+G } jWw G G OM9uO(GW !‰W G)‹_])É9~MO G G]]txMAG+G } j W G G _]9uO(GW !‰W G)‹OM)9~]_ G G]MYu C M]C@CMHC@ C@CYCXMA@]Y A N|uDЉ DЋMH|uH D@ NBDЀx tڅ0|uDЊP ˈX u"| DЊP H TЊB tF+C9C~C[uƋv sG0p t!F@9F~FF9F~Fv uDŽIyPG0pDt"1<A~1ɐ<A~鋟Dt1ɐ(D9C 8C 8C 8˅tC 8C 89]sIC9Eu49MuuSu8u NuJA9M}9M|l]7u uuC 8YC 8uEC9Eu99M|(uuSu8u NuJA9M}9M}+EME)9~1e[^_U,WVSUMMA49_u<uMbtG;t;ŠU =LbtU =Tbt׾U f0щKu uPUI ] U=Tbt<U f=LbtV <0щM\ jhaSR jhau uFe[^_^((^|[^0-9A-Za-z_])()([^0-9A-Za-z_]|$))$UWVS5DbT uhBV5Pbhh*V5Pbh hbu uƒ t jRha=Tbu =LbE 2P=ŠU =LbtfRW fTW B=Tbt׾UW f0щKu uPU:H ] U=Tbt<hW f=Lbtf{W f}W D<0щM\ jhaSRjhau u肿e[^_U$WVSUU Uu9 8bEPE)PVQƃmE)Pj Vf u M~ tN9urC%4bhaE)PSuVhbM`áa8)߃Mq9Mg1U 9MvA e[^_UVS]u Lڍ9s > tF9r)PR58by t jPb9sF9r58btjP:e[^UWVSuE 9OEEPE)PV58bƃ)}=Lbt)9us ~ 79E8 =Tb9]s;C=vP'zD5%ul{_tf9Evl=vP&zD5%u<_u0EPOWV58bË}RF9u"]] 7)Pj Rt @ 1؋M9us ~ tN9ure[^_U WVSu} u uEME=vP%zD5t+E=vP^Ãz4]E=vP% zD5t/E=vPX^z49t E9u}tFMG(>u?t +E E)1e[^_UWVS}u1<5Xb.1] ;t!3Wt|ׅu׉];ue[^_U}Xb%invalid hostname/var/log/wtmpUWVSu0Jv8VWt&jP2xR@x$ƃ_ jj h_ }ǃ |p|RW'$uVju]SZfju URLfjVUR@f$UR褸j$SW<$tUMRQWp WD=l[^_UE UPR,K` ua V%VD$?YnU$WVSE$XZӉƉ%=u % } ؉MuIuE t1u BtE@)ЉE )Љ ÉE%Á}t%}%EEEE MщM9 щM+]U%uպta}׉}܋MM9|u99w5}׉}E%=uuMAM+]9uvK+uU%u t}uEE EEE?u}tEÉ]uEe[^_U =Vut%j \bj `b j dbEPhht@5<F3 t*fUft!fEft҉-%T:$h j A-hj AT:hj -tj jPb- hj ,tj jPmbT: =T:1.`jdj=8u 8jj5$99 8OuD9$9D9\j0t8`jdjh\fh\bTP:1=9u =`9t=(9uM=l9uD= 9u;=8t =8u =8t =8t=X8u =D:tp\1҅u)=9u =`9t=(9u=l9ul\4]ambsdadbeohcinmimsncnsosulxbxnxtxsxxALbcbtcdceclcmcrcsdcDLdmdoedeik0k1k2k3k4k5k6k7k8k9hoicimipkdkekhklkrkskullmandnlpcrcscseSFsoSRtatetiucueupusvbvsvealdlsfsrALDLUPDOLERIsgugUWVSE^l X}ECEWs?‹;uۻl YECEh`jEP[?‹;uӀ=8t8|8Th m >~ |8h m >~ P8=|8uP8t|8l88e[^_Uh`ju>UWVS}G0 u1fw_jjWlWSVW^9=d:u7 {x{ {h{j L@=`:uGe[^_USM] E|| 9Av9Yw1!AQA$ YA$ ]USM] 9|tAt:u9|uA |tA@t:u؋]UWVSuFV$9Gv9֋G$t_]PrU<UBfF9GwG0@ud:@0@u =rG0ud:@0@d:x0}!hТ j58(d:`0 hТ w59(frfr =ru d:`0@@PWG'g0=D9uEt( {x{ {h{j 3=ru5d:QG1tN=ruE11ҋG9s _$]Ƌ]tBfF9rG}9~ Wm 1=rud:΋Wʋ@$G$@Bމ]G$t[SWHG$PG 9rGG$]H W G9sG$] Q A9s!fF9G^ d:9u wwrPrPEG1tbfr؉YfrډYf+Gfrf+W frf|9Gvf|9WvGWQGGA1LGG PGGPrPrPd:__X__ Xh{e[^_U(WVS} ~@uF$} Dt.jrPRrRPHfrfruF$} PF )x 9^w 1ۋuF$} P F )‰UuF9E|HE} u~}=rt E[ d:@$}ڋuV @PU}G$u BXEǃ}$=P9tQ=ruHuF$} vu@T9v: uzt}G$u +PEE=ru =P9}}te$9t+hТ jrPrPR% Pe$ 0hТ j58N$jrPrPjj 9]uFu}uju}uX9]_u}@rEEuEC9]*u} ΐ؋}G PurPrPfuf5rf ff=r*9]?}4uNN d:9H9]}? u>U }W@$@LH ȃ9Es 9 uytd:U uV@$+H+F E؉+U0=P9}H9r}9~w uFH9E uqd:x0}!hТ j58"d:`0 hТ j5P9_"}f ff=ru FuC9E}E=|8}؅t]uʃd:@09tAthТ jW!d:H0!hТ j58!d:`0 C}9_aGH9E 9=r,W0  d:x0}/t*=9u!hТ j58]!d:`0 uF0u=ru4}uF} {{}19{;< u%5u {{} 9{< t{{h{Py,}O d:9Pv GHPGuFHPRrP}fGfGfHfrufFfF fHfr}9_wGH9E r G0=ruXu}Gu {{} 9{< t{{h{P+EB} {{} 9{< t{{h{P]+=8tUutM {{}9{{{h{j+hТ j58O EE}u}r}O 9tpffrT:9|=9t fJfr=uF9r1F HPrRrPR/fF }fGfHfr9]e[^_Ud:x0}*=9u!hТ j58gd:`0 juuu uUPWVSuvЋ}G95d:)׉uF$u`G$ A9BuFzAuv uuuVF9r}WGH95d:)׉uF$u[G$ A9BuAzAuv uuuV9}+)}G}9$999}}uv}$+uKd:@$ A9Bu2RAuv u։u9|9tKC9F+9 }G}99}N9~+1ҋ}9Wv 1 DBu9Vw}}PP +@d:@$ 9+Ӌd:B$< B$9999}ڋu+VF$ ~99|-999wu+}Gv Et2uvuPRw' wjHPj؋u+FPVj}GHPj+GPWt9uSd:@$ 9XtB,}9tSu9]u퍥[^_UWVSd:HMxu+u =p\@H9Eu}tuWuujjuWu 8t%~ hТ VjVPQ P [19}R8t=<thТ jP ' {x{ {h{j t#C9|jWuju}jjuWu$ X8t3=D:t ؃~!hТ PjPR Pa "}hТ j5D:B xjWuju d:@H9Eu }uWPjx=9u =8uued:@H9EuW}uQjjuWuA hТ VjV58 PjWujd:@HP=(9tc}t]jjuWu=l9tt^hТ VjV5(9` P+jjE)@Pju =l9tO}tSjjuWuu19}hТ j5l9 C9|jjE)@Pju}jjd:@HPWu19}R8t=<thТ jPi ' {x{ {h{j C9|d:PJ9UujWujujjE)@PjR[ 9t+=`9tt&hТ VjVP P 4=`9t#19}%hТ j5`9 C9| jWujE)@P=9=X8u =D:@H9E}jjjWu=X8t=D:t*u%}ChТ j5D: x$hТ PjP5X8 P jWujjH=(9t[jjM\SWu*=l9ttVhТ PjP5(9 PpjjujS h=l9tWjjMDPWu}hТ j5l9" xjjujMDP W9t2=`9tt-hТ PjPR P 7=`9t#}%hТ j5`9 xjWujue[^_U WVS} UE}u -)щMu=T:)jPRWuEu1kM] fA A19u~J]C$EMQ19} B@9|?P]sCF9uEe[^_UWVS] UuN9MrUv u9urJE؋u~9w9EЋMN9w*u+]u+UjuuRSÃu13usS(19Cv@9CwSu ؍e[^_UWVSM fy Uf+z fy Q(U19qvnӃA$}<AU+Bz$EA UBCS}{QUPsMFEM9qwe[^_UWVSj4Hƃu1MP(F$tYMIP F(u Vv$4}E EPF,uv$v(V{1~(19]~HWEF$ {{} 9{ t{؈{6h{Si&8th jP j %r= s|s9r*=st}=r}=s se[^_UWVS] =T:9}|E)M1ɋE؉EE֋E)ȍe[^_curses: __tscroll failedUWVS]EEU Us%HCK$ X @ G , ` x Ԡ L Ƞ u`} ~+}c~Ed 0FME 0FE р0FUU}tqElC9E~_EWECE EE=F8E ȉEE}$U)‰)ECCs0 e[^_Ujuuu uzUWVS}w19}jGHPjSWTC9|e[^_UWVS}w19}jGHPjSWC9|e[^_UWVSu} M]}t F$F ËF$uF$@F$@ @9vF$@ 9se[^_UE {{} 9{< t{{Ðh{P UWVS]}1 v.tCwmƒ1҅u΍ƀ;.uXCwmƒ1҅t t0Аwmƒ1҅tCې;*uCu PC׃;utKf-f~?fw9҉UU]Ɖљƅ~8P׃N1e[^_OOPSOVERFLOWU WVSEEETsEuu P sN%t}s]MSAMMw$Ԥ ئ M & Ч  u `u` ~Qc~'}sdÀ0E@Eց}s À0E@E}s 0E@E+MMu}=u 5EE9~M EEEt t up}u =T8ta}t<9u^ T8s0҉эT U Shs`"F t}sEMAMEE EFQ}s]E@E3 }VU)ЉE)ƋMAM0sHs+U9shsuTsU e[^_TERMCAPTERMPATHHOME.termcap /usr/share/misc/termcap:UWVSDžP}=s8h@ -Ht 8/hH t hP}hQ ÃtB0ډЋ8D8SP8/G8+8PhV hH8B 88?tu8< t<:uQ8G8?tM8< t<:u88?uߋ8?t>9_88?uHt'Ht 6. & `[^_UMU E BBUS]M EUAAQQ]US] UJ9t IJ9uuSu]US] UJ9t IJ9uuuSuw]UVSM uA09Esy\u1ۊ(u uu|uf|t؍e[^UVSuM]\È]A19E v1 t })t/}t t:)tf}9|t}tt :|ue[^US]UJx!M9\u  Jy1]U WVSU]9E t,HM8}@WQW~1 1ېSu+uS}tËMuƃ}tË}8EE}tËMӉЅ}B%)‰пMCP1e[^_U WVS][]}7_]EEeEEhju G $G 9u;}A9uu)}GU €$ЈGEUZ]EtF$ $ 0 t p p  d d d d d D d h }OF]P F=ȅ}A0)ljs]Iy }9A~ Fȅ}A0)Ér}9Iy1ɐsu]A~1ɐst}9A~^EHIy]C @u }G 0]C#MFt1 <t<FFt1UE9tJUF9MvZU9Uu79 _r>)ĉPuSM ]MteUE E}O}tNEEFƒu-EVEu9u}]CU €$ЈC1e[^_UWVSMU ]u}tA$ ArzaBBe[^_UEPuuuPu jjuUWVSu] MyIMMMM39} 9E}])Myt8 u~ ^t)MAu QBu929uMA~nE]9u E+E39E E))MU }t9]}$MB<8uKK9]} B<8tE)C}t9u +EMM }t%M%8tE|9uu t MAtFu(u$Vuuuu u[ t~ KFCNe[^_UEPuuPu jjuUWVSM$]]Ћ}_]̋_]ȋG}EEEEEEEEEEEEEeEE]{)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe}%}}}}}}}}KEE9E<E}9}sHU]}}}} $C]}9r}u } t] ]}}E E] ]]}}}9M|M M]]}}E+EE܃}~]9]} }}؋]]EE+EE؋}܉}Ԑ]9]4}9}}0҃}t]9] w E E9v}9}0Ѓ}tt ]9]w}9}E]؉]E}9}]}}}}C]}9rm}tX]]؋}܉}ԋ} 9r }9w]]E}9}s)]}}}}C]}9rڃ} ]C$ufE@v }  ] } ?Pu] C;P`C{_W]C$ CG<uCE@} 9s8PwSGPw>G } ?t(G]W}9}u ]+]  E+EEEu uM}|Uċ] 9v9U|t9u] SC}]] S}t9E w 9w+E |+EE]} W}t9E w 9w+E +EE]|EL}ĉ}] 9;v%} WG]C]9wދU+U}9}t E+E)+U UE]C]Ѓ$ T $ P $ x $ 8 4 p , t }?}EЃ}tJ]9]u}9},]]؉}9t}]ЊC]G}؋}8:MuA]9]u}9}]]؉}9t}؊]ЊC]G}8MuU}9]B9Uso}9}u]9]|}}؉]9t]C @u*}t}]Ȁ< M}؀? <]{ }'}t}]Ȁ<u}؀? U]9}B9Us]Ѐ{È]}9}u]9]}}؉]9t}t]}Ȋ 8]؊ ы}9s%Tȃsu]DEЀ}SU}95]B9Us}Љ}]$<u"Su̍EPJ$Ȉ }]t}E؃t ]}]]؋}}] $?}}}] }t]E؃t }]}}؋]<]}$]9]t,}Њt#‹]ut‹}tuEE҉U]}t {EЃ9E0ɉEEE]ЊC<w <s< t +<u$U:Blj}Z]tUEEE}8xz@}8lЋ]t@$G9s.}]}9|]A}W9rӋUZ]zBlj}Uu+UE+EHX]čD[ _9j)ĉPuStܲ ]t4eu+UDI9ru}9w?MU]EMU}EMU]EF9usċUE}A8EsE%TEsu]CE}ЀtG EX]Ux}LX]t9rZ}<|UZ]ED}UZ]ED|UZ]ED|I9s}?]Clj}|}u+EU+UJTI9sb]čD[ _9>)ĉPuSt谫 ]teu+UDI9ru}9w?MU]EMU}EMU]EF9usċUE}MU}EMU]EMU}EF9usċUE]EUE}}2}GG][}GÉ]tK]]_EG>E}?]Clj}U;Clj}]Њ]UEB}t} 9} ]9]x}n}9}bUJ9Uu ]EH9u }G ]Cs8Ћ}9}u]EH9Eu }G]s8%9}t} 9} ]9]}}9}UJ9Uu ]EH9u }G ]Cs8Ћ}9}u]EH9Eu }G]s8%9R)}9}u]EH9Eu }G]s8}t} 9} ]9]}UJ9Uu }EH9u ]C }Gs8}t] 9]u}9}}~UJ9Uu ]EH9u }G ]Cs8C}9}u]EH9Eu }G]s8}9}]9]u}9}]]؉}9t}9}u]EH9Eu }G]s8U}9]B9Usn}9}u]9]tl}}؉]9t]9]u}EH9Eu ]C}s8t,U]9w}B9UsE EX]MTtU؍x}\]Ѝx}\]x}DEM9rKUZ]ED}UZ]ED}UZ]ED}I9Mv}^]9]s[0ҋ}Њ<w <s < t F<uA]C]}]Clj}DEt8 8} 9}]9]}}hh[^_UWVS} uME9U<<JMZBU| uJVUDPR UډU:u#JMZBÍBE| tUEXPVRPD t0]"MVWEP t 9})1e[^_UWVSE] uE9sBM9tVSEP9 u 1&y}AQЍDE9]re[^_UWVS}uEE$X x      ` x x x x         (  p   x x x x EEWu EPËu $<uڀ$Јut1}U BUxʉURUZ]JBruuU Bˉ]Eu 떐E뎐Eue[^_UWVSM}u] t:CF88tIu1e[^_UEPʀPP5^u u^No previous regular expressionUWS]u=tu }1y=tu?hٔtt th蹔tu w 3 tht5^0HPSJ^e[_UWU0HjPjPRht'}UE%s: UVSU u]؅t,Rh h,|,5SVh,|8h,|j PVhEPm]e[^: %s : %sUWVSU }]؅t;Rh h,|4SWh,|?85<؎PhZ h,|4GuPWhV\0K5<蕎Ph` )PSe[^_can't allocate %u bytes: %sUWVS}u jV3Ãu5<0PVh 7W؍e[^_exec file name too longbad flags arg/dev/mem/dev/drum%s%s: not physical memory device/dev/kmemU`WVS]ǃǃ ǃǃǃ4ǃǃǃ ǃ(} t 0} H=vhe &E Eth} 3S R}uE }uE juu‰  } uEPR螀} ufEf%f= u tuh 3Suh } h kjuu[ }uIu S7}Yjju , }@jju  }u h 3SS| }tCPu&S1e[^_UVSuh8Ãt)h8jS(Vuuu uS5<5PV1e[^%s: %s UVSuh8趏Ãu%t5<PVhW h,|01$h8jS蛚3juuu uS e[^US] | P| P| Pߗ| P̗t P@Ѓ4t St P萏(t P}St1]/var/db/%skvm_%s.dbVERSION_versionUWVS] j/SRtXShw h hSjjjjS%M(Dž DžMjSSP@ Ѓ=PWRDž DžMjSSP@ ЃuLtB u9j EPRmVSuuz9uPSW[ u1!MP@ЋMǁ[^_symbol too largeUWVSMu/u 5h M1Q1] ;t~:tu0H=UEMjEPPRB Ѓu2Ut+} u%FjCPBPQjCPEP? ;u+U Љ)e[^_invalid address (%x)kvm_readshort readUWVSuM<jM 1ۉM]uu]eu%u =<tu h jSO1'VuMޓE }h0 ju̐9ush9 ]3SEh juQh0 M1Q<}URu uIE T9vu<jU1ۉM]uu] _uu =<]uWM E Qt E )f+Ee[^_kvm_writeshort writekvm_write not implemented for dead kernelsU WVSu}<jM 1ۉM]uu脓u u=<tu h jVnMWu襑E }h jV%9}s h 6V2Eh 6V1e[^_US]4tt P׉4ɉ]cannot allocate vm_IdlePTDbad namelistcannot read IdlePTDcannot read PTDUWVS]jSǃu h 4E3 EEPSht h< WjEPEPScthI 1hS)hVuS8=u71h] 3Se[^_vatop called in live kernel!_kvm_vatop: lseek_kvm_vatop: readinvalid address (%x)UWVS]|h6 jSR4u u uu }7U  U j1QR אuu hS DjUR g u#Ut+ U}+E%he 3S u hv jSt1e[^_Uuu uUS]tICjCP'CC$j0C(P'CX0CYCZC[C\1]USj`ÃtS؋]Unknown letter in format: %c UxWVS}E}EE1EMMEE{\$                                                                                                                    L         EvE8t€8 t @EzuER@EIE91ۋEHMxt$UE<}tOwBCEHMxuߋEt@ED+UBUj EPRQà } MGEUM)p_!…u;}t&ujRb}ttEPuMуEMAEE1)]UEUJMj EPBR诺à tu t)6u>}t&ujPb}ttEPuMуEMAEE1GuS}t2ujW Pb}ttEPuMуEMAO ʉEE1Qud}t:ujW W Pb}ttEPuMу#EMIG G ‰EE1ut}tBujG G G Rb}ttEPuMу+EMIG G G ‰EE1PEUJMj EPBR諸à u^}t$uSWb}ttEPuMу3EMqSVW { }zuD39r8 uH9sEE1EEHMx+uEE EE=vP萧z4vu}u EMY1Ej EPu讷à }t%}EPh- h,|P E 1ɅlE|[^_UUEPu jjr rUEju uup pUEPujju uUjuuuu uInvalid starting character: %c Invalid startfield %c (%02x) U WVSMEEEEEE} iE}tM1ۍurEu ЁvRlzD5t ER}}E#u €8 t @EzuE#b{ug1ҋMAM}t+E<}t!}t 9U~M BEx}xuփ}t 9U~M E8}@E*u}G}E=wm1t"EjVuE [EvR脤z4vuEEM MEvR8z4iu'E}?}EM iEEvRz4tuE}?}E,EvR蠣z4suo} sEHM@=v Pe z4vuEE}?}iEjVu膳E LEPh h,|2EE8:@EEE=wm1u&U}t E/}tuuUMуEUE M AE}su ]yE,ƹ)EƒW9] v;C01Et 9] v;C01Et# tnt# t.`9]  IE H90E 9E 9E;CE;CE;CE;Ch7 h,|U~Ut 9] v;C}tM}uEe[^_UWVS]u }tZSut VwCu7{s UEPujjEPjCPt EC1e[^_UWVS]u }tZSut VkwCu7{s Ujuu uEPjCPct EC1e[^_UUtEPu jjjr r&1Ujuuuju uUEju uujp pwUEut ht Pիtu t,|tUnknown return statusSense ReturnedBusyCommand TimeoutNo errorUnknown codeUMU ztB9 uÃ8u %s (%d of %d): %02x # (truncated)... %sUWVS]EEPuu h6 Stt9E~ EE19u2UPhF Sy CPSHy9C   Sj Ԏ}F$)‰Ѓt EH9}hK SVU9t}=vPczD6t.CPSHy 9C t Ȉ SQ%GE9u~CPSHyCPSHx  Sj F9u_ }tO Pha S?e[^_UMA A A MiscompareVolume overflowEqualAborted CommandCopy abortedVendor specificBlank checkData protectUnit attentionIllegal requestHardware errorMedium errorNot ReadyRecovered errorNo sensedeferred errorscurrent errorsError code is "%s" Segment number is %02x Incorrect Length Indicator is set. Sense key is "%s" not valid but containsThe Information field is%s %08lx (%ld). The Command Specific Information field is %08lx (%ld). Additional sense code: %02x Additional sense code qualifier: %02x %s parameter listcommand descriptor blockIllegal value in the %s. Bit %d of byte %d (value %02x) is illegal. Byte %d (value %02x) is illegal. Sense Key Specific (valid but not illegal request): %02x %02x %02x UWVS}] K(MS($h0`ЃPPh%" WC)Ph9" W C* thQ" Wh_C*PuPhu" WC+PtPP" t" Ph" W,C0PLPPh" WsC4Ph# Wc C5Ph# WPC4S5 Ѓ _tRPPhF# W#S7C*$<ЉƃY# tJ# Phr# WC8S9 ЉE t CMMTMAÀtPuPh# 5Puh# W'h# WyC9PC8PC7Ph$ W]e[^_No sense sent. No sense dump for error code %02x. senseUWVSu] {(C({Yu h% V?qp|SVPh & V jCYPCXPWh/& Ve[^_return status %d (%s) after %ld msUVSu] C[t8h|_%PPC[Ph& VQ{[ush& V:e[^SCIOCCOMMAND ioctl: Command accepted., return value %d?: %s host adapter status %d Data inData outNo data transfer?Zero length command???? Command outUWVSu}u1"h' Vm} uh0' VY?} tu hD' V@ <tPZhPhW' V"<Vj } fZu =tWVaGZt%Ph\' V  t u' ' t}' uh' V jGPPGPh' Vjw$w wSV0WVKVUE e[^_SU_DEBUG_OUTPUTSU_DEBUG_LEVEL%dSU_DEBUG_TRUNCATEUSu uaÃtih) ntPh) tn thth ) P> h#) Pnthth ) P> t؋]UVS] u'ShQ`usƃ ttSVPe[^US-=-tЃ;u]US-u1=-t@<-uÅt-Kuh* 3]U=tutU$WVS]u EE}]uC9vEu}u1uE1uӉƋEu9v1׀U܅u9wU9Ur߿` +u܋M}E NjMe؉EM]E ËMe؋UӉNjEU܉9wu9usO1}uEUe[^_UTWVSEEEE EUUUU}}(EUډU܋]ۅtK]M܉MMM}}!UډUԋ]ۅtK]؋EԉEE؉E]UUЋEE̋UU}u@9v E̋U"u 1ËE1UEŰu1U9Uv ű}UЀUȅu*M9Mw9]rUE)UЉẺUű} +MȉMċEЋME؋MU ‰UЋMEMEEMEE̋MU ‰UMe̋EUuЉUEUEM9w uU9vME)MЉEMMU+UMỦMEMM ֋}u}}t%UM؉EۅtK]EEEEEUe[^_UHWVSEEEE EUUUU}}(EUډUuޅtNuMMMM}}$UUډU]ۅtK]EEEEu}UU]u=9vEu 1Ɖ1ӉEE9v1}׀Uąu9w9ur` +UċM} NjM؉E؋M]E ËMe؋UӉ։E9w uM9vOE}ЋEEԋuЋ}ԃ}tډUȉۅtK]̋uȋ}̉e[^_UEt`authunix_create: out of memory UWVSuj(bbǃ%hKbÃG ``_$<C <C<CC G CGCGCj8P8EMMM MMMt`t 9~ЉEuMMjhX4Q@VEPVUqudDV@ЉƉsVcaCt)VP4H\CGCGWh2 h,|I1([^_UVShPuCdEÍPj8"}d~19}B9|퍅PQSVPx[^UUEU @$JPRA UWVS} UZ$juuuVCtP`C{ WVtC UCBCB,EWVCUCBCBu]e[^_U E@E%ىځvSMsHƒMzD5ƒtC>t ʁvQ/HzD5ƒ? F뿐F8/ 16 E@Eуy $X< @> bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG @> bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG bG B pD P> |> bG bG bG @ @ bG bG bG |? bG bG bG bG > |? > bG bG bG > F bG bG bG bG bG bG bG B pD p> xC xC bG bG pD bG ? @ @ E bG bG A bG > bG bG bG bG bG > F F<% uY =8t9zuhE; nuhK; buhT; VuhZ; Juhf; >uY =8t9uY =8t9Vƃ g3wmƒ1҅ 1ۀ>t8wmƒ1҅tۍTF>uˁmEXډځvSMDƒMzD5ƒwmƒ1҅E1ۀ>t8wmƒ1҅tۍTF>u˃;Mu EXEʉʁvQCzD5ƒE8EʁvQCzD5ƒEwmƒ1҅=1ۀ>t8wmƒ1҅tۍTF>uˀHtku ~ EXʉʁvQB zD5ƒE8EʁvQwBzD5ƒE뷋8Y t90щOWY t9VO u%EP /E@ 8Y t90щOWY t9VhO EP  EP1ې8Y t9||0щOWY t9t|VN tQ8Y t9|`0щOWY t9t`VN t ChEXwmƒ1҅1ۀ>t8wmƒ1҅tۍTF>u˃MEX lҁvR)@ zD5ƒ;E8;EʁvQ?zD5ƒE1ې8Y t9|00щOWY t9t0VHM tO8Y t9<0щOWY t94VM t C j  EXQwmƒ1҅1ۀ>t8wmƒ1҅tۍTF>uˍS EPҁvR~>zD5ƒE8EʁvQ;>zD5ƒKE뷊<ډځvSM=ƒMzD5ƒwmƒ1҅1ۀ>t8wmƒ1҅tۍTF>uˀYuÔSEXtvҁvR3=zD5ƒtGE8tKEʁvQ<zD5ƒu EE8u‹E8e[^_$Id: strftime.c,v 1.11.2.6 1997/10/11 14:25:14 helbig Exp $@(#)strftime.c 7.38@(#)strftime.c 5.4 (Berkeley) 3/14/89%cUWVS] }uY]SuVuG Pc9t +E1e[^_?%02d%m/%d/%y%2d%03d %H:%M%I:%M:%S %p%H:%M:%S %d%04d%e-%b-%YUWVSMu>\}?%4Euy"$H J P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P P J $K K K H P PN (L DL P P P L P H P P dM M M M PN O O XP tP P P P P P P J XK K K L P PN XK P pL L L L M P M P xM M M N tO O P 0P M(uQ} WwY =8t9D|BH PuQu VwY =8t9D`BH PuQ} W wY =8t9D0BH PRuQu V wY =8t9BH PuQhDH } GldP^*uQu Y =8t9uQu hIH uQhDH } w uQhRH u v uQhDH } wuQhDH u F u RnuQhVH u F@PRuQhRH } wl8uQhRH u F u R> uQhDH u v$uQhDH } G@PuQh[H uQu ~ ~Y =8t9Y =8t9PFuQu h]H cuQu hcH OuQhDH } 7m9uQu uQu hoH uQhxH uQhDH u F~)ljP uQhzH } GuPCE+EP} _lwu}u'ؾduؿu En EmEu)ƉUEE)Ѓ}E9EWu9uWKu)ؿduؾu EnYEmL}/u~uCts0щЋD@=v <?LuhT V=sV.s} =<%5G(=<G=<1[^_UWVSU=auaa95a~a=a}}DÉэ J ʍ J JS))ȅ}F95a=aa‰aa1Fa9|e[^_random: not enough state (%d bytes); ignored. UWVS]ar au Ba)ȉBShW h,| 1#aaa?#aaaeaa= aaaaa?aU a=a‰au aua@aa)ȉBe[^_random: state info corrupted; not changed. U WVSuщNjaUUa]uUBa+EE]C$| a`aaahfY h,|)N a=ataa=aaa aEe[^_UWVS=auU5aÉэ J ʍ J JS))ȅ%\aaaaa9araaaa9ar aaЍe[^_UiamNA90a%UEaUVSu5Ãt0j=SVtj@PSS:: S.:e[^%s: illegal option -- %c %s: option requires an argument -- %c UWVSu} ]=-u a8uR-a9})a8-uxt+H ax-uBaa[ a-a:tPSluF--u a8ua=a;:t~R5h[ fx:tLa8uvna8uUaa9Ca[ ;:u:J=at5-5h[ h,|?La[ a-e[^_UWVSU} ut28SuUMуUu~<Nu1e[^_US]<ut<t6z~.hCƒu "B<<B\B1]UXEfEfEEEEEuu EP0‹EUXUE ~4fEfEUUHEEuuEP‹Eø/var/tmp/%stmp.%lu.XXXXXXUS]ulu5huh_ h_ hSihuSњ]UU u1uPRu"PUjjjuP UWSU0ЉUX]E_ EE]]EEPh{, tЍe[_UWVSE} uE߉]]MMEEPut +E1Ɖe[^_UUBHJHy RpÐUTWVSẺEȋ} G}ċE@$E}GtEEtE }EE GE#} }0ҋ]߈ҍTUE9Es E}WUuuRVu, uuuWu (9EtWϐ]C]MIMQSWVu tuSWVu)UuuRVu uuuWu (9EtWϐ]C]MIMuuWVuUq Ut 9t ِuuPUuuRVu8 uuuWu$ (9EtWϐ]C]MR]TU쐐uuWVu 9tAEMAM]RUM]щMuIM멐uuWVu}MIM]+S щM]]M ML?][]܉M+Q щMԉ]؋]܋MԉLM؉L ]]M9ce[^_shut up gccU WVSE UEEUNu}9}xuH}ځ0w8wtb%  (tp w` u9u}EG}8u9uEEځ@Ћ}9}xuEFu@XXu}9wu G>u}9w4}? (@uV9Uu F9U}? @}u9~uFtp}u9~vu> u@uWu}9w}сvRzD5҅gu>_[u}9wLсvRqzD5҅}?_uV9UuFt\9U} u@uCʁvQzD5҅u>_u}9w}сvRzD5҅uFu>_t>>E}ځUuځuEE}|}u}9}EKMuR}ځXw1HEw8tOPLp|wh xuN|u | -}O4utuD+EU)9UUu}w u֋}uJځ@}9tEu9uuuUBRuURuuUBRuuuځE}T:uVu}tUBRuUBRuV_}W}u9UuuRVu uuuWux (9EtWϐ]C]MIMQSWVuN tuSWVu)UuuRVu uuuWu (9EtWϐ]C]MIMuuWVuU Ut 9t ِuuPUuuRVu uuuWu (9EtWϐ]C]MR]TU쐐uuWVu@ 9tAEMAM]RUM]щMuIM멐uuWVu}MIM]+S щM]]M ML?][]܉M+Q щMԉ]؋]܋MԉLM؉L ]]M9ce[^_U WVSE UEEUNu}9}xuH}ځ0w8wtb%  (tp w` u9u}EG}8u9uEEځ@Ћ}9}xuEFu@XXu}9wu G>u}9w4}? (@uV9Uu F9U}? @}u9~uFtp}u9~vu> u@uWu}9w}сvRmzD5҅gu>_[u}9wLсvRzD5҅}?_uV9UuFt\9U} u@uCʁvQzD5҅u>_u}9w}сvRNzD5҅uFu>_t>>E}ځUuځuEE}|}u}9}EKMuR}ځXw1HEw8tOPLp|wh xuN|u | -}O4utuD+EU)9UUu}w u֋}uJځ@}9tEu9uuuUBRuURuuUBRuuuځE}T:uVu}tUBRuUBRuV_}W}u9?t9{`B9UB=wm10}t j V>+tz *t?{WF)@PhHVF)PhPV|WF)@PhXV,F)Ph`VU QWF)@PhHVyF)PhPV($WF)@PhxVMF)PhVF)PWV(jhVjFHPVjhV$VE9FvQ8,uLH@=wm1tVÃ9]~j V ]SuWV9Fv 8}u@:V9s8}t H@9rF9r j Vzj Vo~9sE<v3?t.{u1B9s*B=wm1tj Ve[^_US]C9r jSPSC9r]UWVS]KM19CvX8^uL@jhS7CH(C@, *B9Cv9E u B9EtVSJ1C9rЅt Kjh SCH(C@0 M9KujS0e[^_UWVSuNM8\u!F9r jVǁ)]/.tf*[t({tt91{}dF@tV Yjh(V CVZ2j V( F@DFXD FD ShhVNM 9sB9s :\uz)t j)j\V FDHShpVF^ 9sB9s:\uz)u jVjVxsXЃ|Ht-Sh8VtHD @PV}Sh@V$ jV0F@H!} u j VPV#^9s M*u]BuF+E@PhHVF+EPhPVNuF+E@PhXVx,F+EPh`V#B9}\z{VNj9VvZ:,uUJB9Fv@B=wm1tVÃ9~j V  SWuV ^9sB9s:\uz}u VF9s,ÐB9s :\uz}t H@9rF9r j Vj V $u1e[^_UWVSM11Q9sD=wm1t ۍDЋF9r~~j Q؍e[^_[:<:]][:>:]]UWVSu1MB9Avjh RV  u jh*MB9Av/jh R*  ujhuMM9A8^u@FM9A]u@OH]fG]@-u9@MOH-fG-$9sB9s :-uz]tWuMY9s6:]u͋M9Av'8-u@OH-fG-M9Av<]t ju MyAA@txXKx`ӋO tMvS  zD5t(Sp E9tEO fEfGKy t WutwMApNx>ًM Gt ˆ ff)G‹M ffGNyËMA@tG B fG t WueWuuWuTPu Wu WuKPh0ue[^_UWVS]u 9Cv1-t[u;G09CvW j 0Ҁ:t =tt9Cw jS -t]u jS VSC9r jS s9sB9s ::uz]tljw9Cw jSd -t]u jSK VSC9r jS/ s9sB9s:=uz]u jS SE{9s;:-u6B9s/z]t)9Cvz-u E-SEMMM8MuEN fEfFhEPEP~ j S^ SEP%EPSËN ffFC~Íe[^_U WVSu M ME}9Ov;=vP zD5tMx9@9AwƋM+Ub=bt-Ru3U6 Uu<t;u؃;ujue C $4 d  d T P É=vPzD5%tËN ffFC~sÉ=vPV zD5tËN ffFC~#É=vP zD6tËN ffFC~É=vP zD5tËN ffFC~}=wm1tËN ffFC~3É=vP zD5tËN ffFC~É=vP zD5tËN ffFC~É=vPnzD6tËN ffFC~8É=vP zD5tËN ffFC~É=vPzD5tËN ffFC~É=vPrzD5tËN ffFC~?=wm1tËN ffFC~ɍe[^_UVS] j=uщUSuffCe[^US]C9rjSC9sB9Cv:[uz.u ?j.S<EK9sB9s:.u z]ujSE]UWVS}] MG9s.ƐB9s 9uz]t H@9rދ9Gwj@+u(c=(ct#Vu3 u<t;uރtjW1CMe[^_US]vSfzD5t#v S- [z4JvS zD5t'v Sz4Ë]UWVS]3{E UUSEE]ES3{e[^_UWVSu] Fx8@tDÉ=vPf zD5tS9t SVg"PhV<;u FP4;@4e[^_UWVS]3{EECE^E E]ESF3{e[^_UWVS]u {{}~}u M}~}u E$س ( 4 4 4 p p p p p x  p p p p p p @ T ))CDVC)@PhxS ujFPS C)PhSC)PVS]jhS$jCHPS@jhVC)@PhxSC)PhSLC)PVS(jhS/jCHPSjhS$GPFPS‹EHPjOVC)@PhHS%C)PhPS:WVSl‹EHPWVSXuEHPRS jSe[^_UEU xuPly@ly1UWVS}Gp u@ G@EG9PWEEGHuP1‹GPPQL‹GPG@uu‹GPMuP‹GP1҃9U~01ېOquЅ}BEAuB9UՋGxtPtujE+EPEj WOEYËE}UQM)CfCCC ؍e[^_UWVSu }GP PU@E19sˋF ff)FC9]wE9u }GH e[^_U$WVSM fIfM}GP HMʉU@Eu9~}ܐf}Mf9yuc9u t^19]vRMM܊ M} ?}M IMӊM} :%EM} :%9EuC9]w9]t E9uw9uvu uu MA} +xe[^_UVSEU @H19s2ZЄ2t@9r1e[^UWVSE} @@E119s7_]Š]0tAB9Uwȍe[^_UWVS] s0}CS uPC PR=C C u j uJuDPSC De[^_UUUVS]S B}Bu 1S9}<t  @S9|1e[^UWVS}W B}Bu uuu1ɋW9}uu8t1AW9|e[^_UWVSEM I8Mxuxʃ€:u_Wu UUtIM I4MM A4M _-uހ>uSWu U& UtMFC~BG~e[^_UWVSu~]+] t8FPV!V MNЋM uRP^e[^_US]{u.C9C|@@PSSC M M C]UWVSu}~ui^uu VF  T 9|BT TH9|BTH@ ~F)PN RDPF e[^_UEM xuP % EUVS]u 9s}*Ps Du j SY C se[^UVS]u CFSPs Fuj SC Fe[^UWVSE} x1ۋW %=XtAw=t,=Htqb=ptew =ht\M=xtBurCB% %=`t=t=uD=u9_@}u_@1ۉ%=ZG@tK@PG}t*jSV+ u#jSj } uu|V&}t E00V'uWVt[^_UWVS}juVqEEEjjj+Ã|,fEVS>tfE% Se[^_UWVS}uuUu516X;t)jEP3VWu utӃ;u׸e[^_r/etc/hosts.equiv/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts owner.rhosts writeable by other than ownerUlWVSDž} uh h 1t/uuuV[uV 1;V =0fu }  Džu:rWh WUËr+h W8S 1ۍURWL} `fEf%f=t JFPԼ} )Et9Bt  Et# -Vq [^_UWVS1Džx|Pt Dž|jjE P* h0P`ƅ tuht tj tu4MAPQHy Q M tu떐< t<#t_te=vP4 zD5t'=v Pz4C< t< t< u< t< u+C< t< tފ< t< t< t;t Cꐐ<+t <-tYuDžx<@u(|jPPQNxiPM@u'|jPPNt0Pu tu x<+t <-tGFu <@u |ujFPMǃFnxF<@u |ujFP\MtJcFPuu2KxkE>tPuǃx>61h[^_US] =wm1tSlt9E%AS*u -'X;tj3UR{: t܃;u1]No address associated with nameUnknown server errorHost name lookup failureUnknown hostResolver Error 0 (no error): U WS}]t+?t&}0HEEG E]5<plj;0HCJ CU)@PRjJe[_Resolver internal errorUnknown resolver errorUE} Ð9Tf Ð@fUWVS}=xiU |i5t<赟ƅtM6W-t&^;tސ3Wt ;uÐ} tu v u=t<u肟xi|ie[^_$Id: setlocale.c,v 1.8.2.7 1997/09/14 13:09:02 jkh Exp $LC_TIMELC_NUMERICLC_MONETARYLC_CTYPELC_COLLATELC_ALLLANGCU WVS} }u}ExfyfVSU z~?M4`f}tt8u5`ft8u hc t8uh jP]xyP{ƃy }~y 4`fU}Ut8uxyjPVU)ƃy UB~}t&jW]xyPƃy j/W|Ãu3y jWSƆy z~{/uC{/t{xyE)VWuUOM MUB߃ ?/u G?/t;/tC;u?u(XyxyVSURU~}t u|XzfSVUURe Uu;9}+yXzVWUS8 CU9|1 B~ e[^_/UVShfhzfShf!hfhzghU hzhfhzhU hz hfhzhU hzhfhzhU hz hghz FKze[^PATH_LOCALE/usr/share/localeUWVSExyxfE=0.u\h= XÃt?u60Ѓ+=S>0.u0.I uVu E}u&Vx1ۅuu]}u"V@1ۅ|uau)`}u"V 1ۅ|u9u8Ew1V;1ۅuu u$ Vu_1e[^_POSIXU`WVS}t7uh tu u1^0.uLPShU SuS1PS?uff%f=@t[^_UUvR謯%ÐzD5%UUvRtázD5UE%UUvR4ázD6UUvR ázD5UE=wm1UUvR輮 ázD5UUvR茮 ázD5UUvR\ázD6UUvR, ázD5UUvRázD5UUvR̭ázD5UE=wmÐ1UEUUv R`Ðz4UUv R8Ðz4$Id: setjmp.S,v 1.5 1996/05/05 07:56:06 peter Exp $j DZL$$Yai qyAy1ÐT$rCXT$D$ Zbj rzju@ $Uuu ujշUjjuj跷UVS]uU vRU- UzD5u<u t/u t"u t t2Bv u%ЈC\@\ $ L @ d ( X p 4 | \Cn\Cr\Cb\Ca\Cv\Ct\Cf\Cs\C0CE<0C0Ѓ tt"\C 0C$ 0C$ 0b@u\C}MCvRU) UzD5t^Cu?@ -CЈC؍e[^UWVSM] }CPWPQhu)e[^_UWVSMu ]}MvFPWRQKwtjWPQ+Ee[^_UVS]ƍ\ST!Ѝe[^Uh ,?E{jVjY@={u]ĀߐS?={tjURj>u>jURj@e[^_U{/var/run/dev.dbUWVS}tPWT|EPW蛧ufEf%f= t 1jjjjh ƃt~jjlS1fDžl EpdDžhj\PdPVF Ѓu&`hEg\踲VFи@gVFЃEPWP[^_/dev/U`VSu h Ãu1hSƒu SW1MF9uB@PhEgBP)EPh@g5uE9uE9FuS @ge[^U WVSf] f]]]fUރ]t=x:t(AAfAE x;u˃}}EuGu] x;tqރ|x:tYRURMtMu'W|VWVfWfVM}~| x x;u E }Yuu讯El[^_UWVS} EuMuFuF^ FF]tE9sIAt>\uAu\I@f9vҐAtf9wf|VPz VP [^_UWVS}u f;{uf{}uf{u VS44j{S Ãu VWEPVWSuыEe[^_U WVSM] 9tff9uDžqf>t[ff[u# f>tf>]uf>u,(f{u f}utf>uuf>uuP4}Dž9fƒ[t ,tV{t/}t2f;tf;]uf;wtftf,tT9sff9rfFfN fffuuP}K9*}1[^_HOMEUWVSUEuf>~@ u |V]M 9s&uf~tff/tA9sf;uu >uXg**9u#w**9uh ~u%e[^_UWVS}Wt4O4t PKuwe[^_.USU] f:uf fPRC @uPR PC ЋUWVSu }SuG @u VScVSG$Ѝ[^_UWVSu }SuSG @u VSVSG(Ѝ[^_USU] f 9tfu1Ћ]UMU BuU VSEEEEEjjuVjj]S|jPht P^u藙PhtDjjVPjSE|E01Th5Ph Ph1e[^UWV=Phu1u1[\h9Thv@Љ5Ph \h=ЉtɃ=Xhu5Ph葙PhЉe^_UWVS}=Phu tz19ThvJ1WPhPt 0C9Thw9Thv[Љ5Ph =Xhu5PhPh9Thw1Љe[^_UWVSu=Phu tg1ۋTh9s5 Ph19t$t0C9r9Thv[Љ4 =Xhu5Ph\Ph9Thw1Љe[^_US]PhtuPPhXh\h]UPhtPPh\h/usr/lkm/lkmLKMDIR%s/%s_mod.oUWVS}h" 虙ƃtO9u?u5hh=`htD`hW3h) hhЅ%jhЅu Ѕ ;u1e[^_/dev/lkmUjjh  |Pu>%Ð1TMPDIR/var/tmp//tmp/_mod%s%s-q-u-o-emodload/sbin/modloadUWVS]S0ЍHM$)ĉu< cX…} ~DjEPR8uEu<1҅t<Eh _}t6h 4WEt"h WEt5<Ӡh# Sh( E@PWZjVh- h0 Wh3 Wh6 h9 hA DE<1҅t<Rze[^_UWVS=Du =tg=t'P h\HE2j]EPhH ]EEPu1o<+t<-uYhhN50HPhR諎P h[e[^_passwd.bynameUWVSu=Du.u 1E10׍G~P]EPV]}EPÃu"=|th Vh à t<+t<-u1)1te[^_%upasswd.byuidU$VSu=Ducu1E3uj]EPEP_]EEP,Ãu3=|t&Vhv j]Shy Sh5 Ãt<+t<-u1b1te[^UEHLUHLUHDtP@DxhtP@xh|h/etc/pwd.db/etc/spwd.db%s: %mUS t jjjjS‰DE4MMEjEPEPRB Ѓt |2E|au9=uhtR59 =xhuHǐ=u Sh j1]UVSDjURuP@ Ѓu/]9Ev,P5u 155CFu5CFujh S葊jh$S聊jh(Sq5,$CFu50CFu54CFu58CFujh<Sjh@S e[^U=xhujjhXjjxhUWVSuE>+L0҉uh e~@=hh@ 8=|htL}0HExhjhphEPRB Ѓt1҅th@ 돐h h@ 0hE䡄h@ E7hh1=huFP hEPEPEP` u5FPhh1$}=|htB}0HExhjhphEPRB Ѓt1҅eh uh H~=|htL}щK]xhjhphEPRR U҉t1҅t 1Uh FPh;~@FP EPEPEP tD}|h}0щK]xhjhphEPRRU҃E뤃}FPQ‰hz h{ |h}0щK]xhjhphEPRRU҃hS BC u:~|h}0HExhjhphEPRB1e[^_:UVS]U u<+<-VRh 腼Ɔ E h uV蹮TK(h V蝮8C(uCK(h VzC(uP蓿CK(h VNC(uPgC K(}tzh VC( uCK( h VC(uP\CK(h VͭtlC)uP\C$K(h uV蟭t>C(@uCK(@h V耭t{(|CK(h Vau1(C)u C K(j s 蒽te[^master.passwd.bynameUEPEPEPEPh uuu‰Ð1%smaster.%sU0WVSu=uhRVh0 S =tVh3 Sɢ PP0} HPu S5T=Wj:iDžƅ5jPVDžWƒu4ƅ2jV裂Wqƒu5+t-cm0_~@5SjFP; uePǃ W :S2脺t)G G xuS'=|h0HxhjhphPRB ЃtrnFPSX=|hb0щHxhjhphPRR ҉t1҅~@5SjFPP/ǃW :t5S2,t1G G xuhFPSH|h0HxhjhphPRBЃ:軅15:5u脅[^_UWVS =uh#=t =uEt P"EPEPhhV5%ǃuS9EPEPhh5SV5ǃ S趄t1j:uÃts}=|htF}0HExhjhphEPRB Ѓt1҅t:!:5uuu5uuue[^_US]hjx@P 5hj越5lj詊5pj蜊$S[P5]Uh jyhh jhlh jWph<jx@P脇w+/dev/tty UWVSh h 褷xEuE,|x|{h jhh j׉lh jƉphX j赉t hx@PɆ< %Hh<jx@P貆uu菝u xBHJHyR褽 t t sLjCjh MAP]hjx@P'5hj҈ 5ljˆ5pj赈5tj計x=|{tPe[^_/etc/netgroupr%cUdWS]_0J=ht5hS |<EPh` } =<t }u}u|<hn h` X‰hu=|<9EPhp RS5h}+u|<=|<t=tht\PTSnt%0PjhSP> htPthhe[_USUM ]hu1*@h@h@ hh]UVS5ht"6ss |Sv uhhtPVh5htD6Ct P+Ct PC t P Suhe[^UWS] USR5ƒt(0щMT ,tuи1e[_*%s.%s%s.**.%s*.*UWVSMu ]Ez8B~1ot3 tYt+tBK؅uU PVhW Q蘗1Vh] ؅uU Phb Quhg Qee[^_netgroup.byusernetgroup.byhostUWVSu}0}u =|<Dž1h|IPuuE PSt{PP0HPS t P5|ǃtu2u|uPPPz tk} ttPu uttPVu}ttPu֮uf W1[^_), , UWVSuhtsVtuuVÃt{t [CC EAE1<(jzEjuhM hEh EPBE1҃h EPU'ƃUtkF< t< th VU_Ut )0H~2XSUyUMDSPVtU MDBch EP芝V u#Et& EHM@< t<,t< t}1e[^_netgroup%s %sU0WVS=u.5hh ==|uh|uQP}0҉HPuh 5|aƒt,ey=|<LFuh hy+u#C t ttC t<w)C t t jw@OQw‹PWRVrI0҉O1| uO|\u ODž Dž~j7@PNw~ V+rwWVS r tN5hh譬 t0щO DžA hhupƒ5h1[^_UVSu] =jjj7 |"~ SP57 }1mLt Pv@PutS5P-7 |9ve[^U=-uj hh2}1-1=tgroup.bynameU=uu1Ð=̛tht Ðjjju tá8+uxth @PhUVSu u1^Vjj"à u.Л| t#8+uh Vhà t=țu1te[^%dgroup.bygidUVSu|u1`jVjà u3=Лt*Vh! j]Sbh ! ShÃt=țu1te[^r/etc/groupUt Ph! h! 表u1ÐЛEP5-t08+u@t<:t=Лu ЛŐЛ5#UjUS]Htț̛1]ƯtP贰: /etc/group corrupt: invalid fieldU WVSEE15hh  u 1Ej hu:BEHBEHyR tu념h" u藕‰d:+0u}}TZ}t}tuSܤ h Sh }t}uE 9F}t}tu5耤h" uÃu:h" j跩{0uuh" upÃu?uS~}t}uE 9 }h" uÃ0uu}ԛ]1ěԛԛtQME<,ut61*}t } t} utEuEue[^_:UVSuh% ] SNt9h% S:t%Fh% S%tPHFE u1l1ěԛԛtF,ut/1#t t utu@ue[^UWS] =uh*uEPEP0HPSu5uOj u荢tE=w1PuhßEƀunhu1e[_UWVS}=uhy=̛uIt PnEPEPhhh 5腸ƃuW̛=EPEPhh5Sh 5ƃ Snt̛1mE=vum뙐Puh袞Eƀumj h,EthWXIe[^_BLOCKSIZEGKM%s: unknown blocksizemaximum blocksize is %dGminimum blocksize is 512%d%s-blocksUWVSE`( ha( oÃ;j EPS| u}tuMtZGt+ takKt/akt' gt Rmt+IEk( @MEm( 9Eo( %@Shq( e9~jh( d߁,h( dE`(  uPh( jh0HMM e[^_/kernelU EEEjjEPh jEPet ÐP* .UWVS] Àt<j(Yjƃj(jVbuMN ^$ t^$uk=v uYPV ajh* V E ;f@2EEM0HPRV fC2MKK@KF$PSV fC4fufC4}t MK]C}u]MY]EEM9d}t}~uuV E jh* V  t>MHf@4 F$ujjh* NF}N$3<uB u^ivSiVJi1e[^_UWVSM fA&fA$؍CPu @VMqsj/V+ƒt09u M yAt#B0ЍXPRVsM fY&MAM AAA,MA e[^_UWVSut0f{2|ڋCuCRhf{2}SxhFt PD Ft PXhvMhF$u"v%1t=<v)pVhF$ut=<1e[^_..UWVS}mG%cV8fF8ujVW=fF4ugfF4ffwYjVWfF4 fG$jjh* 3F }<FfF4N6f~4tG$@t:G 9F,t2F6t v oGt P GfF4LtbG$}$G$w Gt>G$u\v4(tM<FN6wt:F@Fvu&jWGuG%1wGvPIff~2u'G$uw#VVWjfF8ftfuNjVWfF4 fu2G$u,jjh* F }<FfF4N6fF8WFfx2ufx$u@8/t F@$/BF&@PF@PReppPsef~2uVce<V$Gf~2uG$upw"VfF6t8G$u&v "t<v m<%v l&u G$uh- H&t O$P~tfF47e[^_UM UvBvt<fQ81UWVS}] tt<7<G%fF4f uFfGt PuO$f~2uF8/tG$tSWOG@jjh* ~ƃ |%SW*GV5! uVkG1e[^_U0WVSUUrqEu!} MfA4<Ar} u1+UZ$؃uMy0 u Eu} uVUB$uAM1w t0t} u <UBMI6E<UE EMfY$ËUR)‰HEfy2ufuA8/t MI$MEUB$t MJ/AMЋUB2@EEEEEu~ƃMA$ u~.u~ t֋F%=.tFPFPu*à tF9E}]Put05<t SauquZ5<URUM@$Q)‰HEfFfEf@fC$MCfUfS2}t&tfC4 MKfC4 UBCt ~*F<t#tMA$tCC@CfC4 WUB$tCCC&@PC@Puk K@KjSu/fs4 ~fHfvfuOC}u ]] UZ]EOuY}tuu|MA$tEH9AsEЋU}td} t}upMfy2uUB$uEru4MA$u+h- Y!tUfB4MI$1<}u} uUfB4␋My t}~uuQYEEe[^_U`WVSEu @$t]^<@$u}tESv0ta=<Sv:u< ~Sv t<Fj`jSRi fCf%f=@ubF,CF(fC fF0~@.u~AtF@%=.uZFfx2|9P(u9H,t2@fx2}2f=u $f=te[^_UWVSu} ]9^}(C(FPv^Fu FJNt@uv jSvB(N9ABKu@e[^_UWVS}uFDG$uP\Ãu1NFPu C@PLhG$u D3E$C h> q u5<J1ÐhU tP fstab: :%d: U$WVSjhN? j]j h> j]jhV? j]$5hhX? uVo0ۉщHPVj]uP‰׈щHPRj^](jh]? jM]e[^_U WVS}u MuG?tLt&*['\~t >/>%.9u~/t|G*t>.ut9ut^t~/tSu*e1uj/VVtH/uStNj/VM/ƃM$PVWM M/uuFuŊt.ut9utt~/tEPQPWMMt~}t}u Gu\O8tiIÉ=vPM{ÃM z4=vPMzMz49F1e[^_UWVSu}U UE-^]\u uFNt,ہvSMyMz4Ã=it 8M|<8]~05uPh_!PuU_8MuEF]U2U9U%e[^_UWVSU1119|<]dPWU RUu WQ1/Džu M BtF밃}tMe[^_UVSEju Pqƃ t5<Vu <VQ<e[^UVSUEPu R ƃ tuVu <VP<e[^UVSEju Pƃ t Vu{<VxP<e[^U5<u uPATH/usr/bin:/bin:.execvp: : path too long sh/bin/shUWVSDžDžj/ut#MDžDž>M9u<LhE Qu DžE JhE Pcrƒ:u E 0Ѝp0}Ѝx 7ȃ=v tfE1fzEPhI u> 1҃tU|EPhI u> 1҃tUEPhI us> tUEPhI uL> tUfI fEI EfI fEI EfI fEI EfI fEI EfI fEI EE`,ǔa,Ơ]]]]]WEPu= u GPEPux= EPEPue= 1҃tUVt)EPEPuA= uE1vFFEPEPu= tE0u)EPEPu9 ~h$iu]Ãh fEfffI fEI E,\0]EPEPu< 1҃tUÃ4~,WEVWEVuLF,e[^_UWVSu] ߃;t3V|At-;u=wm1u1) V&ze[^_WARNING! des_setkey(3) not present in the system! Uh P h,|1WARNING! des_cipher(3) not present in the system! UVSu] hjP h,|jSVa?1e[^WARNING! setkey(3) not present in the system! UhP h,|B1WARNING! encrypt(3) not present in the system! UhQ h,|1assertion "%s" failed: file "%s", line %d Uu uuh`Q h,|FU EUEEEEEPRj}Ð}tEEUS]hS&u5<X>PSu1]1OrOrOrOr_Or?OjrO{rN|rN#rN rN;rNr_Nr?NrN<rM$rM9rMUrMrMr_Mzr?MrMrLrLrLrL8rLr_Lr?LrL rKrKrK'rKOrKr_K=r?KrKrJ"rJ r$Id: pipe.S,v 1.5 1996/08/20 08:20:03 julian Exp $J*rL$Q$Id: fork.S,v 1.5 1996/08/20 08:19:58 julian Exp $,Jrt$Id: Ovfork.S,v 1.4 1996/05/05 07:56:09 peter Exp $YBru<$Id: strrchr.S,v 1.2 1995/01/23 01:29:23 davidg Exp $ST$L$ 18uBu[UVSu]t%M >tB:uBKt Aue[^$Id: rindex.S,v 1.2 1995/01/23 01:29:06 davidg Exp $ST$L$ 18uBu[L[ H[ D[ @[ <[ 8[ 4[ 0[ ,[ ([ $[ [ [ [ [ [ <[ Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z yZ pZ gZ XZ UZ RZ @Z %a %b %e %X %Z %YPMAM%a %b %e %X %Y%m/%d/%y%H:%M:%SSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJanCPOSIX//LC_TIMEUxWVS88}uP[ cuR[ K@teRuluUDž9@:0щˋ@:r0}֋ 0.QSkhX[ SMmuSDmhZ[ S9m jSR'|o@t `iu Q&8QH9ujSQ@99P@~ Dž9@:s29tH; t C; uC@:rϋ@81R@`i9Y ,Dž7?8|[^_U WVSu >=uF0ۉ҉HEMQu8ƒt9}9׈ӉHM9FBu <1;t G;u=Dt*P5<?7<uHDP5ÃtՍPS5<0< <D}U:t:=tB:u+UUEDP~5ËU <iڋEEt:=tBM Eu=BFBu1e[^_US]EPS>7t+M<‹BtԃBuƐ]UPWVSEuUu%EEE} EEEU UM9OM܋EEU9uM+MQMЋEЉÃMЅ~o}uUŰUẺA}"u]Nu]𐐊CANU)UE9EsUUE9EME EEE} UUE HEЉE} (U UUԋu֋EPVPU҃}*SVEЃ|FSuU҃ƋM}3/SVEЃSuU҃Ɖم} MMu+uԋ]]uVEЃ}5SuU҃|SVEЃuȅ}B]=UU2SuEЃSVU҃]ȅ} uEEȋUȉUEu)Ƌ]+]SVU҃},uSEЃ|CuVU҃}/]*uSEЃuVU҃]}]uuEЃ}0uuU҃|LuuEЃ]}8]3uuU҃uuEЃ]}]]]}uUŰEUŰEG}&u]M쐐Nu]M쐐CANEEEԉEU JUUUUE9EuuԋU҉ÃuwE}uEE̋UԋEE̋UԉH}&u]MԐNu]MԐCANUUEEԋU9U]E9E)uuU҉ÃuwE}uEE̋UEE̋UH}&u]MNu]MCANU)UE)EU9U]E9Ew}}uUԋŰUԉŰEI}&u]ԋMNu]ԋMCANEEE)E}UUUE EM9MؐUUE9uM+MQMЋU҉ÃMЅ~o}uEE̋EỦA}"u]Nu]𐐊CANE)EU9UsEEU9UME EEEM+M]+]9~˅~DM)ك}"]Nދ]CANM+ME+E+]9s˅~EM)ك}#]ԐNދ]ԐCAN]+]9]suu1uPu|]+]9]sE)؉E1uE `e[^_Uj juaeU1UXW}fEfE}}0HEEE0h EEEPu EP2'}UWVS}W(u<tG u"jjjw҉ÉփuuK_PwTfW t!W)΃0t&W<)tt +WΉ؍e[^_UEPu un&USE8euaX tZ;EuRCt PM,Ct P=,Ct P-,C+uPj}tB=xit hL"=ithL hL_>#zhxm VWÃb5Ph{m VWƃAF< t< th~m VWÃCVk[%X\T``t/< t(< t$sh{m SNWÃtCuPe[^CPOSIXPATH_LOCALE/usr/share/locale//LC_CTYPErNONEUWVS}}0щHwzu@o tuBo uzm1 =0.uihHo 'ÃtLuC0щȃ+=v S 0.u<0.To 50.SWhfo SEYuSSbztrto t R^[^_RuneMagiU|WVS]EPCP2REԅE}S 8u#E"SSjuu;BMMuЉuuT L Eq ƉtPMA0A0P P 4 4 < < D D EuMD4D44444Fu~L 8 4 ‰L 9Uu@ < ‰L 9UMH D ЉL 9EEuM94 1u8 ;;D;D;;D;Bu^L;+ MAML D; UL 9E!uu~0}MD uENuD; EMu94 HEMu9< ~H1ҐM@ DDDDEu9< EMu9D ~G1ҋMH DDDDEu9D MP L 9Es uQ!1Wu udžL M4 u ǁ8 u< u dž@ MD u ǁH Ex[^_Ujuu uu4v 0v ,v 'v #v v v v v v v v u u u u u u u u u u u u u u u u u u u u usr2usr1infowinchprofvtalrmxfszxcpuiottouttinchldconttstpstopurgtermalrmpipesyssegvbuskillfpeemtabrttrapillquitinthupSignal 04v x x x x tx ix `x Gx @x 6x #x x x w w w w w w w w ~w qw Zw Bw ,w w w v v v User defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangup/UWVSE E}tƃu)t PNK@ @ttD|t|t:t A@8ujjPju PuAÍCwCC[^_UWVSj=u uzƃ u [jdY Eu< 3EdU>:<^u+F<: 6 . & :FFBM=+UBdPuU EUEd B+Ep}tPuQ E}];e[^_UWVSj=u uǃ u jd u< edȀ?:t4Ut+G@Ku)΍FdPQ tûdʐ@)ȍpt PQ tU e[^_UWVS}j#u u2uq90uA:tF>:u^FPu<^e[^UEt Ð,|UEUEPu u%s: : %s UWVS}] 5<=u j5h 5 t"uS5臬h 5VPh 5ըtWЃWUEPu u UVSu] =u j5h 5p tuS5 h 5GtVЃVUE PuUVS]5<=u jZ5h 5 t"u S5Sh 5軧VPh 5衧e[^UE PuUS]=u j5h 5T tu S5ƪ h 5+]UVS]sS?3Cs SS"V~e[^rrU,WVSM DžDžDžDžDž3C&vV zT5tfMyQEA]=vPzT5jMI랐%1Dž3Cx$ ̒  H H H H H H H H H H  ȓ ȓ 0 x  % ϓ ϓ ϓ < X  L  $ ܓ MyQ>R ]9P K}|oDžp DžDž DžDž geXR^ * 1Dž DžtE]Sff tEMQft!E]CX:E]S !Z vV. zT5tDžp Dž ]{SS< um]ЁvRzT5t6MQZYJ~믐u;m 뗐/$ P utP1Ґ]s9s*)3Sx;tׅ )Mq9.uWjE]sSutP1,FMIOt2yQ:t m]*u…\EMI]DMICOt0yQf:t 9M*u)ޅxut\1MЁvRpzT5uF]KOt{S9t뀐EMI]ЁvRzT5u1MICOtyQ(9t)OvG]M2VՃMF$ . . . ( \ \ \ \ \ \ \ | | . . . . . . . . . . . . . . . . . . . . . . . . Ě . . . . . . . . . . . . . . . . . . . . . . . . . Ě uDžt ? Mi?t]iՐ Ő@twΈ.t_9uQDžʋCMQZYJ~u6uO}-9uQRsxtXuuVjRщƉ׃ u(tEMQf2Ct EMQ'tEMQ2z E]S2)ꋍ7OvGM2VՃ:$ 2 2 2 2 2 2 2 2 2 2 2 2 2 ̝ 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ̝ ?^@㿉Dtw)uRڋA]SJKJ~u|3uONt>9֐uR9w3etEtuV^K3uVHuHjRtE]SEMQ)ꋝOt[^_UWVS} UG^uEMGEhuu }uG+]]UM] 7G-t t]tsu7]tuVC} E-뷐GEuu}Vu  UM] E}~Ɖuvu\e[^_UWVSE@UZ09u?hDžtoMy0A4UD@>Ny:1FMq4uURSǃt >VWSMy0UQ41e[^_UVSu] t^=D8uVfC u+tDtSu3c CCK {0t0C49C|St fH HCPc ߋCt9vB9u JC,CC<C8K@K0C4KBKB Ce[^UVS]u 9sHr1VsDOt CDsH1e[^UWVS}W`/wj 7聲ƃ tF)ËM fO )_7_ECPPW^u+EUWDP7R ]W.uMwj 7 ƃ u_뮐F+MSWu$EGDu7PM)O7M GD M 1e[^_USU] 9u1* hh U Uu)؋]Uu uZ U`WVSu]SV"pfEf%f=@t<jVoǃ1SWyfEf%f=@t <hjjWjU tVjƃtFeFtFvF t>FFV F<V\WZ<1e[^_U =u9EEEjjEPhjEP'uáUVSu] SVt[hCPV tECPVt4C PV~t#h jjCPCPVD t1e[^U$WVSEu =it VP# EE1EPOE]VCE܋u܃M9>EE;t@EPEPEPS];t#}tEPEPEPVu>t}t݋UtEt9u?u}+};t;ut %؉E*;t>u])‰U;u>u}u;u3Ee[^_U4WVS}EG؉فvSKzT5уuȀ}-uEUE}+uEG}t}u"}0uxtXuWUE}uE }0uEE1҉EUuujj#ӉM]uujj7ӉMEEEM=wmу1ɅtEtMvQ zL5]vSzT5уtــMM9M}|-U9Uw%E9EuU9UwE9EuU9Uu9M} ECEEeÉ֋UU֋EEUЙẺUЉ؉EUЉEUUG}}EE<"}t ]U]} tM}tOE EUe[^_U4WVS}EG؉فvSzT5уuȀ}-uEUE}+uEG}t}u"}0uxtXuWUE}uE }0uEE1҉EUEE}tEEuuuuEuuuu8EUEEEM;wmу1ɅtEtMvQR zL5]vSzT5уtــMM9M}|-U9Uw%E9EuU9UwE9EuU9Uu9M} ECEEeÉ֋UU֋EEUЙẺUЉ؉EUЉEUUG}}0EE}tEE<"}t ]U]} tM}tOE EUe[^_CPOSIX//LC_COLLATEr1.0 UWVSii}u i7uP uR 0.uiPS hX SuShZ S hf SFÃuiSjj hh<muyh<h ucSjh h4.=uISjhh<#u/SjhhD uS%i1 Sv%[^___collate_substituteU WVS1E0ҋ]߈щHE1ۃ}t}?uh wE0ɍ4.׈щMEDE9#th VH Ãth V1 ÃtCh Vj'Z ~ Jh VjZ dq: th h $Y 0 40C< t< t|t/< t(< t$sh SB ÃtCu<|e[^UWVS}j|7ƅt=U 9VuW6t&^;t֐W3t ;u뻐Ce[^_UWVS} uj Åt9suWuC0FH u؍e[^_gethostby*.gethostanswer: asked for "%s", got "%s"USp:t<u u <]gethostby*.gethostanswer: asked for "%s %s %s", got type "%s"size (%d) too big Too many addresses (%d) Impossible condition (type=%d) ULWVSDžEȻMM } t% }tl}bDž~ Dž Ef@ȉEf@DžhDž u f h hhVu覺Ãщƒt}t}uR0ҋʉӁȻ؉)MDžܻܻ̻ܻDž88ػ8DžDž@:"9VuyÃщƒV蹾V譾%}uuV觾@:Vz؃}t }dhVu豸Ã2Љƒދ0Ӂډ)؉09RȻ؉} hVu賷Ã|8t&ދ09|~ى)9}t7W襥Pu蜥Pj襥Puhm j% ރC} t"} }tuVu艶Ã赺tnރuȻ/dsZ0Ӂ~ 1ډ)5Ȼt$5Ȼh j%` ރ9Իu(Ȼ0ʉ)P)‰=hrSh ~r$uj#h MSRV)ރ Wh׾ u~9v ;t"~}uh8=ȻuK0}9|f^uȻ؉)q: tPPhȻWO<Ȼ<1[^_UEtuлԻлԻPuu ures_search failed (%d) UWVS]u p:uu<tt(<</5лԻj.SuSIƒt=wm1ڀ;{.hhSV`N  hShhiDžiDžȻh̻ܻܻ8h<ػ8 q:  PPhȻFM=wm1u:.uB:uӀz.=wm1tj:SJu ;:ڀ;{.hhSV0M hShhUiDžiDžȻh̻ܻܻ8h<ػ8<Ȼ=wm1u <:t<.uB:uҀz.4hVWjS#D|$WSPV&<< Ph 1[^_%u.%u.%u.%u.in-addr.arpa%x.%x.ip6.intres_query failed (%d) UWVS}p:u }uC} u=j hX WE; tj hd W1; uE EE }t }t  </9E t<<1A}t }t0rPGPGPGPhp PO;%PЃPh VƃKy١  FhWj jV@Ã}Sh 1j VSWÃu1jMKM K Qhhu8h< }u&q: thhhhICC <؍[^_UXWVSE}}1ۋ} 9}}^1Ɋ;9s'}E1ҋE#;9;tA9rfL]}u~ D]9}]CE9] }t\} 9}}T}}MIx;}4}OfDMff9~ fTMf}DTIyE} 9}|e[^_Up:u 't}t p:U%p:BrUVSu]F9~Å~Su 6)^1e[^UEPu uVsyslog: unknown facility/priority: %x<%d>%.15s %s[%d]: %m /dev/console U@ WVSu} tVh( j#q pj<u 5ljDžjjh jP8SIVhN gSPhS g dj t:+=hjuhjt5hjhZ f djtPh] f =hjthb nfhe W`5Džjjh jP6ÃuE<%u muGS!P SP~;GuSjl;Sƅ uW/i+dj tG)‰Љ)‰Džh DžjPj  =|ujdj P5hj jWV5`jjWV5`j}bdjtYjjhj Bà |Bj>V@))ljDžw DžjPSDS[^_U`jtP`jx/var/run/log/dev/logUVS=`ju)jjj`j jjP)' =`j=xEEjh u]SjV5`jӷ%xuGjh SjV5`j衷%xu5`j`je[^UUM Ethj djt uljdjt|U5`j`jxUUpjtpj$Id: yplib.c,v 1.24.2.3 1997/04/10 20:29:35 wpaul Exp $UWVSu}EP@E tE9C|uu%j"jSb t Ct PC t PCC uCt~WC {ujgC\US{ssu 腻ss uwCtVPtsV-CUjSe[^_UWVS} u= uhC UCUQEPC t89su+us`uVWs0 uC9E~u1e[^_SuccessInternal ypbind errorDomain not boundSystem resource allocation failureUnknown ypbind error: #%d UEtt-tt x Ð Ð Ð ÐPh h(/var/yp/binding%s/%s.%dclnttcp_createYP: server for domain %s not responding, retrying clntudp_createfcntl: F_SETFDUlWVSDžDžDžj/uljt99t5548t!~`t VV豾ރu48=j} t } Ut0u )548tVRu t6uu+jltjlV^F\FhDž{RRv\C tu fVdf9tJ~\W-DÃN`t QQR҃FhF`SCS ~hN`tQQRF`F\juh? hO SjS:ÃujjS8C=<#DžDž jRSB 9t SjVHRU]FIFHVLffVJfVXSsSfVhBN`tQQRF`F\jS\ƅDžjjRjhSÃu4 .X O=(.=BhX '0ffv SSRjjDžKRh" }Wh` jS҃ tISSRFh uhg h,|b[`t/SSRFhjjR<>*SSRjVHRd[FIffNJVLfNX FhuVR~` jjDžF\V\RjhVHR!F`uh Q&Fhljjv\ u h *DžjSZSv\4@ƅRSv\? uffVd)V`JRQ҃tVf 't48548} t} 71[^_UWVSuE~`t[EPEPv\? t}u fFdf9Et'^\SF?NjF`PPBSW?W F`PPBF`F\Fhe[^_Uju_UWVS}148t?CPW*u#S-t48S? ދuče[^_yp_match: clnt_callU,WVSu]}tD0}t2}~,} t&} t}t}u ouh _uHURURuuu t+UBR诶]6Pu蛱  1URut j]E]]] ]]]]]j ]SWUJ`AuuShP URhl jQ҉ǃ(t#h Ur`u _u ǃuMUBRϵ]6Pu軰  uh *u63uuu 1URhP e[^_US]= uhh :t  1]yp_first: clnt_callU,WVS}t(0}t} t} u B]]]]URu<t j]E]]] ]j]]SUUJ`AuuSh URh jQ҉ǃ(t h Ur`u hu ǃucU]BR]]3Pu] ] U]BRг]]3Pu蹮] ] uh e[^_yp_next: clnt_callU4WVS}tD0}t2}~,} t&} t}t}u N] ]]$]URut  j]E]]܋] ]]]]]j]]S"TU؋J`AuuSh URhl jQ҉ǃ(t h Ur`4u \u(ǃucU]BR8]]3Pu!] ] U]$BR] ]$3Pu] ]$ uh ?e[^_clnttcp_create failed U0WVS}t(0}t} t} u 9URut j]EEMQHUQLUQPUQTUfEjjURjhURhǃuh[  ]]] ]]<SX:OuuЍ]܉]Sh` URh jW҃ t,h Ur`PWWRuWWRҋ}uh` 跥 u1 We[^_yp_order: clnt_callU WVS}t(0}t} t} u URu\t j]E]]] ]j}W QUJ`AuuWh URh j Q҃( uMt h Ur`u `uuU]Wh E{Ee[^_yp_master: clnt_callU WVS}t(0}t} t} u URu0t j]E]]] ]j]]SOUJ`AuuSh URh j Q҉ǃ(t h Ur`u huǃuuө]uh Ne[^_yp_maplist: clnt_callUWVS}t0u URut z5juEj]SNUR`JuuSh! uVh` j R҃(thL Ur`u uuUu e[^_Request arguments badRPC failureCan't bind to server which serves this domainNo such map in server's domainNo such key in mapYP server errorLocal resource allocation failureNo more records in map databaseCan't communicate with portmapperCan't communicate with ypbindCan't communicate with ypservLocal domain name not setServer data base is badYP server version mismatch - server can't supply service.Access violationDatabase is busyYP unknown error %d UE$ ` h p x x Ð, ÐB ÐN Ð| Ð Ð Ð Ð Ð Ð" Ð@ Ð^ Ðx Ð Ð Ð ÐPh hhUEtmwtFw t8t/ytkt^lt?w tHt;Yt#tL1ø ÐÐÐÐÐÐ ÐÐÐUS]= uEPut h ut1h n]$Id: xdryp.c,v 1.6 1996/06/03 13:16:53 jraynard Exp $UU hBPRuhtÐ1UWVSj]S0J]䐐uu3uuhP U 1}uuhP ѝU ]tE@P6uWu$E8E@PuSuE uhP Z5X:uSuWj<ЉƋU  W胨S} *uhP U uhP U e[^_clntudp_create: out of memory U@WVSu}$1j @Et*U U W׃M T9dRÃu0h h,|%H . <(.wT;`SXjURf~u"juu Vf>†fVMAjYSVS VSV SCUSUS C$C(M KT{\˯3U3ỦUEEM M܋MMju sXs8V}<URV[?SPm`P`I TT?B~PTT?B䋽D9PD9PuH9T{`A,m<ODžddRURj`q\``S1O}0<t#`W0G,`QX9Q`jPShS#8uVS:`,RV <`,uKMz ]SRW҃u`A,A0}tQ\SW97RPC: Failed (unspecified error)RPC: Program not registeredRPC: Port mapper failureRPC: Unknown protocolRPC: Unknown hostRPC: Remote system errorRPC: Server can't decode argumentsRPC: Procedure unavailableRPC: Program/version mismatchRPC: Program unavailableRPC: Authentication errorRPC: Incompatible versions of RPCRPC: Timed outRPC: Unable to receiveRPC: Unable to sendRPC: Can't decode resultRPC: Can't encode argumentsRPC: SuccessRPC: (unknown error code)US]1ҹj19juDBv ]UuPh h,| 5 - Error %dUWSÅu1uhR S5 .oPS, . t'uzhE S5$.@PSXhE S(.~9 ~P藎PS'5(.hI 0ЍDPK h S؍e[_UuPh h,| 4Failed (unspecified error)Invalid server verifierClient credential too weakServer rejected verifierInvalid client verifierServer rejected credentialInvalid client credentialAuthentication OKUS]1ҹpk19pkuD Bv1]U WVSu t~t.<.ujjVϜEE f~uJEEPEPjju"ÃEjEPjjuÃ|mjVuà f~uT=<tjEPjju}4=<,E9t%EEPVu}=<1؍e[^_UVS(uj@j1Ãu1({<uq<C <C<CC CCCCC kujjC(PV&SV4(C PV*( EV@ЉC)~vulsGu] ډQRuv]Ӄu uN0t@9tQ']C0uVFf 1e[^_USUM AXYHy 9A t QR譢];; res_query(%s, %d, %d) ;; res_query: mkquery failed ;; res_query: send error ;; rcode = %d, ancount=%d UWVS]ufp:u!u<Mp:tSu uh0 VhWjjjSu ujcÃ$"p:t hJ <uuSW'Ã}"p:t hh ߼<VufFfp:tfF%PЃPh 蔼FwQ$     <<<<؍[^_UWVS}UUEEEp:uku<<<1ۉ?t8.uC@8u19vx.uFu'Wtuuuu PPE;9r+uuuu jW`<UEu=p:|q:1۾:=:tzuuuu 6W=<=<tt$!uEUB$<uECq:uC>tt}uuuuu jW{<}t U<&}t<}t <e[^_;; res_querydomain(%s, %s, %d, %d) %s.%sUWVSu] p:u!<u<p:t uu؅u= PVhC ruK0ЍXYX|!<3.uSVP蕵Ƅ+ ZR0҉ЍD=~</SVhg Puuuu[^_HOSTALIASESrUWVSq:  9m  9Yh Dh P[ǃ,jWEWhS輸 ހ=vPqzD5uF>ù>uS~uF=vPmq zD5uӀ>tf^~t4=vP2qzD5uC;u,hVh,wW, W1[^_;; res_mkquery(%d, %s, %d, %d) U`WVS}$u(p:u ;u<p:tuuu uh` yt΃ ~j W"}f:f:fUG$ЈGp:$ЈGg_ }Em} }tU}JAuMMQVSu g")SEP{kSMMQjkMfA}}uuVSufSj kSukSjkSjjMfA nE 9nG _ SEPj_SEPj_Sjj_SEPj_ }tuSuz]fG)e[^_US] jEPu\z CHyCCjSEP9z]UWVSEu }xucx u]@@ X;tGȃ)B9} 'щ)63];ue[^_UEM UttRQ-ÐRQÐ</0123456789U WVS1EuEZSh uEt/‹E- =wNu%E}?.u3t/}t)F1MAMu}~EM 1e[^_0123456789abcdef0123456789ABCDEFU(WVS}jj]S诈mE ?:u G?:[}VE^ h^ U胱U؅uVEo ho UdU؅t+E Em:u?}}u}]OC9ECЈCE1(.s9uSu>"7G,}tC9Esl CЈC}t.+u9]K)M  KG9~]9]u"EM EAEAEA 1e[^_US]jEP} tEE]U8WVS]uEEEEURVj } ]Uu}t69u U9U9~N)MUMVN EEEԈ EEURURjh 0jVjN=0uߐS=0tjURjWjURj 1e[^_U0U E EEEjjEPujEP t1ÐUSE ]tpSPu\uts]UEPURj+uEÐUEPURjuEÐUUR,鯆ir鏆xrovrO r/rZr)rυhr鯅Sr鏅ro/rOr/+rUu uot Ð1Uu uot Ð1Uj@u uqtÐ1Uj@u uhqtÐ1Uj@u uHqtÐ1UE hPPuotÐ1UE hPPuotÐ1UVSu] SV>t7CPVMt&CPVltC PVKt1e[^UVSu] SVt'CPVtCPV t1e[^UVSu] SVtCPVt 1e[^UVSu] SV t7CPVkt&CPVktCPVkt1e[^UVSu] SVtCPVut 1e[^UVSu] SVt'CPV9tC PVt1e[^UVSu] SV6tCPVt 1e[^UVSu] SVtCPVjt 1e[^UVSu] SVlttuCPVu1e[^UVSu] SV"jtCPVt 1e[^UVSu] SVth jCPV~t 1e[^UVSu] SVth jCPV:t 1e[^Uu ukt Ð1UVSu] SV>itCPVt 1e[^Uu u2kt Ð1UVSu] jSVk tjCPV kt 1e[^UVSu] SVt)tuCPVh CPVu1e[^UVSu] SVt'CPVItC PV,ht1e[^Uu u2jt Ð1Uu ujt Ð1UVSu] SVtAt w t 1t'CPV:CPVz CPVu1e[^UVSu] SVbtAt w t 1t'CPVCPV CPVZu1e[^xdr_reference: out of memory UWVS}uU uEt u9VV qËU uh# h,|1/VS]jSWU҉ƃ ?uSqU e[^_UVSu] ;ƒUEPVgu1&}tuuSV1e[^xdrrec_create: out of memory UWVSu }jDpÃt*VJƉsuNSV{\t@CPVF^t/CPVY\tC PVH\t CPV7\1e[^UUE wR$/ H/ / (/ 0/ 8/ @/  @PUUE tuÐ@PUVSu] Ft t!+Fu ]SP!Sv FCtwt ( t!FCFFC FCF Ce[^U=4uGT4=~ 44$Id: sigsuspend.S,v 1.4 1996/05/05 07:56:20 peter Exp $qD$D$or1UU h1uPRu~res_send: %s ([%s].%u): %s US<p:t1uU_PfE%PuSPu h0 u<]res_send: %s: %s US<p:tu^Pu h[1 u<]UEllUEplUWVSE8}HMPU@ E11ۡt:9}?}Mǹx:1Ґ9Eu|:t9EuF C9|ىe[^_UWVSu UfBOhVuuG} TV$M؃VM%9] u$9Euue^u  O1[^_UWVSu UfBUfB%9t 1|uO~jhVu uF|VZL؃VNL%uuPStO[^_;; res_send() ;; Querying server (# %d) address = %s socket(vc)connect/vcwrite failedread failed;; response truncated read(vc);; old answer (unexpected): socket(dg)connect(dg)sendsendtoselect;; timeout recvfrom;; old answer: ;; not our server: ;; wrong query name: server rejected query: ;; truncated answer ;; got answer: U\WVSM}p:u| p:u ;t"h3 h{h{u uDžp:u } ~ DžDžDžDž<DžDž9 l: Džw x:EW=lltW11ېEPuuE P}WEPllЃ $l6 6 < 6 n? @ C) tp:t&Ep:NP@Ph3 h{ l:Dž=`l|=hl! jjj2S`l <juPMS }>=<Ep pp0Wh3 h,|hl]SE PH]EEEE EjEP5`li‹E 9t.=<Wh4 h,|ufEEPV5`leà ~fEf)fEuׅO=<Wh4 h,|/ 63&DžuTG%E9E}0p:th!4 h{DžfMfMfEuf}t+EPV5`ldà ~fEf)fEuׅ=<Wh84 tUIfEf+E8fEf=wSP5`lSdà ~fEf)fEfu‹ff9p:u ; PhA4 h{h{UE9Pu=`l| =hlt3=hlt,jjj=P`l dl=t:t=dluAju5`l'P } Ep pp05<hi4 dlju u5`lv9E 5<hu4 h,|=dltEƅDžfDžjP5`lyOdl< juju u5`lڊ9E t>Ep pp05<hz4 h,|h:~ =t: DžDž`l  vSVYƃu SV=`l PjjVAQ^aÍ9t VY}<aPh4 }u0p:th4 h{Dž<DžPjuu5`lME"5<h4 h,|4 Džff9tp:u ; h4 }q:u/up:u ; Xh4 Dq:ugEEPuUE PRzuGp:u ; h4 h{h{UE9Pu G$<t<wTp:t,h4 h{Oh{UE9Pu5 =;;p: u6Gt*th4 h{Džp:u;%!=!uh5 h{p:u ; t,h5 h{h{UE9Pum tp:tu q:u =pltV11ۍEPuuu uuplЃ$L? n? < `? n? @ C)tE9 t:x9=l:PouJu <=A<<45<h3 h,|5<h^4 搐 <[^_U`l|$P]`ldlhlrjeechodiscardsystatdaytimenetstatqotdchargenftp-dataftptelnetsmtptimerlpnamewhoisdomainaptsapfsbootpsbootpctftpfingerlinksupdupnewaccthostnamesiso-tsapx400x400-sndcsnet-nspop-2sunrpcauthsftpuucp-pathnntperpcntpstatsrvprofileNeWSsnmpsnmp-trapprint-srv%dUUB=$A 0D E 8D E @D E HD E PD E XD E `D E hD pD xD E D E D E E E E E E E E E E E D E D E E D D E E E E E E E E E D E E E D E D E E E E E E E D D D E E E E E E E 0D E D E E E E E E E D E E E E E E E D E E E E D E E E E E E E E (E E 0E E 8E E @E E HE E PE E XE E `E E E E E E E E E E hE E E pE E E E E E E E xE E E E E E E E E E E E E E E E E E E E E E E E E E E P@ ÐT@ ÐY@ Ða@ Ðh@ Ðp@ Ðx@ Ð}@ Ð@ Ð@ Ð@ Ð@ Ð@ Ð@ Ð@ Ð@ Ð@ Ð@ Ð@ Ð@ Ð@ Ð@ Ð@ Ð@ Ð@ Ð@ Ð@ Ð@ ÐA Ð A ÐA ÐA Ð!A Ð(A Ð-A Ð2A Ð>HEADER<<- opcode: %s, status: %s, id: %d; flags: qr aa tc rd ra UNUSED-BIT-ON ad cd; Ques: %d, Ans: %d, Auth: %d, Addit: %d;; QUESTIONS: ;; , type = %s, class = %s ;; ANSWERS: ;; AUTHORITY RECORDS: ;; ADDITIONAL RECORDS: ;; ...truncated ;; ...malformed U WVSup:ukh}UӃ U ;tu UBt_f%PB4lB4lh4H VsFPVHx  Vj d;tt&FPVHy9F ; Vj;d;t hcH Vz}hlH VBthpH VBthtH VBthxH Vz}h|H VzB@thH V`B thH VFBthH V,;t fB%PhH V fB%PhH V fB%PhH V fB %PhH V ;t t FPVHx   Vj bfBH;tthH V:O&;tthH V9;ttVu uSÃ)hPSEE Pu-YÅO9;;tt S3%PPhH V9;tt S2%PPhH VE;tt!FPVHx   Vj aO9hH Vj BPSu uOÃtn9r^hH Vj@BPSu uÃt>9r.hI VhB PSu uÃt h,I h>I V][^_Uu hu=UWVSU ]hVuEPR,ǃ}1>u'CHKHy9C .Sj.P` SVbE[^_Uuhu uf.UWVS]uSuEEPu +ƅ|#0ЍPt|.t9E1fN fEe[^_UVShVhu uuÃtuVa1[^ %lu %s %s ; proto %d, port %d " "\"?" ;; *** Warning *** OS-type missing ( %lu ; serial %lu ; refresh (%s) %lu ; retry (%s) %lu ; expire (%s) %lu ) ; minimum (%s) %d %u %u "%.*s" %u %u %u %u %s %s ( 0x%04x %u %u ( ) ; BAD BASE64 %d ; LABELS WRONG (%d should be %d) ( %s %u ?%d?;; packet size error (found %d, dlen was %d) U WVS}p:u`u<1nhShu WǃtuS_W.%(Wn.؃W~.WS.%$ ;tthhO u ;ttS)PhmO uw(PhmO u[(He$R S uj +$uhO \Gޅ9PhO tt0UBHJHy9BU\uj\YGMAPQHy 9A tM ؈UuSYNkMAPQHy9AM"uj"nY9GuhO [ރ9PhO st0UBHJHy9BU\uj\XGMAPQHy 9A tM ؈UuSXNkMAPQH9Auj"(  uhO ZhO u UBHJHy9B U  uj "Xuu W_ǃ JMAPQHy9AM uj Wuu Wǃ uhO YW(ÃShO uW(ÃSKPShO u0W(ÃS(PShO uWk(ÃSPShO u0WH(ÃSPShP uv W(%Ph'P uouu W,ǃW'%Ph'P u;uu WǃUBHJHy 9BGU E$uhO XGޅ9PhO pt0UBHJHy9BU\uj\UGMAPQHy 9A tM ؈UuSUNkMAPQHy9AM"uj"UBHJHy9B U  uj VU $9UBHJHy9B U" uj"UGޅ9PhO bot0MAPQHy9AM\uj\TGUBHJHy 9B tU؈MuSkTNkUBHJHy9BU"uj"2T9MAPQHy9AM uj S9NjW$&PhmO uD$"j.,PWj3'PhmO u$,PWOPhmO u$WR$؃WF$%PSh,P uGWSh4P uG(WSh4P uGWSh4P uo߃ W#W#؃W#%PSVh

ЍUC=wm1tMLЉMC=vPzD5tҐ=vPzD5tCЊ20$o p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p v@MU42+Uv@M)12$p q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q M M  M C=vP8 zD5tԐ=vP zD5tCЋMe[^_U4WVSU1EEEEEEEU0Ѝ|EP]SEEPSuẼUMMЉЃu5uu]]M̉M%}u}u]]M̉M 1.E8-u E@EE8+u@EE=wm1tDЋU4EɐE8.uqX]@=wm1tKEЍ‰UEE=wm1tEMLЉME]EE=vP#zD5uE9s@EE=vPzD5tE9M@E뾐9}<EPEԃE=vPzD5uE9s@EE=vPGzD5tE9@E뾐9}EP6E܃E=vPzD5uE9s@EE=vPzD5tE9s@E9}s EPE؋M ]ԈY]܈Y]؈YEAEAEA]YEAEA EA ]Y A A AYe[^_?; error: unknown LOC RR version%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %smUHWVS];thGv u 8CESU܊CE؊S{ C ‰US UсCS  {  EC EƁS {  C [ ׉}w)E]ÀigE}ESENȿU<UUE} EWEEUЉƿ<ỦƙUȉƉؿdUĉMMEPQEԃu lUEPPEu =l}EPPÃulSuuuuEPuuuVURuuuuhgv u 6D}9=lt W-E9lt P9ltSE e[^_UWS]0ЍH119} <.u@B9|;*utH~| .t@e[_%04d%02d%02d%02d%02d%02dUEEEP*BlB@B2rrr Prh5y h5ZONEREFZONEINITUPDATEMAUPDATEMUPDATEDAUPDATEDUPDATEA8765NOTIFYCQUERYUCQUERYMIQUERYQUERYNOCHANGE14131211109REFUSEDNOTIMPNXDOMAINSERVFAILFORMERRNOERRORUWVSEEEE]=~؉E}%t=tt}|:}9]t 9].C9Evv}|:}JxsF.t\u D9EvO\CȈC9u vAJyF}} +E@EЃ? Ћu9uw9u vEE +E9E| !F,}}+uuEe[^_UWVSEu} =~E EEE}t8UUEt/MM9t EU:uMMOEF}t`uuuFPE|"_9] {E}tE9EsU:U}G\uFt9}v5؈GFt .uF+EPUu9>v}t/M$UM,9}w}t U G+E e[^_UVSu] 9s+@t сt t@9r9w)e[^US]ÀuMvSzD5t#v Sm?z4؋]UWVSMMuM M{%t=tTKx2<.tj<\uFPFCPGU4U9uBKyFu?t).t+؃? Ћ} Gu>u E+E EM9MPe[^_US].CtY C.tH.t .tuBv2Bv*BЃ v"1+BvBv BЃ v-uމЉʅu]UE8*u!P.u PlÐuÐPVUSM1ۊu @%B߃]w$t1.t\uAuك.t1Q]UU ߃]v1BuUEff@f UMA A A UM fUfQUMU BBJUUBЃ w ÐUWVSu19} . +/€t1vRV zD5t%É=v P  z4=w m1tP!EFtÉ=v P z4=w m1.PŠEЋM AM GFe[^_UWVS}u UtU E~19}J%B 07FB 07u C9}.BC9|Ee[^_USE] MUttRQS0RQS</1]%u.%u.%u.%uUWVSU} ]BPBPBPPh uVy,9wVWE<1e[^_%xU\WVSj jUR1 M M+MM+MM DG~E1|uu "Ft}t9u}]uG~Ãt}t9u}]u}t }E]1}t9}UU9} 9}uv:Cpt:CuO}uI}t}u=}u4)ڃRSU Rs tv0ҍ\ th S*à Gf}tUUu:CCEЉ)9UrPu \CE <1e[^_%d.%d.%d.%dUE PE PE PEPhЄ jhtABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=UWVS}1} UGMMGMMGE ÀE ÊMEȈE% ÊE? À?v?vM?vvM}?vaF9E@Ê MFŠ FE슀 FM MF} } EEE19U vD*GB9U wE$U% ÀE À?v?vM?vvF9ErXÊ MFŠ F} u =E슀 MFM=F9uvMe[^_U WVSMEEA} vSMwMzD5==ISh MbAÃMP}tX}t$}}} tU9U غ (E} t/E@9E- غ (uU D2GEEv} t/E@9E- غ (uU D2GEE2} tu9us\غ (GEE gA=A}t\~}}vSMMzD5tAuŃ=u9vSM{MzD5{Au} tu U<2t\}PEe[^_UEarrbrUUEu EPUUu uUu uBUUM u BQR@Ðu BQRÃt1ÐUUM u BQRÐu BQR@Ãt1ÐUSM] t$r t3;]AURQ@%AURQЅtEf1]USM] t$r t3;]AURQ@%AURQЅtEf1]US] UEPut E1]US] UEPu`t E1]UVSM] t+r tBJ;ƃuQEPQB-AURQЅt}ƃ31e[^Uu uUWVSuM UtyӃt )߉u*FRQV@Ѓ tItLFShV@@u(FRQV@ Ѓ ttFSh0mV@ t1e[^_xdr_bytes: out of memory UWVS}uU VWty69us?umt r@tG]uSu(VËU uh h,|)'VSWtSU 뫐1e[^_UE hPPuDUWVSu} ]WVft{t9t{u}u1juVCjuVUҍe[^_xdr_string: out of memory UWVSuM t u0HEEPVtwE9EroPt r>tF\tOu(RËM uhێ h,|ɦ/EuSVgS>M 1e[^_Uju u$u1ø$Id: bcopy.S,v 1.3 1995/12/27 18:47:44 davidg Exp $VWt$ |$L$)9rL$_^ONL$_^0123456789U(WVSu95 v  [M؅}ؐ 1Êp A؅u}-AIOmPmE9vÐIB9w@me[^_UWVSu0S ǃt SVW1e[^_UWVS]} =vP+ƃz4G=v P+ z49u Cu1Mv Rg+à z4G=v PA+z4)É؍e[^_UWVS}]u =vP*ǃz4F=v P* z49tT=vP*Ãz4F=v P*z4)ÉCt ML1e[^_GMTUS]1;}1ɐ A~]USmmmm19 ~'1ҋhldmA9 19 ~-dP@dmA9 ԋ]/etc/localtime/usr/share/zoneinfo/U#WVS]u ;:uC;/% 0 ҉ЍD=^h V3h V`5SVY5j.S4 t Dž󃽐tjS1jS ÃEPSfEf%f=hPSSVVVU VM AVU BVtM A 92YC=yrt29t 9t )‰Љ)ËM ItM AЉxtU J t t9[19~VM DG9y1U 9z~"M F%9AG9y1U 9z~_DžtL] tV-CFCFM 9A tGU 9z1M 9y ~U LFG9z M ƄL199~>DžL] VVCGU 9:1M 9y~KDžtL] ttC FvhC tGU 9z1M 9y~BDžtL] ttCFv CtGU 9z1h[^_mnUM+tAtƒЃ v<wUWVS]} ut=ƒЃ w01ɐɍDҍ 9CƒЃ v9M1e[^_UWVSu hj]SutRURB9:uEAj;jSQXt%E@9:uAjȍe[^_UVSE] 1-uF+u@SPKu1 te[^USU] ]U=$|/$hj2t hmTZUWSh )Ãu =$~Sh#&0H=%$tSh#%;u?dlh hd%;hSMt&;:tjhS t hoe[_UWVSE}E t9(~-1҃=htA 1B9} 0Pu#19}9DB9|2LWV3EPSW CLmCLƉw(e[^_US]8h$jS+$]UVSu ]=$u$hShVuVt C(mC(@ e[^Uh$ju$Uh$u uy$U`WVSu1EHEU }L}E9E}uUH}9W~E}td}~^EHELB93Lu?} 1P@93Pu#E}~ˉJULG93Lt‹EX M7U ȿQщƋE )؉EyNQxFQȿӉEHؿ<ӉEH]NȿӋEX}X|51u!ؿduؿu94t mىM}ME)؍<Љ}EUJUMyMMEd)‰U܋EE܋U‰Uԍ{}M}KMЋEdE)ȉE̋E]̉]ȋE))Ƌ]ÔUZrEE9t WE } uf^ FFCFFYˀ9}t}uf^ M N~t tFNىN~ F-l~Ee[^_UW}}0HEEUUEEPu }Ujjuuu u/&LOCALDOMAINr/etc/resolv.confdomain searchnameserversortlistoptionsconfRES_OPTIONSenvU(WVSDžDžDžDž=h:u h:=l:u l:p:u p:f=:u df:|:y:5fz:t:;$ ;;hs >ÃhSh:Dž::::1҃ =:tT:sA< t;< t< u t1DžC;u <v Ct< uh h hr g<;t<#tjh o up< t< ubuC< t< tt< thSh:h h:LÃtDžIjh  < t<  C< t< t< hSh:j h:Ãt::::1Ҁ=:t@:s.< t< u  t1C;u; t Ct< uDžHj h  < t< u}tC< t< t< PSr|:Ƃy:5fz:jh > < t<  ^4C< t< t7< /<;'߄tTPhp u><;t8|4=vPzD5uC;uPWD;Rhp ftyЈC.=vPzD5uCt<;t}PWt; ;; }jh ^ < t< h PDx~ t:;$Ј;=:u:hSu"j.SÃtCPh:u:::hű >Ãt hѱ S p:1[^_;; res_setoptions("%s", "%s")... ndots:;; ndots=%d debug;; res_setoptions("%s", "%s").. ;; debug inet6UWVS}u p:VShθ  C< t< tjh S uYCP€;$Ј; ;p:;Ph tmjh S7 u0p:uVWh C p: h+ /(jh5 S u p: ; t Ct < u; e[^_UE|Ð%=tÐUjEP_ ‹E3E1%UEPuu ÐEUWVS]uu =wm11E 0u$C xtXuEE|4=wm1tU|p}ur|n=w m1tRэJ vRMD MzD5tAA C S.uE9Eu>uCt-сv R zD5t_Eu)Ɖ@wh$ ؼ м w(E:wEU"v11EU ЋU ǃ} tu e[^_UEU E EE EjjEPujEPt1Ð o Y B 0  z X H 9 ( ~ o c B 1  l U > $ x a =   r ^ K )  ѿ ¿ v d R > (  Inappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisc quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0P/rtr!rUWVSE} " Btp9u Bu@u1e[^_UVSuUt$] CAuJtAJuJue[^$Id: strncmp.S,v 1.3 1995/01/23 01:29:21 davidg Exp $SD$L$ T$@AJttm8ui@AJtpt^8uZ@AJtatO8uK@AJtRt@8u<@AJtCt18u-@AJt4t"8u@AJt%t8u@AJtt8t )[Ð1[$Id: strcpy.S,v 1.2 1995/01/23 01:29:17 davidg Exp $L$T$QtLBAtBBAt8BAt.BAt$BAtBAtBAuX$Id: strcmp.S,v 1.2 1995/01/23 01:29:14 davidg Exp $D$T$@BtX8 uT@BtL8 uH@Bt@8 u<@Bt48 u0@Bt(8 u$@Bt8 u@Bt8 u @Bt8 t)$Id: strchr.S,v 1.2 1995/01/23 01:29:12 davidg Exp $SD$L$ 8t@u1[$Id: strcat.S,v 1.2 1995/01/23 01:29:09 davidg Exp $W|$T$ W1OtLBAtBBAt8BAt.BAt$BAtBAtBAuX_Uj juAUE Puh{toUVSEPu ,ƃt(ÅthuuI } fC 1>fCfs [C$C, C(\C Et jjjSg؍e[^UWVSu U)1@))ZSWuM }MMNtkZu$RUHUtM9MuF1KZ:9vSj WUQ Uu)ZSWuU% ])ދUuMEe[^_/usr/bin:/bin:/usr/sbin:/sbin:UVS]u EUM;tuQRPVSR<t<#{u%t:v%t0jh Pi!t:w u 1S$ $ <  $ $ $ $ $ $ $ $ 0 < c wk, _SG;<e[^rUWVS}EGÉEu=vP胶zD5ƃuɀ-u E+uG}t}u!0uUxtXu _E}uE 0uEE}tEE1uUE1EˉM}wEmE E}t ӉUvR耵EMzL5M}ہvSCzD5E}téӉUM9}B}|9ur uE9~ EEuƊGӉU€}}}t<"}tރ} t]}t_M e[^_UE@( @, zz1UEU} utz@0ÐtH UMU E}tt tB tUWVS}=&u &EPu 5ƃt1jjW(à |ڃtE9t<1Dˬtfp Et ufH fx@@$@, @(\@ e[^_yrUUM RQjujh,US]SCt K]UUfB f f t1R:US]=D8uǬCfC uuDu< tSuc CCK 3S0t)C@9t RC0Ct!=<u=<u <}tauSu>‰ u <t"EPR蝮u}u }ujj# t'uuV+ƃ <}tEPt  z hVTVtu(>au FHwj h Ѓ9F@t O VV(Й~džQV ƒF F TDJNRj8PJ }t EP tRhVU*01҃}t tB4dž$j$׽ƒu<VXrB B B B D B B B "t1V$<1e[^_UVS]ts8Se[^UEu Ð@u<UdWVS]} uEC8CC C CCCC4 z hjCDPj@jPt'EPW ;EC P"Ctnt,P"KC =~ <QFtC4Ft FtEFt=t=uFCuSu1e[^_UVS]E H{4@}P"ADDDHK C$jP @PSt LVS0S(uC,K@C<Й{@P!9C}CPSG e[^UWVSu14jV{' t=<tF0HtvHuUVt u=<19~8t PC9㋆t PVu1 =<e[^_USE} t<9tX4t%jjSn& uSuǃ01]UWVSu4aFj h ҉F@SVBjjjW2 ut/hSWq t=t<Odž,O51ې8tjj^RQVYuC~1[^_UE@}uuu jPÐ<ǀ,UEMPt t<ǂ,u<ǂ,uu uPRdUE@}v<ǀ,Ðtju jP<ǀ,U WVSMq MIMM MjjuQu Pu EuAMM#MMIMY ME9MfKfMfv:)9EuuMy׋EuEf}u juaf}uuuuuQE^MMEPufju%PuEX MEMq M9M } wD} r>uuuu} tzr,} t} MaMYMfDKfwjuQuu_%؋MMKDK)‹MQbuuu~ u;uuuu>t6$uuuRt"$跸Ma Ma1e[^_UWVSE]pt*t%t <dž,$|udž$dž(dž 1 u^$9^(r4jjSVt xf?uCdž(9^(sω$9^(}dž$?x(f|_uA=C=A>CEA?A@EEA@EAAEABEAC1ҐDDEEDDEDEEDFEDGfQfEEQEQB~UWVSu1Lhhxt=tt  Džt|uDž|P,}uE,}uNLECDž|P,DžlDžhLUDžtE,DžxMt h$ͫÃh$jSӶǃEǃ|Eǃj$pƉsj$jVv L9t ^F FF , F FF!F| }tNM  tt uu uC) *E  jj EP蜙w}u }jEP谲 I6}b1u  EdgEfEeEdEE`cEbEaE`EE\_E^E]E\EEX[EZEYEXEETWEVEUETEEPSEREQEPE}b1}}=M_x EEexu0Ex=w Džxxv Džxhu  ǃǃ xltxIt!ȍD8lx 9lsllI1D1tffHffHw fǃDj2B  uSh h@ QBStVE t @U@t }} I< <Ot*Kt Q腧t QuSh18[^_UWVS}jj7Bƃ tjV=<<]S7"BƃtiS7BÃtX}uRCCfCfCC jVjV7[DjS7QD1e[^_TMPDIR/tmp%s/bt.XXXXXXUWVShU ^u\ Pha hS DžWPj蘯SB ƃ t S jWju[^_UEEt t ÐÐ1USEXCtjP3MCC u <]UWVSEXCtjP3BC }t<vEPu S6ƃ u V}uj63B;jPujjVS8ǃ!@tj63hBCe[^_UDWVSEU } uR`ыEEEAEAEAAEEAEAEAEAAEEAEA EA EA A EEA EA EAEAfAfEEAEAfAfEEAEAAA 1f9fDQfEEDQEDQDQEEEBEBEBEEEBEBEBtEEÈEˆBEBEBEEEBEBEBfFf9e[^_UDWVSEU } uRAA 1f9DYEEEBEBEBEEEBEBEBtE؊EۈEڈBEوBE؈BEԊE׈EֈBEՈBEԈBfDQfEҊEӈDQE҈DQfFf9E̊EψEΈAE͈AËAAEȊEˈAEʈAEɈAEȈAAEĊELjAEƈA EňA EĈA A EEÈA EˆA EAEAfAfEEAEAfAfEEAEAe[^_UEUUUPUPUPPUUPUPUPUPPUUPUP UP UP P UUP UP UPUPPUUPUPUPUPPUUPUPUPUPUWVS}wFtjP6;F jWt6;u FtPF FtP֝dždžtP话dždžV茝W膝S聥1҅tЍe[^_USEXCtjP3:C } t<B Ѓt1.tS)u 3;u ]UVSujj6z8à tUEb1EEEE UjEPSejS6':1e[^鯨\r鏨 rUXME ~8UfEfEMMHEERuEP?‹EÐUEPu2tUUS]jS1҅tډЋ]UdWVSu} @;tC;u 0K;XtKM9v?;/u/EPVfEf%f=@/K9wǐt8hh V |aӐ=<t'oEPVt=<%N]t@jS7 UUfUfU}ujjjFPPEPWuN1e[^_UVSu] Ct&jP6Xƒ t-CBjR6C Ct-jP6+ƒ u CBjR6 1e[^鏎rorOrU8WVS]fE fEM 9uSEPEPEPQu^SEPEPEPu uƅUfFf)fFfDVF0} }$MAM C}w7S) >MA}GM C}w7S_Mq1S} ?uVM }*uuWQ1,jV}7 {uuu uE,M9tzZ1ۅ*MM؋}}j3M1ƃ HfSfBfUG tFw t}GEM $E}GE܋M܋ $Eȋ}tgAua~ufvUMA$TʋE U}܋E }EPEPMЉEЃ $9EvE!EE V^)ڋEȃ9sTu >uuȍEPEPEPu uuȍEPEPEPu u"ƅE8CfUf9s%)PTVRR蛉 fFE}ԋG tbw tFUfFf+EfFfDV%0uuS/MԋC EfVf+UfVfTF0}u }܋MЉ }ԋM܊I CEЅu}܋PE܃ PS踈 MA q uA fEft%DF0EPTu3 }؋CUfFf+EfFfDV%0u MԋC}fEft%DF0EPT}GCUfFf+EfFfDV%0MAC W}} ?u7M }uuWQuuu u{tGju؋}7ju7juM1ju}71Nju؋M1juԋ}7juM1ju}7w譺e[^_UWVSEPu{ǃu 1REfGUfGM AGGQ W yu;M U B9u%BfGMfMU:MrzƃujWU21M FAFfFUfFI N U Bt5jPM1wà u Vz1[CjSU2V uuWVu uËMVu `$9u] VlzM U U:؍e[^_UWVS}EPWƃtEPWÃu1eEEFCCFfCfFffCfFU B C F uuSVRWU2Ue[^_UWVSu }UfffFfFF0G t G W.CfFffFfFF0UB t B uUCfFF $ F jVU21e[^_UWVS} UMfffGfGG8CG txMAƋ $EfGf+EfGfGG8C6F PSE Fthv uuUmMQʋ $EfGf+EfGfGG8uRSMC zfGG $ G jWM11e[^_U(WVSEUffU}fff}ff}fEfE1ɋU BfEf9ENf}f9}u]EU B t2w ttGtb} DGƋ} DGƋF ÀVUM} DGƻE/U DBƋÀE ;yf}f9}wEU9f9}t0fAU}fGf)fGfDWSVGPM4 Mf]fUf9Ur}t}tEfEf9MEE}fGUB(tG} 9Bu=fBf9Ewf@fBUf9Js}BfM믐U}Gf)OfUf9UwfE}} UU؋}f)fEf9Mf9Mu fEfEU B t.wtut;tNh} DGƋ JU DBƋF /} DGƻ&U DBƋÀ wfA}UfBf)fBfDzSVBPM fEMf9ME}fGfGfUf9UuffGE؍e[^_US]ju 3 tH jP31]UVSu11Ff9sDF0fBf9r؍e[^UWVSE} uXCtjP3C FwX$ "\"p"\"p"p"\"D"p"D"C(tVEPSƃ (VWEPS|ƃ<[uREPE0StjPuPWEPS:ƃ(!@tju3ECe[^_UWVSu} UEH$ #0#!$d#!$!$#d#!$#:tzu<EPWRVjS6ƒ tBt*B uB\jR6 ŐfGojR6^jS6 ƒ ^BtB uDB\jR6 BfHfG1e[^_UWVSu~F(tEPu FPVjv6, }t } tOF(uHf^fCA9YjQ6 tMjS6 tT1eF(tgU fGfBUf^fu>YjQ6 u0jS6z uAfKU fZ1e[^_UWVS]Su uE ;M  l}MOME}9tjPM1 MOM }fWfUMfyuq{}}9tjSM1 js}7 à u!M9jQ7f }SfWMfIQu u; 0U9t jS}7 M}9}yuMI}P9uJËsjSM1 u UG9utuu WuvuMfMUfJ ENfuftfNUMfpDG\8jW1 e[^_UWVS]u }jv3E u1MfEURuS tju3n 1#jV3^ UMSK e[^_UWVS]u }jv3E u1UPfJfUURuS tju3 1"jV3 UMSK e[^_UWVSE u@DB}Ct.FPVEPC PuMs} u }!@tR9Fs,u Pj PRkF3C P6.vMA }GK }Ct7EPuEP PuuP}M} u }!@tfC@M9As6u Pi PR%ku G}KAOs P}7_uCMAC}G É1e[^_UVS]EfxuzuB u 1B t@DB@u@DB@tH p uEt2PPEPQSt EEPu Ѝe[^UWVS}O} W9vы}7} 8t%)‰FCIu}G} +Ge[^_UWVS}W} G9v‹}} 8tCAFJu}G} 9Gv@e[^_U WVS} ]ujWEPsjGPEPsEEU9s1u Pg PSiusEMUU>juM1ƃ tċ]9]s]SFPWsjVU2E)؉Et ߋFE1e[^_UWVSE UU1M@EEPuÃu ECCC fCfCuU9vuVuCP\r tGjWM1 U)utMMgjSU21e[^_UVSu] jSEPqjSEPqju6ƒ$u UB tjR6|>쐐BERV;9]vju6Gƒ t)]ѐ1e[^UMU BBjR1UVS]u t+jP3ƒ tB V3e[^U`WVSURu cTufUfft<1uh(jÃt[1ɸTT A~u u1QRUԋMRQ[}u ؍e[^_USEU M] $]mpool_new: page allocation overflow. UVS]u uh0h,|5`gS:u1XAAAHTQ9RuJH YCA 9u CHKAe[^UWVS} u9w<1u uÃSJuL9uSQSPC9uK9IuYZK9Mu S }WS Q K 9Mu SuSQ}{WS u97u }WZu^KuÃU }1u}juu}*l9E9Uusj 9t<O} {CSJuLK9IuYZ}{WS u97u }WZu^tss$ҋCe[^_UE HUшH1US]>P9u @ C @ B P 9u @@BQa 9uSa1]UVSu9t%CtSVu[9u1҅tЍe[^UWVSu 99tzCuitSVCHL9uCACBSS9uC FC B S 9uCCB0[9uP`Åt{{1e[^_UWVS} tM qq$҃ ] S1ۉM]juupi9Eu,9Uu'] sg9uc1e[^_UM AU‹9t 9Ht9u1/l_rUVS] ]S^ƃtSVbe[^UEPu uv$Id: bzero.S,v 1.2 1995/01/23 01:28:52 davidg Exp $WS|$ L$1~ڃ)Ӊك[_US] {tSu:CC C1]UXWVS}fW fUfGfEGEċG,EԍEEEEEuu uVbà |VGtE@tO @؍[^_UVSUE]M t tStgy w I0svIо 10АI 0uw?Ed?EEEET>EE(BEEEEEpCEECEEEEEEEEEE>>w?w?d?`>>EEl>EA/BBx>EBEwCEEDC_ƅC S0DE][(,ۉ(0ƅC+ < 8<*u.E][$Dž$Dž82ɍT8<8<ڃЃ vȋ$yDž$j0HDžۍT8< 8<ʃЃ vȋ(00@00 P4E]SP00 t:E]K K}~ b0tEMI30@tEMIE][} ƅC- g$u Dž$$u Dž$0tE ]kݝEMAݝ t,ܝEuƅC-Dž49 7tDž490DR8HROR0$ R4 8gt 8Gu9H~9$}E8gue8 Dž8g8eEHJH8JRURD׃ n0tya8fu;H~%׃$u 0tN$|;B$4HD9|Nj0tG )zO5ƅC-)0 t!EMA,X0tEMQ,~0@tE]Sf,f XE]S, A00 tEMY YS0tE][30@tE][EMIE][Dž90߀0Dž8xEMI4u Dž49$|9$j4 t+49$u$j04ҍzN00 tEMY YS0tE][30@tE][EMI Dž9 Dž90 tEMY YP0tE][30@tE][EMI0t, t uut0ƅC$| 0]40 tO uu tq0RP4 $4>u t+0RP4,4+4z38 P48PƅC9}Ct0t0(+~Q0zFEUJMB~u- u0z^]UJMB~u3uCtCFEB0teƅ@0f8ff@f f@@FEUJMB~uPu0(+~P@zFEUJMB~u/u@z^]UJMB~uu)~Q@zFEUJMB~u-u@z^]UJMB~u3u0u4~}t8e݅D@D9H|0u99FEUJMB~u1uDK~R@zFEUJMB~u+u@z^]UJMcH9FEUZ]B~uSuHى~O@zFEUZ]B~uOu@zNMUZ]B~uu4DD94VUUZ]B~uJuH+D~R@zFEUZ]B~u?u@zNMUZ]B~uu0m9FE*4FEUZ]B~u8uH49FEUZ]B~uDu4D+HVUD04@C4ƅA.@FEUZ]B~uWu݅E@t'4DK^UJDUDK~Q@zFEUJMB~uu@z^]4FEUJMB~u\u]NMUZ]B~usu0(+~R0zFEUJMB~uu0z^]UJMB~uud(9~,}tuu/Eu}tURuVuE]C @t Dž,,[^_UWVSEMu fu etEuEEu-EPEPuuR$}mgtGu]tUUʃfu%90uE@t +]}}D@uU 0EE9r؋})ϋ]$;ȍe[^_U4WVSuU E} F-F+^ ~2Iп 0ƒ I09sAC9r 0C0C)[^_UWVS}M ysG tuW*^M M MMqMfG t]M MMqMtvPuwG,ЉÃ ])ދM A)؉AuM MMqMt_G t9sSu7N )_k9Gs)9v%SuPN WP,e<_9rSuwG,ЉÃ @Su77N )_])ދM A)؉AUEEu EM MMqMt}u/Vj uƒ tEH)‰U NMEE9s__9Ws%9~!SuRM WT+um8_9|SuwG,ЉÃ ~LSu7CM )_)]uW+u!E])ދM A)؉A1 O @e[^_UURUMRQU MRQ+EU$Id: isinf.c,v 1.3 1996/07/12 18:54:26 jkh Exp $U1fEf%f=uE u}tU1ҋE %=u }u$Id: memchr.S,v 1.5 1995/01/23 01:28:58 davidg Exp $W|$D$ L$uG_Ð1_USM&t &"PM?‹MJZBB Ћ]UUtB&B&U WVS}WU_EM ME U ȉEu9u|ƅtE9w2G@PËWK w PVQJ WMߋuUtBWe[^_UWVS]} uE E1Ҹ}~B9ER‰rB  ~% PCj Rƒ F9|C! PCj Rƒ F9uЍe[^_UU1uuuu|@@u ÐUMt't1Ðt 1fuuuuu @u ÉUS]jJX@]U8WVSMu F9A}MuAQU^]ډU9Q}@PMEǃUUM9s9}wM]]u܋UU؋]]9UUtT}uEEEUMуUfNf9}w][]tW}uEEVE]fFfGEЋM]9}wEEU9U&]Ut~%>uK]~ M}~>t]UZEe[^_UWVS} tj4LzuE th8'uhq8'tSuueu tuSS뿐Ee[^_UWVS] MqA@EA9E~ F9EVEǃ}19}MM@9|U}ЉEe t: +u 1ۋM ؋}}9UwމtE}}9Uw}OMyuQEe[^_UVSM] SA)u9q0\ 9t9s9w1e[^U,WVSu} WVƒu!jnE@MA}u}1vU3EUԉP ^]u M_]؉E}1M ы]))ىEEfWfM9Mr]9]s:MMfWf]9rM?tM]KEe[^_UE %~ MEO؉UE.E)ʉѺUEEUWVSEPU@tSǺ )M  5 ) ?E9usF1O ) r9us MEtH] )U ? ؉E9us^1ۋU ) ?]UUEe[^_UWVSjƍNME U%E t UEEt_EPEt$ +EUӉ EFMUEFE]CtVU*EPkEEFFEE tM]5)ˋM,]MM]t‹E)ЋMe[^_UVSu] EPV]EPS]U+UF+CЅ~ E )EEue[^@?5?55?5?UWVSEEEEEMM]+tt&-uEEM9uE]]B MЁvR# zT5tE두];0u'EC];0u EM90t]; MM1EE1Ft9HMʋtTЉUttGE]t/}ȃt.EM tuH0uEE]t0t鋕tσMM]]EtEttmMMĸ9})G]Ӊ] @9E؉GMtU tEE]tڃЃ jEtet tE'u}u }+]]EC] t+t-uEE]ttЃ t0uEM t0t싕tσtЉ]EEM t/~5t9)]ڋtTЉUE]t/΋U)ƒ }N~ ENMMԃ}t]E ]]u"} }MM])]ԋMԉt}u}ȉ}̃~EM1SQ,$U} ~] z1SQ,$]؃}}~Q}E] \z]j)P9UE)EE \zUM \z]7}|UE4\z]+Utttt E \z]tt4~#<"| |UMt1҃t~(tt E {]Bѽtt؁EE {]Uց|r|vEEPUtttt E4\z]tt1҃t~*tt E <{]BѽttEU <{UD@ujU <{UD@u;EE<">UMRQcE]EEuWuuE]stEK RSP: URURURURNEjE}|Džt1}ԉ}uމtE1U|)׉u؋]xUD=} ځ3 6)щ׉9~9E}E؅~)))E؃t~,tuEuuGu]~VuE}~uuE~Wu`E}~uuIEuu|Nj_ tG uW }>8}.E!jWuW\tt7Eu\}uVUEEu/}u)UсMEExtUUMRQmUE@>uW_uatteUu Et؃u }_:Eu _ __tuEÁ]UMUMEUMRQ}}mE]Em|v*؁}u }EEPEs}@wDÈ@s4_}M Mm$ZmR$tuUMRQ}} mE]mEƁ9uug}U UmUmetu }ut&_EtS_EtC_Et/u&uuW1uuuuW} t]M E}th[^_U$WVSE @E]9C} 1E EM]]؉E}]@E1uEEE]]E]É]E։]U)ЋU‰]u)ىEfOf]9]vE8u2}E9v8uME9}v];tE]Cu uLEEE}E E]]‹]É]։EU)ӋUډEu)]fOfE9Ev}]];u.]9v;uME9}vE8t]EXEe[^_InfinityNaN0?aCoc?`(?yPD?$@@@?UWVS]&t'&BrR1&} }e  U uQM'Em}uE uEm} tu~tUM E ED@u'؋u} t M mmq URUR$EE ׁt/UM UMU?UEcUU2 ~#@)Eu  )U1QR,$]EEmmmmmW $}U UmUmEuEE@tME}wM\z]EuIMEU)Z|E|ۉ]Dž|}|Euĉu|M)MىME} vEE}~ EEE}wu$pppq qq'qEEE?E}E}}ȉ} EUUčz}ЉUȅ&v&ۍS9r5&&EE}}1UUU UMĉMuЉuE~Oʃ\zt+E54{]Et E {GuE]0tEGmM]r؋MMUUUU uuċM̉MЃ}(}u\z}}:}4EE}xm]dqE}U Um$[mS $]ـ0uFu9}uhEUEt+D@u9ut( MM99tuFuEċM0mMUE@G4u܉uM؉MEE}tj}}t }3=6+}2]K9]| u)މu+]]]E}Ѕ})}1}|jE}~&|~}9|}|)})})|}~Q}t:}~)uu1Euucu]]+]tSuuEjE}~uuE}4}u'U utE|E E}t+MIut2| ) |B׃t )σ~ }}|}~uuE|~|uE}tEuuw}3Mjj uE }tjj uE uȉuЃ}W}~Q}|%jjuEPu؋MщM؋u1FuE}}~uuEMM}t?qEuv M RQP;( juE uu0EuuPuuƒz uRux)xREREu}uEu}9tl~NEI|uR}uLEuF~2juEuu uMt Eԃ}:tUԋu8~(}9uM9AMMu UԋMAM9}jj uE u9uujj VEE !jj u|Ejj umEGuum0EԊUԋMAM9}~jj u'E GƐjuEuuÃu=Mt5 M9MtMu>9tMAM,Eċu1FuMM90u Mu>0tEuv}t1}tM9Mt uWuL u4u9uu0FuEMMAu} tMu El[^_US]=D8ufC uAujt.S0tC@9t R4C0c CCK {uS6fC tCKىK 1ҨuSS1]UVS]C u#EPEPSiuuK CCCC9-l~΀CEC}tCPtf s e[^U`WVSu] }fVf|EPP}fEf%f= Eu-EFLfEf%f=u~(\uЍe[^_UWVS]CP…u1-B$ZBKxǾ<'XKyЍe[^_US=D8u|CSJxfx t%XJy;uj gtΐ1Qf@ @@@@@f@@0@4@D@H]USK|+|~t +C~P]Uh~GU-l~D8UEuh~ Ð@ u< ÐPUWVS}G tLwtE)7uGG/O @(GSVwG,Ѓ ~)ƅ1e[^_UWVSu}19] ~7)MuMD^Mf ‹MfMC9] ^f^e[^_UlWVSu} }u7}u1|U1uEԉE؃}5M1y(9}wu%9uv }tU2zMMЍUU̍M܉Mȉuԉ}fEUUfMfMfUfUMMfUfUfMfMUUԋUU؋MMfUfUfMfMUUfMfMfUfUEf}EM}XMA1fEuI 1։uMI 1MI 1Ӄ}t1ɉUMMUUQfM щM؉Ef8S+MMUfzuMEMfyt+ux UfrNy+MUȍJUEMYwEہv}~&uUURuGuUJRŨR3EUfRfUʉMURUMЉMUfMUfDJftJf9]u *% 1uӉNjE 9v!O]wU׉ 9w1ۋu~;EUBM q))ډӋUfB])NȋU)ډӋMf]tAO1ۋu~1UUM QUrȉEËMUfJNыMfUMf$܇Љ؈ЉЉЉЉЉЉЉЉ Љ`ЉЉЉЉЉЉЉ@ЉЉ|ЉЉĉЉЉЉЉЉЉЉЉЉЉЉЉЉPЉЉЉЉЉЉЉ0ЉЉpЉЉ%|-|---------{-o-c-W-K-?-3-'--hEhE-CFb=-t#EEEj EP=-t -=-t -jjjhjhjK|-u h: j. t--=|u |%| jH-l-e[^_UWVSEEÁ1 -t:A9r-uqtABQMq<3y)Y u uSƃtW + t-|-9sE }B9r=-t PhV }t=-u}=- u e[^_U WVSEwEHEu|-M<GhE'ME9~$uƃuu1uMfFfMfN MfF fFMN~1ۃv2D )؃wك DC9|9vu<1ۃ}~4M琐ك!DfN fN)}C}ًE +t-|-4M4u1|-M4~~u?t1ۋu Ct1fF fIfN fu|-MG)N =-tFPhFPPF؍e[^_allocation failed. UVSu=-tN 9s1wVVÃ=-tu h6=-t t VjS؍e[^junk pointer, too low to make sense. junk pointer, too high to make sense. modified (page-) pointer. modified (chunk-) pointer. chunk is already free. pointer to wrong page. UWVS} =-t E +t- w h9x-s h|-uUMt h8t=-99vEv_sFEthQE%K Dth%=-u%9s!9wu듐h419Wƃt&tt9sSWuV. u[e[^_page is already free. freelist is destroyed. malloc() has never been called. UWVS}=l-uhސ.=-E +t- wh9x-sh~|-4NEuhPth49Mth@<u@B<t =-tVhu5 =-tjVu> }}=-uj--MH}x p-u@--ӋM9K st Ë}9{ rC9Es-SPCPfM9K u8K stpB9C ucUB C }{MtKXA9Eu s}{1;u-X-hƐn;uz|9Cvp-9C ufjc9-uT|KK Cs P C -C +t-p5x-ƒ9w|-B9v}'uE%V ~}HEthUЃ}|th*=-tuhu M Lf~ f}fGf~ V |-fEf@fu3t$:tNM萐}9xs Ӆtƒ:u3Ff9Fu?93t93uF +t-|-^9t VSe[^_ in malloc():recursive call. out of memory. U VSu-p-=p-th p-1n=l-u=-t u1 VÃ=-tEu]j EP\ p-=-tu h؍e[^ in free():U S]-Օp-=p-t hC/S=-t]EEj EP p-] in realloc():U WVSu} -Mp-=p-th p-1t=l-uhސ1=l-u=-tu V'1ۃ uW2ÃWVQÃ=-tu}]j EP p-=-tu ho؍e[^_UWVS}ty=<un+<U ZM9t 9=tA9u+MM=<1M]tUt AF8uKuuF<=t7u1e[^_U WVS}ty=<un+<E\M9t 9=tA9u+MM=<1M]tUt AF8uKuuF<=t7u1e[^_US-tEj]SjjPjj$jSj(jPjCUWVS]uu SR|ƉSPKTfc e[^_US]C tjjjCPfc uu CP]US]uUM RQSRxuu fc fK CPST]UE@P8UWVS1ҿ|t0w_Kx!f~ tVUMыU ƒXKy?uЉЍe[^_Uu ht,@uU,WVUE ut} Mu$tt *t!Vht,Vht,Vht,RD<e^_UE EEPhvtu UEPhwt@u|EøUE@(UE@$UUE B(1UUE B$1UUE B(B$1UE`` a_P P@ @!US]EEjh{t S; t'EPjjjjjhzt St1]Ujh^t uUE tt -t%E/E#E<ÐEPhtuU0VSu] tt d_jhot jhnt VCPEPV~t8uEEEjjjut RP u 1e[^_UWVSu]}tgw;ujK jPpdžjEPC M QTPCt#PPGPCPV{u=j!@tk@9s?uP PRu ? A3CPG G1e[^_UWVS}w,EEju7`ƒ B tWfE f+EfG G)1BfEDBfAf9MtE9E rEސu0fNfp[]}t r}t([DB jDBjjR7螀 &5<u}tiG,9trZ1ۅtFj37S~ƒ t2}uCDB CDBjR7" 뙐u5<1e[^_UWVS}fӋM AftWf)P1P fCf4GMAf)P1PfCf4GfEf)fLGftGe[^_UWVS] s>}]f|^wu u=}t }fD~]fC }f|~f}f)fEEH9EtrLF] [U)PSR:U9U|D Vf|VuffDVfDVfDVf}f9f|Vf]f\Vf\V9U}f]f\F}f~fEfD~ffD~f}ff>]K8} O1e[^_UUT@PUI ]uVUT@UUUjӉ]uuF]u]uuuuut'uWuXt}܅t9Et<Ouf}u.Mf9u%f]f[ ff_uV fWMy}tRY ]E9]UUUuTUTUTFuM9|Y]ffUUUSUE9U-E܃ffUUUuM܈TqFu]9~1e[^_U WVSMI MuuV}}My}tKY E9]}uE UUUu} TUTUTFu9|>M ZE9]'E ffUUUu} TwFu9~܃}t.]MY<}tUBR<ڋuT@LEU uV<\}}tP;T@Uj։u}}Gu}u}uuuut'uu ut9Eu1<Oe[^_UWVSUr ǃtkMuNFSjWUB )PhSE\f] UMfQ81e[^_UM1t@vHASH: Out of overflow pages. Increase page size U$WVSUR UMLDIM}_}}UR H#EEMq$u9}8}uVuE9uu UUMI HE9uu*} HUZ$!ÉyCE'1EM}"AM 9]}F9uTUMDDA$DDx|DXt+\@~8E}~j1hjMUMQ x@|DH@UR H9EufE}ujE Pu{M}DDC~RAMtUMQ x@|DH@1+EE}u)ֿU Z uuEEEGEE}Eu M9r EwPu u tFf@fE܃}t@}t>u M9v0%PSQ ujSM16_fE܋G$ECsu)U9s.EPuuWjSu[?MEf9EsE)RDCPP fCUfCf+EfCfDSC؋WM@w7Pu jS6Z^1e[^_}  "`$5L0itu  @4`7BMPN`q0P````@ ztUnYk@ep_YOJP C0;525-p&ppPpХ8p  %]?U?Q?G?=?5?,?$??? ??>>>>>>>>>>>>>:D1D+D%D DDD D D C CtDmDeD[DRDKDBD0123456789MP MPMHRLPLQ@@L(QLDQLTQLpQ LQ@@LQR QQ Q QQQQ Q Q QQQQQ    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. @(#)df.c 8.7 (Berkeley) 4/2/94ii:@iiii iii|iuiqi gi@ai@Zi@Ui@Pi@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. @(#)echo.c 8.1 (Berkeley) 5/31/93u}@ 0p)+H@(#)cmp.c 8.1 (Berkeley) 5/31/93@(#)stat_flags.c 8.1 (Berkeley) 5/31/93@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. @(#)ls.c 8.5 (Berkeley) 4/2/94P. @(#)print.c 8.4 (Berkeley) 4/17/94@(#)util.c 8.3 (Berkeley) 4/2/94w8s8o8k8g8_8X8P8I8D8>8 48 ,8 (8 $8 88;;;L;D;;L;?x?m?a?U?I?=? 1? %? ? ? ??>>>>>>>>@(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. @(#)rm.c 8.5 (Berkeley) 4/18/94@(#)stat_flags.c 8.1 (Berkeley) 5/31/93/) %!    އ ه҇C=7@(#)key.c 8.3 (Berkeley) 4/2/94hla\TM<I>6,/`+Б($Б< Б51-)"   #3ڒ#Ӓ3Β2Ȓ3’3#@@@@}tlc[RJA:2 ݓדГɓ  @@~wphb[SJB 9 ~wnd^WQJC;3* @@ޔ@Ք@͔ Ĕ   @y@rjc [ WC$RCKC$CC8,#̕ŕ@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. @(#)chown.c 8.8 (Berkeley) 4/4/94@(#) Copyright (c) 1990, 1993 The Regents of the University of California. All rights reserved. @(#)clri.c 8.2 (Berkeley) 9/23/93@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. @(#)disklabel.c 8.2 (Berkeley) 1/7/94{vnid^XRKD@/tmp/EdDk.aXXXXXX@(#)dkcksum.c 8.1 (Berkeley) 6/5/93@(#)itime.c 8.1 (Berkeley) 6/5/93@(#) Copyright (c) 1980, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. @(#)main.c 8.6 (Berkeley) 5/1/95 @(#)optr.c 8.2 (Berkeley) 1/6/94@(#)dumprmt.c 8.3 (Berkeley) 4/28/95@(#)tape.c 8.4 (Berkeley) 5/1/95@(#)traverse.c 8.7 (Berkeley) 6/15/95@(#)unctime.c 8.2 (Berkeley) 6/14/94JanFebMarAprMayJunJulAugSepOctNovDecXVYYY3м|}Uu|. tMissing operating systemError loading operating systemInvalid partition tableAuthor - Siegmar Schmidt\w\d\N\2\%\ \[[ [ [ x[s[@i[Pf[Qf[RL[VI[aC[c[d[eZuZZZZZZyZcZ[ZRZ:Z(ZZC[C[C[C[YC[Y0`@(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. @(#)mount.c 8.19 (Berkeley) 4/19/94|wqje`YRNGA;40@آҢˢĢ  A@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. @(#)mount_ufs.c 8.2 (Berkeley) 3/27/94FC=84/*# @ @(#)getmntopts.c 8.1 (Berkeley) 3/27/94@(#)dkcksum.c 8.1 (Berkeley) 6/5/93@(#)getmntopts.c 8.1 (Berkeley) 3/27/94@(#)newfs.c 8.8 (Berkeley) 4/18/94@(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. |vqmhc\V P@ @%s: can't read disk label; disk type must be specified@(#)mkfs.c 8.3 (Berkeley) 2/3/94......8.dA@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. @(#)reboot.c 8.1 (Berkeley) 6/5/93@(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. @(#)main.c 8.2 (Berkeley) 1/7/94@(#)interactive.c 8.1 (Berkeley) 6/5/93@(#)restore.c 8.1 (Berkeley) 6/5/93@(#)dirs.c 8.2 (Berkeley) 1/21/94##.@(#)symtab.c 8.1 (Berkeley) 6/5/93@(#)tape.c 8.3 (Berkeley) 4/1/94@(#)utilities.c 8.2 (Berkeley) 3/25/94@(#)dumprmt.c 8.3 (Berkeley) 4/28/95@(#) Copyright (c) 1980, 1993 The Regents of the University of California. All rights reserved. @(#)swapon.c 8.1 (Berkeley) 6/5/93@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. @(#)umount.c 8.3 (Berkeley) 2/20/94}vokd^XQM @(#)getmntopts.c 8.1 (Berkeley) 3/27/94@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved.   @(#)getmntopts.c 8.1 (Berkeley) 3/27/94@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved.  ~ u@ne_ZVP J@  '@(#)getmntopts.c 8.1 (Berkeley) 3/27/94@(#)cmds.c 8.5 (Berkeley) 4/6/94^&$$ rq@(#)cmdtab.c 8.3 (Berkeley) 4/2/94send account command to remote serverappend to a fileset ascii transfer typebeep when command completedset binary transfer typetoggle mget upper/lower case id mappingchange remote working directorychange remote working directory to parent directorychange file permissions of remote fileconnect to remote tftptoggle carriage return stripping on ascii getsdelete remote filetoggle/set debugging modelist contents of remote directoryterminate ftp sessionexecute macroset file transfer formattoggle metacharacter expansion of local file namestoggle printing `#' for each buffer transferredprint local help informationget (set) idle timer on remote sidechange local working directorylist contents of remote directorydefine a macrodelete multiple fileslist contents of multiple remote directoriesget multiple filesmake directory on the remote machinelist contents of multiple remote directoriesshow last modification time of remote fileset file transfer modesend multiple filesget file if remote file is newer than local file nlist contents of remote directoryset templates for default file name mappingset translation table for default file name mappingenter passive transfer modetoggle use of PORT cmd for each data connectionforce interactive prompting on multiple commandsissue command on alternate connectionprint working directory on remote machineterminate ftp session and exitsend arbitrary ftp commandreceive fileget file restarting at end of local fileget help from remote serverrename filerestart file transfer at bytecounttoggle restriction of data port rangeremove directory on the remote machineshow status of remote machinetoggle store unique for local filesclear queued command repliessend one filesend site specific command to remote server Try "rhelp site" or "site help" for more informationescape to the shellshow size of remote fileshow current statusset file transfer structuretoggle store unique on remote machineshow remote system typeset tenex file transfer typetoggle packet tracingset file transfer typeget (set) umask on remote sidesend new user informationtoggle verbose mode7V295V,D-V*D&V* V +V"+t/V>+xV@0B VW+LGV+2V+NU+AU,0CU,GU@,t4US,1Um,7U,0CU,0U+0Uz0L"U,h1U, 0U/-\UL-dBU>+xUp-3U-7U-OU-4U- 8U.t'U.>U;. 8U.zUh.SuU.xoU.PTjU/8IdU.7]U?/GXU+0QU/$1IUs/QCU/E:U/06U12U0`=-U@0B'U_0?"Uz0L"U00"UH1SU0BU046U1@T0NT0Tf1MT1T1@T,2RTE2\-TY2tT2OTu2hMT2T2/T2hT3;T2BT630T/-\J@(#)ftp.c 8.4 (Berkeley) 4/6/94@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. @(#)main.c 8.4 (Berkeley) 4/3/94@(#)ruserpass.c 8.3 (Berkeley) 4/2/94ߘט И@(#)domacro.c 8.3 (Berkeley) 4/2/94@(#)ch.c 8.1 (Berkeley) 6/6/9399@(#)command.c 8.1 (Berkeley) 6/6/93@(#)decode.c 8.1 (Berkeley) 6/6/93 j kd  u f  bRr gp%G 0123456789=/ ?nm'EN:nP:pvhq:q:t:aZZ:(@(#)help.c 8.1 (Berkeley) 6/6/93@(#)input.c 8.1 (Berkeley) 6/6/93@(#)line.c 8.1 (Berkeley) 6/6/93@(#)linenum.c 8.1 (Berkeley) 6/6/93@(#) Copyright (c) 1988 Mark Nudleman. @(#) Copyright (c) 1988, 1993 Regents of the University of California. All rights reserved. @(#)main.c 8.1 (Berkeley) 6/7/93 @(#)os.c 8.1 (Berkeley) 6/6/93 is a directory@(#)output.c 8.1 (Berkeley) 6/6/93 (press RETURN)... (interrupt to abort)@(#)position.c 8.1 (Berkeley) 6/6/93@(#)prim.c 8.1 (Berkeley) 6/6/93@(#)screen.c 8.2 (Berkeley) 4/20/94@(#)signal.c 8.1 (Berkeley) 6/6/93@(#)tags.c 8.1 (Berkeley) 6/6/93@(#)ttyin.c 8.1 (Berkeley) 6/6/93$Id: rsh.c,v 1.8.2.3 1997/09/15 10:19:51 jkh Exp ${}abcdDgGhHilnNpPqrs tw xy !:#=48@(#)authenc.c 8.1 (Berkeley) 6/6/93@(#)commands.c 8.2 (Berkeley) 12/15/93z=a=]=A===+=%="===<<<A<<<<~<t<o<k<P<L<0<*<< <;;;;;d;|;z;e;D`;D];AX;AS; BN;$BMMXN_MUMMLLLPNLLLFzLaLGWL@LI;LLEl0 LKH0KKKDp0fKdK>^KTK$ETN5K-KJ$(JJJ40\JTJ*JJ JIt0Iz;M`;MSmSx0<=S,(6SSSR`PdK>dKRRRKDt<gRDDbR>RED;#RdKQQQ?DQQADQyQJD <TQFDLQ*QBD QP@DPPHDPPIDPP=DPP=D]=}PNDM]5]tZ> ]]\@Z>\>>>\\~\L[x\L[r\Z\\[U\<\L[6\L[0\\\[ \[L[[L[[\\[[[L[[L[[[\[`;][Z>>z;k[].ffeeee`;8fz;k[8fhhlhlhLm.f:hm1hgmgg0nggn`;hz;k[hconnect to a siteclose current connectionforcibly logout remote user and close the connectionexit telnetprint status informationprint help informationtransmit special characters ('send ?' for more)set operating parameters ('set ?' for more)unset operating parameters ('unset ?' for more)toggle operating parameters ('toggle ?' for more)change state of special charaters ('slc ?' for more)display operating parameterssuspend telnetcompute response to s/key challengeinvoke a subshellchange environment variables ('environ ?' for more)try to enter line or character mode ('mode ?' for more)*zHd#zHez'J\_zJ`^lrH`szH`sbRHheg4It? zdI`UzITXqIDpzIOyI0gyDJ c79wJcyJjz;I}ySJ8deprecated command -- use 'toggle crmod' insteaddeprecated command -- use 'set escape' instead`;}<YLa L(Lb@(#) Copyright (c) 1988, 1990, 1993 The Regents of the University of California. All rights reserved. @(#)main.c 8.2 (Berkeley) 12/15/93@(#)network.c 8.2 (Berkeley) 12/15/93@(#)ring.c 8.1 (Berkeley) 6/6/93@(#)sys_bsd.c 8.2 (Berkeley) 12/15/93@(#)telnet.c 8.2 (Berkeley) 12/15/93Ȟ""""@(#)terminal.c 8.1 (Berkeley) 6/6/93@(#)tn3270.c 8.1 (Berkeley) 6/6/93@(#)utilities.c 8.2 (Berkeley) 12/15/93MHD2-& vh]NG;3.'!}wqkfb^YT(standard output)~}zvrnjfb]XSNIC=70\^:   }) 0/dev/ptyXXN@(#)find.c 8.3 (Berkeley) 4/1/94@(#)function.c 8.6 (Berkeley) 4/1/94@(#)ls.c 8.1 (Berkeley) 6/6/93@(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. @(#)main.c 8.3 (Berkeley) 4/16/94@(#)misc.c 8.2 (Berkeley) 4/1/94@(#)operator.c 8.1 (Berkeley) 6/6/93@(#)option.c 8.2 (Berkeley) 4/16/94+ "  <  l  D t GNU grep version 2.0?!T V Y T V Y T V Y T W Y T W Y S W Y S [ l\ S [ l\ @(#)genget.c 8.1 (Berkeley) 6/4/93@(#)logwtmp.c 8.1 (Berkeley) 6/4/93$Id: w_sqrt.c,v 1.2 1995/05/30 05:51:46 rgrimes Exp $` $Id: e_sqrt.c,v 1.2.6.1 1997/02/23 11:03:09 joerg Exp $@(#)standout.c 8.2 (Berkeley) 5/4/94@(#)insertln.c 8.2 (Berkeley) 5/4/94@(#)initscr.c 8.2 (Berkeley) 5/4/94@(#)idlok.c 8.2 (Berkeley) 5/4/94@(#)delwin.c 8.2 (Berkeley) 5/4/94@(#)clrtobot.c 8.2 (Berkeley) 5/4/94@(#)addnstr.c 8.2 (Berkeley) 5/4/94@(#)addch.c 8.2 (Berkeley) 5/4/94@(#)addbytes.c 8.4 (Berkeley) 5/4/94 @(#)setterm.c 8.7 (Berkeley) 7/27/9498990988898 988\8H888p89<98H9P99$988 9(949@99T9x9|9h9t99999\9d9888L98888,989X98888\j8888|8X8t8`888l8T8P8h8L8x8`9l9H:D:d8\:<<@8<8@(#)scroll.c 8.3 (Berkeley) 5/4/94@(#)move.c 8.2 (Berkeley) 5/4/94@(#)longname.c 8.1 (Berkeley) 6/4/93@(#)deleteln.c 8.2 (Berkeley) 5/4/94@(#)clrtoeol.c 8.2 (Berkeley) 5/4/94@(#)id_subwins.c 8.2 (Berkeley) 5/4/94@(#)tty.c 8.4 (Berkeley) 5/18/94@(#)tstp.c 8.3 (Berkeley) 5/4/94@(#)refresh.c 8.4 (Berkeley) 8/4/94 @(#)newwin.c 8.3 (Berkeley) 7/27/94@(#)erase.c 8.2 (Berkeley) 5/4/94@(#)curses.c 8.3 (Berkeley) 5/4/940 @(#)cur_hash.c 8.1 (Berkeley) 6/4/93@(#)cr_put.c 8.3 (Berkeley) 5/4/94@(#)tscroll.c 8.4 (Berkeley) 7/27/94@(#)touchwin.c 8.2 (Berkeley) 5/4/94@(#)putchar.c 8.2 (Berkeley) 5/4/94@(#)tputs.c 8.1 (Berkeley) 6/4/935MS7) @(#)tgoto.c 8.1 (Berkeley) 6/4/93@(#)termcap.c 8.1 (Berkeley) 6/4/93K%  `   X,nK2a F * Ѯ w R .   @(#)kvm.c 8.2 (Berkeley) 2/13/94@(#)kvm_hp300.c 8.1 (Berkeley) 6/4/93?     ! ! ! ! ! ! ! ! ! ! r! b! \! L! A! p" q" P`4 4 4 5 d6 @(#) Copyright (c) 1994 Powerdog Industries. All rights reserved.@(#)strptime.c 0.1 (Powerdog) 94/03/27?9㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sž(aaaa[    ޓ ѓ   q e H = !  ޒ Ԓ | q M C - "  ӑ ґ      y s m g `     ~ z t q g d ` ] U R E B 8 5 % "                  ޗ ۗ ח ԗ m × ! " # $ % &z 'i (W )N *D +> ,7 -* -# . . / / 0 1 2 3 4 5 6 7ޖ 8ٖ 9Ӗ :ɖ ; < = > ? @l [b \R \= ]2 ^ ^ _ _ ` { {ӕ |Ǖ } } ~ +   \ Q H < 1 ) CCCCCC/dev/  @(#)getbsize.c 8.1 (Berkeley) 6/4/93$I I I I I I I H H H H H I I {I qI hI aI RI KI EI >I $I 9I 1I ,I C  <  ڵ ӵ ε ʵ õ       | < \ $      j [ 9    i P 4       | d I (  0 < D $Id: yp.x,v 1.5 1996/02/26 02:22:53 wpaul Exp $% @& & ' t' ' <( ( + + ,, d, , , , + P- -  d'@Bʚ;Ev z y y y y y y y y y y y y y y y Jz Bz 9z 0z )z !z y y y z z z z z z z Unknown error: @(#)localtime.c 7.57WILDABBRmm@(#)asctime.c 7.7RuneMaginone  BBBBB@(((((((((((((((          (((((((    ((((((    ((((  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~mL 0000000000000000}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMD7yACnF?O8M20HwZ&2 exit 64 # EX_USAGE } # # Prepend a hyphen to the first arg if necessary, so the traditional form # ``tar xvf /dev/foobar'' will work, too. More kludgy legacy forms are not # supported however. # if [ $# -lt 1 ] ; then usage fi case "$1" in -*) break ;; *) tmp="$1" shift set -- -$tmp "$@" ;; esac while getopts "ctxvb:f:" option do case $option in [ctx]) if [ $mode = "none" ] ; then mode=$option else usage fi ;; v) verbose="-v" ;; b) blocksize="${OPTARG}" ;; f) archive="${OPTARG## }" ;; *) usage ;; esac done shift $(($OPTIND - 1)) if [ "X${archive}" != "X-" ] ; then device="-F ${archive}" # else: use stdin or stdout, which is the default for cpio fi case $mode in none) usage ;; t) exec cpio -it $verbose $device --block-size="$blocksize" "$@" ;; x) exec cpio -idmu $verbose $device --block-size="$blocksize" "$@" ;; c) if [ $# -eq 0 ] ; then # use current dir -- slightly bogus set -- "." fi find "$@" -print |\ cpio -o -H ustar $verbose $device --block-size="$blocksize" exit $? ;; esac . .../ . ..0 protocols1group2spwd.db3services$wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: news:*:8: man:*:9: games:*:13: staff:*:20:root guest:*:31:root uucp:*:66: xten:*:67:xten dialer:*:68: network:*:69: nogroup:*:65533: nobody:*:65534: 4 ...5 ...6 ...7 ...8 ...9 ...: . ..;share>mdeca  #n}jfnobody*Unprivileged user/nonexistent/nonexistent3pop*DPost Office Owner/nonexistent/nonexistent1popxten*CCX-10 daemon/usr/local/xten/nonexistent1xtengames* Games pseudo-user/usr/games/nonexistent2news*News Subsystem//nonexistent2faman* Mister Man Pages/usr/share/man/nonexistent2games* Games pseudo-user/usr/games/nonexistent3bin*Binaries Commands and Source,,,//nonexistent1binOJuucp*BBUUCP pseudo-user/var/spool/uucppublic/usr/libexec/uucp/uucico2 news*News Subsystem//nonexistent3rootCharlie &/root/bin/csh3rootCharlie &/root/bin/csh2 lgjnobody*Unprivileged user/nonexistent/nonexistent1nobodyxten*CCX-10 daemon/usr/local/xten/nonexistent2 man* Mister Man Pages/usr/share/man/nonexistent3 daemon*Owner of many system processes/root/nonexistent3toor*Bourne-again Superuser/root21,B> I  I pop*DPost Office Owner/nonexistent/nonexistent2 uucp*BBUUCP pseudo-user/var/spool/uucppublic/usr/libexec/uucp/uucico3Bman* Mister Man Pages/usr/share/man/nonexistent1manoperator*System &/usr/guest/operator/bin/csh3operator*System &/usr/guest/operator/bin/csh1operatordaemon*Owner of many system processes/root/nonexistent2daemon*Owner of many system processes/root/nonexistent1daemontoor*Bourne-again Superuser/root1toorrootCharlie &/root/bin/csh1rootf`yt/* nobody*Unprivileged user/nonexistent/nonexistent2 xten*CCX-10 daemon/usr/local/xten/nonexistent3Cuucp*BBUUCP pseudo-user/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpnews*News Subsystem//nonexistent1newsgames* Games pseudo-user/usr/games/nonexistent1gamesbin*Binaries Commands and Source,,,//nonexistent3operator*System &/usr/guest/operator/bin/csh2eWepop*DPost Office Owner/nonexistent/nonexistent3Dbin*Binaries Commands and Source,,,//nonexistent2# # Network services, Internet style # # Stripped-down version. # # $Id: fixit.services,v 1.1 1996/11/09 16:25:32 joerg Exp $ # # WELL KNOWN PORT NUMBERS # echo 7/tcp echo 7/udp discard 9/tcp sink null discard 9/udp sink null systat 11/tcp users #Active Users systat 11/udp users #Active Users daytime 13/tcp daytime 13/udp chargen 19/tcp ttytst source #Character Generator chargen 19/udp ttytst source #Character Generator ftp-data 20/tcp #File Transfer [Default Data] ftp-data 20/udp #File Transfer [Default Data] ftp 21/tcp #File Transfer [Control] ftp 21/udp #File Transfer [Control] ssh 22/tcp #Secure Shell Login ssh 22/udp #Secure Shell Login telnet 23/tcp telnet 23/udp # 24/tcp any private mail system # 24/udp any private mail system smtp 25/tcp mail #Simple Mail Transfer smtp 25/udp mail #Simple Mail Transfer time 37/tcp timserver time 37/udp timserver domain 53/tcp #Domain Name Server domain 53/udp #Domain Name Server bootps 67/tcp dhcps #Bootstrap Protocol Server bootps 67/udp dhcps #Bootstrap Protocol Server bootpc 68/tcp dhcpc #Bootstrap Protocol Client bootpc 68/udp dhcpc #Bootstrap Protocol Client tftp 69/tcp #Trivial File Transfer tftp 69/udp #Trivial File Transfer gopher 70/tcp gopher 70/udp finger 79/tcp finger 79/udp http 80/tcp www www-http #World Wide Web HTTP http 80/udp www www-http #World Wide Web HTTP sunrpc 111/tcp rpcbind #SUN Remote Procedure Call sunrpc 111/udp rpcbind #SUN Remote Procedure Call auth 113/tcp ident tap #Authentication Service auth 113/udp ident tap #Authentication Service nntp 119/tcp usenet #Network News Transfer Protocol nntp 119/udp usenet #Network News Transfer Protocol rmt 411/tcp #Remote MT Protocol rmt 411/udp #Remote MT Protocol https 443/tcp https 443/udp # # Berkeley-specific services # exec 512/tcp #remote process execution; # authentication performed using # passwords and UNIX loppgin names biff 512/udp comsat #used by mail system to notify users # of new mail received; currently # receives messages only from # processes on the same machine login 513/tcp #remote login a la telnet; # automatic authentication performed # based on priviledged port numbers # and distributed data bases which # identify "authentication domains" who 513/udp whod #maintains data bases showing who's # logged in to machines on a local # net and the load average of the # machine cmd 514/tcp shell #like exec, but automatic # authentication is performed as for # login server syslog 514/udp printer 515/tcp spooler printer 515/udp spooler talk 517/tcp #like tenex link, but across # machine - unfortunately, doesn't # use link protocol (this is actually # just a rendezvous port from which a # tcp connection is established) talk 517/udp #like tenex link, but across # machine - unfortunately, doesn't # use link protocol (this is actually # just a rendezvous port from which a # tcp connection is established) ntalk 518/tcp ntalk 518/udp utime 519/tcp unixtime utime 519/udp unixtime efs 520/tcp #extended file name server router 520/udp route routed #local routing process (on site); # uses variant of Xerox NS routing # information protocol uucp 540/tcp uucpd uucp 540/udp uucpd uucp-rlogin 541/tcp uucp-rlogin 541/udp klogin 543/tcp # Kerberos (v4/v5) klogin 543/udp # Kerberos (v4/v5) kshell 544/tcp krcmd # Kerberos (v4/v5) kshell 544/udp krcmd # Kerberos (v4/v5) ; .: ..<misc< .; ..= scsi_modesbe Offset Count} i1 {Reserved} *i1 {Write Retry Count} i1 {Reserved} *i1 {Recovery Time Limit} i2 } # Rigid Disk Drive Geometry Page 0x04 { {Number of Cylinders} i3 {Number of Heads} i1 {Starting Cylinder-Write Precompensation} i3 {Starting Cylinder-Reduced Write Current} i3 {Drive Step Rate} i2 {Landing Zone Cylinder} i3 {Reserved} *t6 {RPL} t2 {Rotational Offset} i1 {Reserved} *i1 {Medium Rotation Rate} i2 {Reserved} *i1 {Reserved} *i1 } # Verify Error Recovery Page 0x07 { {Reserved} *t4 {EER} t1 {PER} t1 {DTE} t1 {DCR} t1 {Verify Retry Count} i1 {Verify Correction Span} i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Verify Recovery Time Limit} i2 } # CD-ROM Audio Control Parameters Page 0x0E { {Reserved} *t5 {Immed} t1 {SOTC} t1 {Reserved} *t1 {Reserved} *i2 {APRVal} t1 {Reserved} *t3 {Format of LBAs / sec.} t4 {Logical Blocks per Second of Audio Playback} i2 {Reserved} *t4 {Output Port 0 Channel Selection} t4 {Output Port 0 Volume} i1 {Reserved} *t4 {Output Port 1 Channel Selection} t4 {Output Port 1 Volume} i1 {Reserved} *t4 {Output Port 2 Channel Selection} t4 {Output Port 2 Volume} i1 {Reserved} *t4 {Output Port 3 Channel Selection} t4 {Output Port 3 Volume} i1 } 0x10 { {Reserved} *t1 {Change Active Partition} t1 {Change Active Format} t1 {Active Format} t5 {Active Partition} i1 {Write Buffer Full Ratio} i1 {Write Buffer Empty Ratio} i1 {Write Delay Time} i2 {Data Buffer Recovery} t1 {Block Identifiers Support} t1 {Report Setmarks} t1 {AAutomatic Velocity Control} t1 {Stop on Consecutive Filemarks} t2 {Recover Buffer Order} t1 {Report Early-Warning} t1 {Gap Size} i1 {EOD Defined} t3 {Enable EOD Generation} t1 {Synchronize at Early-Warning} t1 {Reserved} *t3 {Buffer Size at Early-Warning} i3 {Select Data Compression Algorithm} i1 {Reserved} *i1 } > .: ..?boot2@boot1A fdbootB bootfdC odbootD bootodE sdbootF bootsdG wdbootHX bootwdfȎfffsffJf1fffrCffg&C> FreeBSD BOOT @ 0x%x: %d/%d k of memory, %s%s console Boot default: %d:%s(%d,%c)%s %s boot: Can't find %s UWVS}1S|4CF~j@6jD6<6 = } hhh hh h=t4hh h|h-t h uPaP54P|tPtP5D65@6hh |%|0th. u j h|h.T=-ƅt5h>Invalid format! Booting %d:%s(%d,%c)%s @ 0x%x Start address too low text=0x%x data=0x%x bss=0x%x symbols=[+0x%x+0x%x+0x%x+0x%x+0x%x] .configtotal=0x%x entry point=0x%x U(WVSj EPMэvI tot9Ȇ%=t$=t= t=th>]iU= t!1=tІf= t }}W5aP54PhOhnuhuuuut FuuhuVQuuhjuVu t )߉މ5H6jVEPujShuV u$j]S%jVSNE܃E܃Pjh uV u܉5L6  Ћ Ћ ЉÁ6= 6686H*ABuJABuhh(h*Zhhh(kuVh $h6S| Pue[^_Can't find file %s UVSE] ut~5h VS D3e[^No keyboard found Keyboard found UVSMu A< t< t<-umA< t< t 1023 (BIOS limit) Error: D:0x%x C:%d H:%d S:%d UWVSE9`\uU 9h\ 9d\E =\8Ɓ~ VhKE =\8Ӊؙ=X8EE =X8׋X8)~=h`8SWuVu t@h`8SWuVutWuVuhlXʋE`\U h\Ӊd\E +h\ `8e[^_UWVS=P8 t9MT89EE)ȉ158׉Éމ15,f}15,f]ffE1ۿP6 fTfUf9t v~fEf9D tC}~у~t/=t   <Q,؉)Ee[^_UWVS}u ~,Shp\SWhp\E)߃ԍe[^_U WVS} 5x#8}NPU B9wu9 r^08# @#^L]u1Ndt}u9] |SRu| /+]9] }] uRhp^SuUpRz])] ډ} ~ 9u 9 e[^_%s U WVSEE8?u xuExUr0M׉ËÉEQ!ӉAUQUyxNjY`}EUZdtPhplhh xyxpPsUu /u EM9/t= u =tnfff@u[EEUt}/tEM MuE1UM9]ru M9 w}1x#8[P]M -C‰UM M9Mwu E9 r xR0 x8# @#QLUuSxJdtRhp pS׃p}tSRh|pSRupUUM j Ce[^_UWVSu  ,JxJd\t9ptr0Shp+pVЋ=xtpe[^_Unknown device UVSހ;t;(tC;u;ul\~:u< w l\C9tH=MM8u@8Ft:u:-< w ƒУCtq<,uC;tg<w ƒC;tLC<)t;u;t;l\ƒЄut"t u h_uh tPxp|hp|St|1e[^@@7  |/-\: # $Id: fixit.profile,v 1.1.6.3 1997/03/02 12:03:31 joerg Exp $ export BLOCKSIZE=K export PS1="Fixit# " export EDITOR="/mnt2/stand/vi" export PAGER="/mnt2/stand/more" export SCSI_MODES="/mnt2/usr/share/misc/scsi_modes" # the root MFS doesn't have /dev/nrst0, pick a better default for mt(1) export TAPE=/mnt2/dev/nrst0 alias ls="ls -F" alias ll="ls -l" alias m="more -e" echo '+---------------------------------------------------------------+' echo '| You are now running from a FreeBSD "fixit" floppy. |' echo '| ------------------------------------------------------------- |' echo "| When you're finished with this shell, please type exit. |" echo '| The fixit floppy itself is mounted as /mnt2. |' echo '| |' echo '| You might want to symlink /mnt/etc/*pwd.db and /mnt/etc/group |' echo '| to /etc after mounting a root filesystem from your disk. |' echo '| tar(1) will not restore all permissions correctly otherwise! |' echo '| |' echo '| Note: you might use the arrow keys to browse through the |' echo '| command history of this shell. |' echo '+---------------------------------------------------------------+' echo echo 'Good Luck!' echo # Make the arrow keys work; everybody will love this. set -o emacs 2>/dev/null cd /