fjQPS1Pjf1ɎَѼ|}r,g|uuƀrIᾋ}R1҉ 5w ޿))0duddu`ûDL Ss*}}0r4uRZr?tfFRff1fC0fZf=wD@(f8r^P[s Ot0FsF ^(Fw.yURAZoUd]BReadBoot error PUWEVfd1440P$@ ,WEV(i @ @ @ BTXP1мfjf9W_s uU}EEE Efh ( f"1ɱѱ8ٺ6 -)б3QPhj+5 QQQQRja 1f֐ юَH"1Ўػptr4!PP 栈!桰!桰!XX!j@j td>0tc>2tk> u~tEj$USm]]fEfE EfCe[]XPPPP`jr11t$PV^=1ɱ󥖋D$@t+rBR/=_D$HuKKf)8󥑉-w1)ثufȫd$aσuD$ `X6qtltŰ=Vtf\tGt3CRu fu6 Ж1t -t ^ u 뎪PXPX$< i/ u`1ɴPf 8cuf1< tPЀfBPr0ƀrf Pffa g ?`}9m)u int@errDeflPeipHeax4ebx(ecx0edx,esiediebp espcsLds es fsgssscs:eipHss:espBTX halted'00b1000h01 50Çl$EMU ]$PXE(PD$E,D$Xu0}4l$UWVS0 0 )*1Ҁ=*|** )@ *@0p0Tj1x0j%|0t01۾P00000tO00 ы0 у? C~h"vthh *P *= *t&Sh"h" S t1 *tH ,= ,u:u#j h"S j7u Su jh"S h ,*aP5**#*Ph"x #tt jZtw *jƃ u ttA, t"u" *vOj j 1"- *=}GtV uj 1h *t j h , UUWVSEP8u =0 URh#n j4EP8PEf= t=ELFh#h$#, }+00uS8R|E%uS8PUqE%EË0ډ0jEPS E܅PS8P!]jS8R3VS8PlE裘0Dž41f}t=1j \/S8R;u 4FE9} 4~11\/+0D/0t/S8P8T F~ŋE%Ë0ډ0UMA9DE죘0jP0Z=0tCPh"!.K:Sut @A:uu:kCÍ9rhS6߃t=0tj 1ۅ~:/uB 1u[^_US]Su u#9u1h#h$#V] UWVS]=*u}=)uh 7))jj5){u+hd5)h#=<)TthE#8$ )*u19)5)15$lj $#!=#=#15X$Ƌ @$> D$P5)f15X$`)5) )0))E E05h))9uvuUU6 0$0  <)k)9)tI=)uh )5) D$)P5)))C=T$):  C 0$ l)9wu;h)w5$5h)#5)5 )#5,$9=)t* P D$P5)S=)0#));uvuV)PMQu50)uEe[^_ UWVS=*U=)uhx)*jj5) )þ *ǃw=1ڀzu uw Fu t Fvڃ= *u *t#t\{t hN#C*j*@P5)(uy )9WEVu WEVt=*tihT#E=*ufyu ***9suhZ#h$#4#*u*E E Pue[^_ UWVS}u %Gst% ctut0xt+vvo^;tdPqC;uSEuuE F]1u#CȅuKE9rP&KE9sPGN1e[^_US] uj S]UVSuUM t ACJu[^ U=)u00%)У))U‰)UE000UWVS]} u##Phd#b000 0=0f0؃00 5*50k00u1W0Phh#e[^_ UVSu1jt l+0u9r9r1e[^US]#t(0%00#tS؋]US]#tjBt u&j3*#ttu t1]US]00!u 0 04[fRf fZBB--uf1ɵ@ tD$ f1$dafd wdad%s /boot.config%s: %s/boot/loader/kernel >> FreeBSD/i386 BOOT Default: %u:%s(%u,%c)%s boot: No %s formatInvalid %s yesnoKeyboard: %s Not ufs slicelabelpartition%cDisk error 0x%x (lba=0x%x) DhaCcdgPrsv  """""0123456789abcdef/|\- 089@   9~ Q`w/mntii<@T 089@   9~ Q`S}<@TU 9@ w(( < h/8}jZK6 A999I4A999 !ޑ999Iz+O!9993'!999̑!999n/!999 [!999<#!999I!999 q!999どC!999@/!999ʍ9!999MJsm!999-]!!999m!999N mA999I9[!999KB$!999?Ds!999M,!999=>!999_W!999{o!999}!999l5!9999!999 R!999 gj!999 v#!999 9:'\!999 4!999 WE!999 R+!999 '\!999 QG!999 XoZ!999 7!999 &k!999 @X$!999 ~׽)!999 .!999 S!999 bKc!999 B!999 %^u!999 qZP!999 oc,!999 mfQ!999 t!999 ߳u!999 E}!999tsf3!999t>\w!999t20m!999tt !999u*E!999u|xW!999uZ]{!999 u|!999v>X!999!999X9$!9990}y!999'_!999EԱ|!999Eat!999W\!999W3R>!999W!999W!999W>^/!999W½!999W4 !999W<!999W5q!999W)f!999W7p_v!999Wk,!999W5!999ZtO!999+٧d!999+]8!999+կ!999+;k !999+6c!999+!999+dgV!999+c!999+\M!999+9l!999+N;!999+g!999+m8!999*4!999#G!999@N !999 V)!999 )Y&#!999QK!999Km=!999%!999Cz!999+E!999 A2!999 7!999 a6!999 2!999 = .!999 )Lvb!999 N!999 }!999 %G999ttyv09!999BBD!999DQBD!999$ΜBD!999:!999M'!999*yl!9994!999bx*!999$-l(!999b+o!999Tc%!999Ma]!9997!9992!999ظ!999*-FZ!999^R~!999H&D!999 !999Qy!99960R !999  I2!999 0!999 ?!999 ;JK!999 T _!999 *"!999 E&!999 Y\!999 'Hi!999 Ί`!!999{3y!999l:!999X)!999 3!999Bb!9997w!999@;!999cv!999>d>!999l+!9991P!999]E!999@c!999>O!9996"!999HmT=!999TM!999$g!999Hz\=!999;;F!999 wp!999Pfo!999w!999*0!999J:!999TV!999TR!999=U!999fI3!999;!999xv!999(-!999Vnv!999!v !999a!9990Y!999X6!999 . !999@RP!999pu!999њH!999#bml!999 m!999 ,!999`To;!999P5!999R7H^i!999i!999j*9!999o~º&!99946&jOBD!9994 E!999(a!999'&G!999'<!9992WsRQ!999z!999hɶ/!999<$j&!9997=)Q!999;J!999;y!9998 .~!999@84:A!9999KY=A999H_m'~a9a99px`H ďkm 999FtA999'V|A999jA999԰j999 QEQ999DV999 P@-|999[qA9998eA9992B1A999ZA9992)A999F{MA999:tA999gjA999{+ZA999$999  |С1999(kp\D(iRK]O3'6&tb q>ov, =2 ix}NLy^/z127L.Hc?[v(z\D0 u` Ó;C *>K&aYE_$WK4 YJ'Z{άGָKJ/N=fw}B3dkJsgF^2(Zn;4ˤN~T0Q#;Z l=W/@Gg PWa tϟ( ^Dj-(C2,PF7/;Y}N^x?LB5L# Gó!OΝP"h(m@BnoXِTK~HQD+H/^ WIQ +;adAvf In VR*qL(L .,F(2Gvkgj+E7X~g6U R  l=/0+.? o%~Ψ:D>kgq]m pT1w ...$offset + $unit ` ;; i4btel*) unit=`expr $i : 'i4btel\(.*\)'` mknod i4btel$unit c 56 $unit ;; i4btrc*) unit=`expr $i : 'i4btrc\(.*\)'` mknod i4btrc$unit c 59 $unit ;; mlx*) unit=`expr $i : 'mlx\(.*\)'` mknod mlx$unit c 130 $unit ;; agpgart) mknod agpgart c 148 0 ;; twe*) unit=`expr $i : 'twe\(.*\)'` mknod twe$unit c 146 $unit ;; local) umask 0 # XXX should be elsewhere sh MAKEDEV.local umask 77 ;; *) echo $i - no such device name ;; esac done  . .. 0 1 2 3 4 5 6 7 8|9ticast Transport Protocol ax.25 93 AX.25 # AX.25 Frames ipip 94 IPIP # Yet Another IP encapsulation micp 95 MICP # Mobile Internetworking Control Pro. scc-sp 96 SCC-SP # Semaphore Communications Sec. Pro. etherip 97 ETHERIP # Ethernet-within-IP Encapsulation encap 98 ENCAP # Yet Another IP encapsulation # 99 # any private encryption scheme gmtp 100 GMTP # GMTP ifmp 101 IFMP # Ipsilon Flow Management Protocol pnni 102 PNNI # PNNI over IP pim 103 PIM # Protocol Independent Multicast aris 104 ARIS # ARIS scps 105 SCPS # SCPS qnx 106 QNX # QNX a/n 107 A/N # Active Networks ipcomp 108 IPComp # IP Payload Compression Protocol snp 109 SNP # Sitara Networks Protocol compaq-peer 110 Compaq-Peer # Compaq Peer Protocol ipx-in-ip 111 IPX-in-IP # IPX in IP vrrp 112 VRRP # Virtual Router Redundancy Protocol pgm 113 PGM # PGM Reliable Transport Protocol # 114 # any 0-hop protocol l2tp 115 L2TP # Layer Two Tunneling Protocol ddx 116 DDX # D-II Data Exchange iatp 117 IATP # Interactive Agent Transfer Protocol st 118 ST # Schedule Transfer srp 119 SRP # SpectraLink Radio Protocol uti 120 UTI # UTI smp 121 SMP # Simple Message Protocol sm 122 SM # SM ptp 123 PTP # Performance Transparency Protocol isis 124 ISIS # ISIS over IPv4 fire 125 FIRE crtp 126 CRTP # Combat Radio Transport Protocol crdup 127 CRUDP # Combat Radio User Datagram sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS # Secure Packet Shield pipe 131 PIPE # Private IP Encapsulation within IP sctp 132 SCTP # Stream Control Transmission Protocol fc 133 FC # Fibre Channel # 134-254 # Unassigned divert 254 DIVERT # Divert pseudo-protocol [non IANA] # 255 # Reserved  . .. devstand binsbin etc mntmnt1mnt2mnt3mnt4 tmp usr@.profileE (Disable Transfer on Error)} t1 {DCR (Disable Correction)} t1 {Read Retry Count} i1 {Correction Span} i1 {Head Offset Count} i1 {Data Strobe Offset Count} i1 {Reserved} *i1 {Write Retry Count} i1 {Reserved} *i1 {Recovery Time Limit} i2 } 0x04 "Rigid Disk Drive Geometry Page" { {Number of Cylinders} i3 {Number of Heads} i1 {Starting Cylinder-Write Precompensation} i3 {Starting Cylinder-Reduced Write Current} i3 {Drive Step Rate} i2 {Landing Zone Cylinder} i3 {Reserved} *t6 {RPL} t2 {Rotational Offset} i1 {Reserved} *i1 {Medium Rotation Rate} i2 {Reserved} *i1 {Reserved} *i1 } 0x07 "Verify Error Recovery Page" { {Reserved} *t4 {EER} t1 {PER} t1 {DTE} t1 {DCR} t1 {Verify Retry Count} i1 {Verify Correction Span} i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Verify Recovery Time Limit} i2 } 0x0E "CD-ROM Audio Control Parameters Page" { {Reserved} *t5 {Immed} t1 {SOTC} t1 {Reserved} *t1 {Reserved} *i2 {APRVal} t1 {Reserved} *t3 {Format of LBAs / sec.} t4 {Logical Blocks per Second of Audio Playback} i2 {Reserved} *t4 {Output Port 0 Channel Selection} t4 {Output Port 0 Volume} i1 {Reserved} *t4 {Output Port 1 Channel Selection} t4 {Output Port 1 Volume} i1 {Reserved} *t4 {Output Port 2 Channel Selection} t4 {Output Port 2 Volume} i1 {Reserved} *t4 {Output Port 3 Channel Selection} t4 {Output Port 3 Volume} i1 } 0x10 { {Reserved} *t1 {Change Active Partition} t1 {Change Active Format} t1 {Active Format} t5 {Active Partition} i1 {Write Buffer Full Ratio} i1 {Write Buffer Empty Ratio} i1 {Write Delay Time} i2 {Data Buffer Recovery} t1 {Block Identifiers Support} t1 {Report Setmarks} t1 {Automatic Velocity Control} t1 {Stop on Consecutive Filemarks} t2 {Recover Buffer Order} t1 {Report Early-Warning} t1 {Gap Size} i1 {EOD Defined} t3 {Enable EOD Generation} t1 {Synchronize at Early-Warning} t1 {Reserved} *t3 {Buffer Size at Early-Warning} i3 {Select Data Compression Algorithm} i1 {Reserved} *i1 } 0x00 "Vendor-Specific"; #!/bin/sh - # # Copyright (c) 1990 The Regents of the University of California. # All rights reserved. # # Written and contributed by W. Jolitz 12/90 # # Redistribution and use in source and binary forms are permitted provided # that: (1) source distributions retain this entire copyright notice and # comment, and (2) distributions including binaries display the following # acknowledgement: ``This product includes software developed by the # University of California, Berkeley and its contributors'' in the # documentation or other materials provided with the distribution and in # all advertising materials mentioning features or use of this software. # Neither the name of the University nor the names of its contributors may # be used to endorse or promote products derived from this software without # specific prior written permission. # THIS SOFTWARE IS PROVIDED ``AS IS'' AND WITHOUT ANY EXPRESS OR IMPLIED # WARRANTIES, INCLUDING, WITHOUT LIMITATION, THE IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. # # @(#)MAKEDEV 5.2 (Berkeley) 6/22/90 # $FreeBSD: src/etc/MAKEDEV,v 1.243.2.10 2000/07/27 13:57:00 nsayer Exp $ # # Device "make" file. Valid arguments: # all makes all known devices, standard number of units (or close) # std standard devices # jail suitable for a jail(8) # local configuration specific devices # mach-4 mach4&lites+devices for Mach's XFree86 distribution # (see http://www.cs.hut.fi/lites.html for more info on LITES) # # Tapes: # wt* QIC-interfaced (e.g. not SCSI) 3M cartridge tape # sa* SCSI Sequential Access Devices # # Disks: # acd* ATAPI CD-ROM disks # amrd* AMI MegaRAID # cd* SCSI CD-ROM disks # da* SCSI Direct Access Devices # fd* floppy disk drives (3 1/2", 5 1/4") # fla* M-Systems DiskOnChip # idad* Compaq Smart-2 RAID arrays # matcd* Matsushita (Panasonic) CD-ROM disks # mcd* Mitsumi CD-ROM disks # md* Memory (or malloc) disk # mlx* Mylex DAC960 RAID controllers # mlxd* Mylex DAC960 RAID disk volumes # scd* Sony CD-ROM disks # vn* vnode disks # wd* "Winchester" disk drives (ST506,IDE,ESDI,RLL,...) # wfd* IDE floppy disk drives (LS-120) # # Console ports: # vty* virtual console devices for syscons/pcvt/codrv # # Pointing devices: # mse* Logitech and ATI Inport bus mouse # psm* PS/2 mouse # sysmouse Mousesystems mouse emulator for syscons # # Time devices: # refclock-* serial ports used by xntpd parse refclocks # # Terminal ports: # tty* general purpose serial ports # cua* dialout serial ports # ttyA* Specialix SI/XIO dialin ports ('*' = number of devices) # cuaA* Specialix SI/XIO dialout ports # ttyD* Digiboard - 16 dialin ports # cuaD* Digiboard - 16 dialout ports # ttyR* Rocketport dialin ports # cuaR* Rocketport dialout ports # # Pseudo terminals: # pty* set of 32 master and slave pseudo terminals # vty* virtual terminals using syscons/pcvt/codrv console # # Parallel port: # lpt* Printer # ppi* Parallel port i/o # pps* Pulse per second timing interface # pcfclock* Parallel time sync interface # # I2C and SMBus: # iic* I2C devices # smb* SMBUS devices # # USB devices: # usb* USB bus control device # uhid* Human Interface Device (HID) # ums* mouse # ulpt* printer # ugen* generic USB device # # SCSI devices (other than CD-ROM, tape and disk): # ch* SCSI Media-Changer (juke box) driver # worm* WORM driver # pt* Processor Type (HP scanner, as one example) # pass* CAM Passthrough device # ses* SES (SCSI Environmental Services) and # SAF-TE (Scsi Accessable Fault-Tolerant Enclosures) device # # PC-CARD (previously called PCMCIA) support # card* PC-CARD slots # # ISDN devices: # i4b isdnd call control device # i4bctl debugging control device # i4btrc* trace data interface(s), one per passive card # i4btel* telephony interface(s) # i4bteld* telephony dialout interface(s) # i4brbch* raw b channel access device(s) # # Special purpose devices: # apm Advanced Power Management BIOS # apmctl APM BIOS control device # bpf* packet filter # speaker pc speaker # tw* xten power controller # snd* various sound cards # pcaudio PCM audio driver # socksys iBCS2 socket system driver # vat VAT compatibility audio driver (requires snd*) # gsc Genius GS-4500 hand scanner # joy pc joystick # tun* Tunneling IP device # tap* Ethernet Tunneling device # snp* tty snoop devices # spigot Video Spigot video acquisition card # ctx* Cortex-I video acquisition card # meteor* Matrox Meteor video acquisition card (pci) # bktr* Bt848 based video acquisition card (pci) # labpc* National Instrument's Lab-PC and LAB-PC+ # perfmon CPU performance-monitoring counters # pci PCI configuration-space access from user mode # ipl ipfilter control devices (ipl, ipnat, ipstate, ipauth) # kbd keyboard devices # agpgart AGP interface # if [ -n "$MAKEDEVPATH" ]; then PATH="$MAKEDEVPATH" else PATH=/sbin:/bin fi umask 77 # Usage: die exitcode msg die() { echo $2 exit $1 } # Convert integer to partition name dkitop() { local p case $1 in 0) p=a;; 1) p=b;; 2) p=c;; 3) p=d;; 4) p=e;; 5) p=f;; 6) p=g;; 7) p=h;; *) p="?";; esac echo $p } # Convert integer to slice name dkitos() { local s case $1 in 0) s="";; 1) s="";; *) s=s$(($1-1));; esac echo $s } # Convert disk (type, unit, slice, partition) to minor number dkminor() { echo $(($1 << 25 | ($2 / 32) << 21 | ($2 % 32) << 3 | $3 << 16 | $4)) } # Override mknod(2) to add extra handling to it. mknod() { rm -f "$1" || exit 1 case $# in 4) /sbin/mknod "$@" root:wheel || die 2 "/sbin/mknod $@ failed";; 5) /sbin/mknod "$@" || die 2 "/sbin/mknod $@ failed";; *) die 2 "bad node: mknod $@";; esac } # Convert tape (ctrl, unit, mode, access) to minor number saminor() { echo $(($1 << 29 | ($2 / 16) << 16 | ($2 % 16) << 4 | $3 << 2 | $4)) } # Convert the last character of a tty name to a minor number. ttyminor() { case $unit in [0-9]) m=$unit;; a) m=10;; b) m=11;; c) m=12;; d) m=13;; e) m=14;; f) m=15;; g) m=16;; h) m=17;; i) m=18;; j) m=19;; k) m=20;; l) m=21;; m) m=22;; n) m=23;; o) m=24;; p) m=25;; q) m=26;; r) m=27;; s) m=28;; t) m=29;; u) m=30;; v) m=31;; *) m="?";; esac echo $m } # Raw partition for disks dkrawpart=2 # Compatibility slice for disks dkcompatslice=0 # Raw slice for disks dkrawslice=1 # Standard umasks disk_umask=037 # allow group operator to read disks tape_umask=017 # allow group operator to read/write tapes for i in $*; do case $i in all) sh MAKEDEV std # standard sh MAKEDEV fd0 fd1 # bdev, floppy disk sh MAKEDEV da0 da1 da2 da3 # bdev, SCSI disk sh MAKEDEV ad0 ad1 ad2 ad3 # bdev, ATA disk sh MAKEDEV acd0 afd0 ast0 # bdev, ATAPI devices sh MAKEDEV wd0 wd1 wd2 wd3 # bdev, OLD disk sh MAKEDEV wcd0 wfd0 wst0 # bdev, OLD ATAPI devs sh MAKEDEV vn0 # bdev, virtual disk sh MAKEDEV cd0 matcd0 mcd0 scd0 # bdev, cdrom sh MAKEDEV sa0 wt0 # bdev, tape sh MAKEDEV vty12 # cdev, virtual tty sh MAKEDEV cuaa0 cuaa1 cuaa2 cuaa3 # cdev, serial tty sh MAKEDEV pty0 # cdev, pseudo tty sh MAKEDEV ttyd0 ttyd1 ttyd2 ttyd3 # cdev, serial tty sh MAKEDEV kbd0 kbd1 # cdev, keyboard sh MAKEDEV mse0 psm0 sysmouse # cdev, mouse sh MAKEDEV pcaudio speaker # cdev, noise sh MAKEDEV lpt0 lpt1 lpt2 # cdev, printer sh MAKEDEV ppi0 ppi1 ppi2 # cdev, parallel port sh MAKEDEV iic0 iic1 # cdev, I2C device sh MAKEDEV smb0 smb1 # cdev, SMBus device sh MAKEDEV usb usb0 uhid0 ums0 ulpt0 ugen0 # cdev, USB devices sh MAKEDEV bpf0 bpf1 bpf2 bpf3 # cdev, network sh MAKEDEV ipl tun0 tun1 tun2 tun3 # cdev, network sh MAKEDEV tap0 tap1 tap2 tap3 # cdev, network sh MAKEDEV ch0 perfmon tw0 # cdev, miscellaneous sh MAKEDEV apm apmctl card0 card1 card2 card3 # cdev, laptop sh MAKEDEV pass4 xpt2 # cdev, CAM sh MAKEDEV i4b i4bctl i4btrc0 i4btrc1 # cdev, ISDN sh MAKEDEV i4btel0 i4btel1 i4bteld0 i4bteld1 # cdev, ISDN sh MAKEDEV i4brbch0 i4brbch1 # cdev, ISDN sh MAKEDEV agpgart # cdev, AGP ;; # a much restricted set of the above, to save precious i-nodes on the # fixit floppy fixit) sh MAKEDEV std # standard sh MAKEDEV fd0 # bdev, floppy disk sh MAKEDEV da0 # bdev, SCSI disk sh MAKEDEV ad0 # bdev, ATA disk sh MAKEDEV acd0 afd0 ast0 # bdev, ATAPI devices sh MAKEDEV wd0 # bdev, OLD disk sh MAKEDEV wcd0 wfd0 wst0 # bdev, OLD ATAPI devs sh MAKEDEV vn0 # bdev, virtual disk sh MAKEDEV cd0 # bdev, cdrom sh MAKEDEV sa0 # bdev, tape sh MAKEDEV vty2 # cdev, virtual tty sh MAKEDEV cuaa0 # cdev, serial tty sh MAKEDEV pty0 # cdev, pseudo tty sh MAKEDEV ttyd0 # cdev, serial tty sh MAKEDEV kbd0 # cdev, keyboard sh MAKEDEV mse0 psm0 sysmouse # cdev, mouse sh MAKEDEV lpt0 # cdev, printer sh MAKEDEV ppi0 # cdev, parallel port sh MAKEDEV iic0 # cdev, I2C device sh MAKEDEV smb0 # cdev, SMBus device sh MAKEDEV ums0 # cdev, USB devices sh MAKEDEV tun0 # cdev, network sh MAKEDEV tap0 # cdev, network sh MAKEDEV ch0 # cdev, miscellaneous sh MAKEDEV apm apmctl card0 # cdev, laptop sh MAKEDEV pass1 xpt1 # cdev, CAM sh MAKEDEV i4b i4bctl i4btrc0 i4btrc1 # cdev, ISDN sh MAKEDEV i4btel0 i4bteld0 # cdev, ISDN sh MAKEDEV i4brbch0 # cdev, ISDN rm -f fd/[1-9]? ;; std) mknod console c 0 0; chmod 600 console mknod kmem c 2 1 root:kmem; chmod 640 kmem mknod mem c 2 0 root:kmem; chmod 640 mem mknod null c 2 2; chmod 666 null mknod random c 2 3; chmod 644 random mknod urandom c 2 4; chmod 644 urandom mknod zero c 2 12; chmod 666 zero mknod io c 2 14; chmod 600 io mknod tty c 1 0; chmod 666 tty mknod klog c 7 0; chmod 600 klog mknod stdin c 22 0; chmod 666 stdin mknod stdout c 22 1; chmod 666 stdout mknod stderr c 22 2; chmod 666 stderr mknod pci c 78 0; chmod 644 pci mkdir -p fd (cd fd && i=0 && while [ $i -lt 64 ]; do mknod $i c 22 $i i=$(($i + 1)) done ) chmod 555 fd chmod 666 fd/* ;; jail) sh MAKEDEV std pty0 rm mem kmem pci io klog console # for security ln -sf null mem # for libkvm (ab)users ln -sf null kmem # --//-- ln -sf null console ;; mach-4) mknod iopl c 22 0 mknod kbd c 23 0 mknod mouse c 24 0 mknod time c 25 0 mknod timezone c 26 0 ;; # Create device files for new Archive/Wangtek QIC-02 tape driver (vak) wt*) umask $tape_umask u=`expr $i : '..\(.*\)'` if [ -z "${u}" ]; then u=0; fi # default density, 512b blocks mknod rwt${u} c 10 `expr 0 + $u` root:operator mknod nrwt${u} c 10 `expr 4 + $u` root:operator # default density, 1024b blocks # mknod rWt${u} c 10 `expr 64 + $u` root:operator # mknod nrWt${u} c 10 `expr 68 + $u` root:operator mknod rwt${u}b c 10 `expr 16 + $u` root:operator # 60 megabytes mknod nrwt${u}b c 10 `expr 20 + $u` root:operator mknod rwt${u}c c 10 `expr 24 + $u` root:operator # 120 megabytes mknod nrwt${u}c c 10 `expr 28 + $u` root:operator mknod rwt${u}d c 10 `expr 32 + $u` root:operator # 150 megabytes mknod nrwt${u}d c 10 `expr 36 + $u` root:operator # mknod rwt${u}e c 10 `expr 40 + $u` root:operator # 300 megabytes? # mknod nrwt${u}e c 10 `expr 44 + $u` root:operator # mknod rwt${u}f c 10 `expr 48 + $u` root:operator # 600 megabytes? # mknod nrwt${u}f c 10 `expr 52 + $u` root:operator umask 77 ;; # Individual slices. ad*s*|afd*s*|amrd*s*|da*s*|fla*s*|idad*s*|md*s*|mlxd*s*|twed*s*|vn*s*|wd*s*|wfd*s*) umask $disk_umask case $i in ad*s*) name=ad; chr=116;; afd*s*) name=afd; chr=118;; amrd*s*) name=amrd; chr=133;; da*s*) name=da; chr=13;; fla*s*) name=fla; chr=102;; idad*s*) name=idad; chr=109;; md*s*) name=md; chr=95;; mlxd*s*) name=mlxd; chr=131;; twed*s*) name=twed; chr=147;; vn*s*) name=vn; chr=43;; wd*s*) name=wd; chr=3;; wfd*s*) name=wfd; chr=87;; esac case $i in amrd*s*|idad*s*|mlxd*s*|twed*s*) unit=`expr $i : '....\([0-9]*\)s'` slice=`expr $i : '....[0-9]*s\([0-9]*\)'` part=`expr $i : '....[0-9]*s[0-9]*\(.*\)'` ;; afd*s*|fla*s*|wfd*s*) unit=`expr $i : '...\([0-9]*\)s'` slice=`expr $i : '...[0-9]*s\([0-9]*\)'` part=`expr $i : '...[0-9]*s[0-9]*\(.*\)'` ;; *) unit=`expr $i : '..\([0-9]*\)s'` slice=`expr $i : '..[0-9]*s\([0-9]*\)'` part=`expr $i : '..[0-9]*s[0-9]*\(.*\)'` ;; esac case $unit in [0-9]|[0-9][0-9]|[0-4][0-9][0-9]|50[0-9]|51[0-1]) case $slice in [0-9]|[1-2][0-9]|30) oldslice=$slice slice=$(($slice+1)) slicename=`dkitos $slice` minor=`dkminor 0 $unit $slice $dkrawpart` mknod $name$unit$slicename c $chr $minor root:operator ln -f $name$unit$slicename r$name$unit$slicename case $part in [a-h]) case $oldslice in 0) slice=$oldslice ;; esac for part in 0 1 2 3 4 5 6 7 do minor=`dkminor 0 $unit $slice $part` partname=`dkitop $part` mknod $name$unit$slicename$partname \ c $chr $minor root:operator ln -f $name$unit$slicename$partname \ r$name$unit$slicename$partname done ;; "") ;; *) echo bad partition for disk in: $i ;; esac ;; *) echo bad slice for disk in: $i ;; esac ;; *) echo bad unit for disk in: $i "(unit=$unit, slice=$slice, part=$part)" ;; esac umask 77 ;; fd*) umask $disk_umask unit=`expr $i : '..\(.*\)'` name=fd; chr=9 case $unit in 0|1|2|3) mknod ${name}${unit} c $chr `expr $unit '*' 64` root:operator ln -f ${name}${unit} r${name}${unit} # Fake BSD partitions for i in a b c d e f g h do ln -f ${name}${unit} ${name}${unit}$i ln -f r${name}${unit} r${name}${unit}$i done # User-readable and programmer-readable name sets mknod ${name}${unit}.1720 c $chr `expr $unit '*' 64 + 1` \ root:operator ln -f ${name}${unit}.1720 r${name}${unit}.1720 # ln -f ${name}${unit}.1720 ${name}${unit}135hs21 # ln -f r${name}${unit}.1720 r${name}${unit}135hs21 mknod ${name}${unit}.1480 c $chr `expr $unit '*' 64 + 2` \ root:operator ln -f ${name}${unit}.1480 r${name}${unit}.1480 # ln -f ${name}${unit}.1480 ${name}${unit}135hs18 # ln -f r${name}${unit}.1480 r${name}${unit}135hs18 # ln -f ${name}${unit}.1480 ${name}${unit}96hs18 # ln -f r${name}${unit}.1480 r${name}${unit}96hs18 mknod ${name}${unit}.1440 c $chr `expr $unit '*' 64 + 3` \ root:operator ln -f ${name}${unit}.1440 r${name}${unit}.1440 # ln -f ${name}${unit}.1440 ${name}${unit}135 # ln -f r${name}${unit}.1440 r${name}${unit}135 # ln -f ${name}${unit}.1440 ${name}${unit}135ds18 # ln -f r${name}${unit}.1440 r${name}${unit}135ds18 # ln -f ${name}${unit}.1440 ${name}${unit}96ds18 # ln -f r${name}${unit}.1440 r${name}${unit}96ds18 mknod ${name}${unit}.1200 c $chr `expr $unit '*' 64 + 4` \ root:operator ln -f ${name}${unit}.1200 r${name}${unit}.1200 # ln -f ${name}${unit}.1200 ${name}${unit}96 # ln -f r${name}${unit}.1200 r${name}${unit}96 # ln -f ${name}${unit}.1200 ${name}${unit}96ds15 # ln -f r${name}${unit}.1200 r${name}${unit}96ds15 # ln -f ${name}${unit}.1200 ${name}${unit}135ds15 # ln -f r${name}${unit}.1200 r${name}${unit}135ds15 mknod ${name}${unit}.820 c $chr `expr $unit '*' 64 + 5` \ root:operator ln -f ${name}${unit}.820 r${name}${unit}.820 # ln -f ${name}${unit}.820 ${name}${unit}96hs10 # ln -f r${name}${unit}.820 r${name}${unit}96hs10 # ln -f ${name}${unit}.820 ${name}${unit}135hs10 # ln -f r${name}${unit}.820 r${name}${unit}135hs10 mknod ${name}${unit}.800 c $chr `expr $unit '*' 64 + 6` \ root:operator ln -f ${name}${unit}.800 r${name}${unit}.800 # ln -f ${name}${unit}.800 ${name}${unit}96ds10 # ln -f r${name}${unit}.800 r${name}${unit}96ds10 # ln -f ${name}${unit}.800 ${name}${unit}135ds10 # ln -f r${name}${unit}.800 r${name}${unit}135ds10 mknod ${name}${unit}.720 c $chr `expr $unit '*' 64 + 7` \ root:operator ln -f ${name}${unit}.720 r${name}${unit}.720 # ln -f ${name}${unit}.720 ${name}${unit}96ds9 # ln -f r${name}${unit}.720 r${name}${unit}96ds9 # ln -f ${name}${unit}.720 ${name}${unit}135ds9 # ln -f r${name}${unit}.720 r${name}${unit}135ds9 mknod ${name}${unit}.360 c $chr `expr $unit '*' 64 + 8` \ root:operator ln -f ${name}${unit}.360 r${name}${unit}.360 # ln -f ${name}${unit}.360 ${name}${unit}48 # ln -f r${name}${unit}.360 r${name}${unit}48 # ln -f ${name}${unit}.360 ${name}${unit}48ds9 # ln -f r${name}${unit}.360 r${name}${unit}48ds9 mknod ${name}${unit}.640 c $chr `expr $unit '*' 64 + 9` \ root:operator ln -f ${name}${unit}.640 r${name}${unit}.640 # ln -f ${name}${unit}.640 ${name}${unit}96ds8 # ln -f r${name}${unit}.640 r${name}${unit}96ds8 # ln -f ${name}${unit}.640 ${name}${unit}135ds8 # ln -f r${name}${unit}.640 r${name}${unit}135ds8 mknod ${name}${unit}.1232 c $chr `expr $unit '*' 64 + 10` \ root:operator ln -f ${name}${unit}.1232 r${name}${unit}.1232 # ln -f ${name}${unit}.1232 ${name}${unit}96ds8 # ln -f r${name}${unit}.1232 r${name}${unit}96ds8 # ln -f ${name}${unit}.1232 ${name}${unit}135ds8 # ln -f r${name}${unit}.1232 r${name}${unit}135ds8 ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; ad*|afd*|amrd*|da*|fla*|idad*|md*|mlxd*|twed*|vn*|wd*|wfd*) umask $disk_umask case $i in ad*) name=ad; chr=116;; afd*) name=afd; chr=118;; amrd*) name=amrd; chr=133;; da*) name=da; chr=13;; fla*) name=fla; chr=102;; idad*) name=idad; chr=109;; md*) name=md; chr=95;; mlxd*) name=mlxd; chr=131;; twed*) name=twed; chr=147;; vn*) name=vn; chr=43;; wd*) name=wd; chr=3;; wfd*) name=wfd; chr=87;; esac case $i in amrd*|idad*|mlxd*|twed*) unit=`expr $i : '....\(.*\)'` ;; afd*|fla*|wfd*) unit=`expr $i : '...\(.*\)'` ;; *) unit=`expr $i : '..\(.*\)'` ;; esac case $unit in [0-9]|[0-9][0-9]|[0-4][0-9][0-9]|50[0-9]|51[0-1]) for slicepartname in s0h s1 s2 s3 s4 do sh MAKEDEV $name$unit$slicepartname done ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; ccd*) umask $disk_umask name=ccd chr=74 unit=`expr $i : '...\(.*\)'` case $unit in [0-9]|[0-9][0-9]|[0-4][0-9][0-9]|50[0-9]|51[0-1]) for part in 0 1 2 3 4 5 6 7 do minor=`dkminor 0 $unit 0 $part` partname=`dkitop $part` mknod $name$unit$partname c $chr $minor root:operator ln -f $name$unit$partname r$name$unit$partname done ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; # SCSI processor type driver pt[0-9]*) chr=61 name=pt unit=`expr $i : 'pt\([0-9][0-9]*\)'` if [ -z "${unit}" ]; then unit=0 fi unit=`expr $unit + 1 - 1` mknod ${name}${unit} c $chr $unit ;; # SCSI SES/SAF-TE type driver ses[0-9]*) chr=110 name=ses unit=`expr $i : 'ses\([0-9][0-9]*\)'` if [ -z "${unit}" ]; then unit=0 fi unit=`expr $unit + 1 - 1` mknod ${name}${unit} c $chr $unit ;; # SCSI target mode sample driver targ[0-9]*) chr=65 name=targ unit=`expr $i : 'targ\([0-9][0-9]*\)'` if [ -z "${unit}" ]; then unit=0 fi unit=`expr $unit + 1 - 1` mknod ${name}${unit} c $chr $unit mknod ${name}.ctl c $chr 0xffff00ff ;; # CAM transport layer device xpt*) # This major number is temporary chr=104 name=xpt units=`expr $i : 'xpt\(.*\)'` if [ -z "${units}" ]; then units=1 fi i=0 while [ $i -lt $units ]; do dname=$name$i rm -rf $dname r$dname mknod $dname c $chr $i root:operator i=$(($i + 1)) done ;; # CAM passthrough device pass*) # This major number is temporary chr=31 name=pass units=`expr $i : 'pass\(.*\)'` if [ -z "${units}" ]; then units=1 fi i=0 while [ $i -lt $units ]; do dname=$name$i rm -rf $dname r$dname mknod $dname c $chr $i root:operator i=$(($i + 1)) done ;; pty*) class=`expr $i : 'pty\(.*\)'` case $class in 0) offset=0 name=p;; 1) offset=32 name=q;; 2) offset=64 name=r;; 3) offset=96 name=s;; # Note that xterm (at least) only look at p-s. 4) offset=128 name=P;; 5) offset=160 name=Q;; 6) offset=192 name=R;; 7) offset=224 name=S;; # This still leaves [tuTU]. *) echo bad unit for pty in: $i;; esac umask 0 case $class in 0|1|2|3|4|5|6|7) i=0 while [ $i -lt 32 ]; do # This was an awk substr() before. c=$(echo 0123456789abcdefghijklmnopqrstuv | dd bs=1 skip=$i count=1 2>/dev/null) mknod tty$name$c c 5 $(($offset + $i)) mknod pty$name$c c 6 $(($offset + $i)) i=$(($i + 1)) done ;; esac umask 77 ;; sa*) umask $tape_umask unit=`expr $i : '..\(.*\)'` chr=14 case $unit in [0-9]|[1-9][0-9]|[1-9][0-9][0-9]|[1-9][0-9][0-9][0-9]) mknod sa${unit}.ctl c $chr `saminor 1 ${unit} 0 0` ln -f sa${unit}.ctl rsa${unit}.ctl for m in 0 1 2 3 do mknod sa${unit}.${m} c $chr \ `saminor 0 ${unit} ${m} 0` root:operator ln -f sa${unit}.${m} rsa${unit}.${m} mknod nsa${unit}.${m} c $chr \ `saminor 0 ${unit} ${m} 1` root:operator ln -f nsa${unit}.${m} nrsa${unit}.${m} mknod esa${unit}.${m} c $chr \ `saminor 0 ${unit} ${m} 2` root:operator ln -f esa${unit}.${m} ersa${unit}.${m} done ln -f sa${unit}.0 sa${unit} ln -f sa${unit}.0 rsa${unit}.0 ln -f sa${unit}.0 rsa${unit} ln -f nsa${unit}.0 nsa${unit} ln -f nsa${unit}.0 nrsa${unit}.0 ln -f nsa${unit}.0 nrsa${unit} ln -f esa${unit}.0 esa${unit} ln -f esa${unit}.0 ersa${unit}.0 ln -f esa${unit}.0 ersa${unit} ;; *) echo bad unit for tape in: $i ;; esac umask 77 ;; ch*) umask 37 unit=`expr $i : '..\(.*\)'` case $i in ch*) name=ch; chr=17;; esac case $unit in 0|1|2|3|4|5|6) mknod ${name}${unit} c $chr $unit root:operator ;; *) echo bad unit for media changer in: $i ;; esac umask 77 ;; ast*) umask 2 ; unit=`expr $i : '...\(.*\)'` chr=119 case $unit in 0|1|2|3) mknod rast${unit} c $chr `expr $unit '*' 8 + 0` root:operator chmod 640 rast${unit} mknod nrast${unit} c $chr `expr $unit '*' 8 + 1` root:operator chmod 640 nrast${unit} ;; *) echo bad unit for tape in: $i ;; esac umask 77 ;; acd*|cd*|mcd*|scd*) umask $disk_umask case $i in acd*) units=`expr $i : '...\(.*\)'`; name=acd; chr=117;; cd*) units=`expr $i : '..\(.*\)'`; name=cd; chr=15;; mcd*) units=`expr $i : '...\(.*\)'`; name=mcd; chr=29;; scd*) units=`expr $i : '...\(.*\)'`; name=scd; chr=45;; esac if [ -z "${units}" -o "${units}" -le 0 ]; then units=1 fi if [ "${units}" -le 31 ]; then i=0 while [ $i -le $units ]; do dname=$name$i rm -rf ${dname}* r${dname}* mknod ${dname}a c $chr $(($i * 8)) root:operator mknod ${dname}c c $chr $(($i * 8 + 2)) root:operator ln -f ${dname}a r${dname}a ln -f ${dname}c r${dname}c i=$(($i + 1)) done else echo "$i is invalid -- can't have more than 32 cd devices" fi umask 77 ;; matcd*) umask 2 case $i in matcd*) unit=`expr $i : '.....\(.*\)'`; name=matcd; chr=46;; esac case $unit in 0|1|2|3|4|5|6|7|8|9|10|11|12|13|14|15) mknod ${name}${unit}a c $chr `expr $unit '*' 8 + 0` \ root:operator mknod ${name}${unit}c c $chr `expr $unit '*' 8 + 2` \ root:operator ln -f ${name}${unit}a r${name}${unit}a ln -f ${name}${unit}c r${name}${unit}c chmod 640 ${name}${unit}[a-h] r${name}${unit}[a-h] mknod ${name}${unit}la c $chr `expr $unit '*' 8 + 128` \ root:operator mknod ${name}${unit}lc c $chr `expr $unit '*' 8 + 130` \ root:operator ln -f ${name}${unit}la r${name}${unit}la ln -f ${name}${unit}lc r${name}${unit}lc chmod 640 ${name}${unit}l[a-h] r${name}${unit}l[a-h] ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; wcd*) umask 2 ; unit=`expr $i : '...\(.*\)'` chr=69 case $unit in 0|1|2|3|4|5|6|7) mknod wcd${unit}a c $chr `expr $unit '*' 8 + 0` root:operator mknod wcd${unit}c c $chr `expr $unit '*' 8 + 2` root:operator ln -f wcd${unit}a rwcd${unit}a ln -f wcd${unit}c rwcd${unit}c chmod 640 wcd${unit}[a-h] rwcd${unit}[a-h] ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; wst*) umask 2 ; unit=`expr $i : '...\(.*\)'` chr=90 case $unit in 0|1|2|3) mknod rwst${unit} c $chr `expr $unit '*' 8 + 0` root:operator chmod 640 rwst${unit} ;; esac umask 77 ;; iic*) unit=`expr $i : 'iic\(.*\)'` mknod iic$unit c 105 $unit ;; smb*) unit=`expr $i : 'smb\(.*\)'` mknod smb$unit c 106 $unit ;; pcfclock*) unit=`expr $i : 'pcfclock\(.*\)'` mknod pcfclock$unit c 140 $unit ;; ppi*) unit=`expr $i : 'ppi\(.*\)'` mknod ppi$unit c 82 $unit ;; pps*) unit=`expr $i : 'pps\(.*\)'` mknod pps$unit c 89 $unit ;; usb) mknod usb$unit c 108 255 root:operator chmod 0660 usb$unit ;; usb*) unit=`expr $i : 'usb\(.*\)'` mknod usb$unit c 108 $unit root:operator chmod 0660 usb$unit ;; uhid*) unit=`expr $i : 'uhid\(.*\)'` mknod uhid$unit c 122 $unit ;; ums*) unit=`expr $i : 'ums\(.*\)'` mknod ums$unit c 111 $unit ;; ulpt*) unit=`expr $i : 'ulpt\(.*\)'` minor=$unit mknod ulpt$unit c 113 $minor minor=`expr $unit + 64` mknod unlpt$unit c 113 $minor # and the 'no prime' version ;; ugen*) unit=`expr $i : 'ugen\([0-9][0-9]*\)'` endpoint=`expr $i : 'ugen.*\.\([0-9][0-9]*\)'` if [ -z "${unit}" ]; then echo $i - Invalid unit number fi if [ -z "${endpoint}" ]; then # ugen0 & ugen0.1 - ugen0.15 mknod ugen$unit c 114 $(($unit * 16)) i=1 while [ $i -lt 16 ]; do mknod ugen$unit.$i c 114 $(($unit * 16 + $i)) i=$(($i + 1)) done else minor=$(($unit * 16 + $endpoint)) mknod ugen$unit.$endpoint c 114 $minor fi ;; lpt*) unit=`expr $i : 'lpt\(.*\)'` mknod lpt$unit c 16 $unit mknod lpctl$unit c 16 `expr $unit + 128` ;; tw*) unit=`expr $i : 'tw\(.*\)'` mknod tw$unit c 19 $unit root:operator ;; # Use this to create virtual consoles for syscons, pcvt or codrv # ttyv0-b # use as MAKEDEV vtyNN to create NN entries vty*) chr=12 units=`expr $i : 'vty\(.*\)'` i=0 while [ $i -lt $units ]; do mknod ttyv$(printf %01x $i) c $chr $i i=$(($i + 1)) done ln -fs ttyv0 vga # XXX X still needs this pccons relic ;; bpf*) nbpf=`expr $i : 'bpf\(.*\)$'` unit=0 while [ $unit -le $nbpf ]; do mknod bpf$unit c 23 $unit unit=$(($unit + 1)) done ;; speaker) mknod speaker c 26 0 ;; cuaa?|cua?) umask 7 unit=`expr $i : 'cua.*\(.\)$'` m=`ttyminor $unit` mknod cuaa$unit c 28 `expr $m + 128` uucp:dialer mknod cuaia$unit c 28 `expr $m + 32 + 128` uucp:dialer mknod cuala$unit c 28 `expr $m + 64 + 128` uucp:dialer umask 77 ;; tty0?|ttyd?|tty?) unit=`expr $i : 'tty.*\(.\)$'` m=`ttyminor $unit` mknod ttyd$unit c 28 $m mknod ttyid$unit c 28 `expr $m + 32` mknod ttyld$unit c 28 `expr $m + 64` ;; cuac?) umask 7 portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q r s t u v" major=48 card=`expr $i : 'cua.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=`expr $card \* 65536 + $minor` name=$card$unit mknod cuac$name c $major `expr $minor + 128` uucp:dialer mknod cuaic$name c $major `expr $minor + 32 + 128` uucp:dialer mknod cualc$name c $major `expr $minor + 64 + 128` uucp:dialer done umask 77 ;; ttyc?) portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q r s t u v" major=48 card=`expr $i : 'tty.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=`expr $card \* 65536 + $minor` name=$card$unit mknod ttyc$name c $major $minor mknod ttyic$name c $major `expr $minor + 32` mknod ttylc$name c $major `expr $minor + 64` done ;; # RISCom8 'rc' driver entries cuam?) umask 7 unit=`expr $i : 'cua.*\(.\)$'` m=`ttyminor $unit` mknod cuam$unit c 63 `expr $m + 128` uucp:dialer umask 77 ;; ttym?) unit=`expr $i : 'tty.*\(.\)$'` m=`ttyminor $unit` mknod ttym$unit c 63 $m ;; # Specialix SI/XIO. # Note: these are 'base 1' to match the numbers on the panels, and to match # the manual that comes with the system. ttyA*) major=68 nports=`expr $i : 'ttyA\(.*\)$'` port=1 while [ $port -le $nports ]; do minor=$(expr $port - 1) name=$(printf %02d $port) mknod ttyA$name c $major $minor mknod ttyiA$name c $major `expr $minor + 65536` mknod ttylA$name c $major `expr $minor + 131072` port=$(($port + 1)) done # For the user-mode control program, 'sicontrol' mknod si_control c 68 262144 ;; cuaA*) umask 7 major=68 nports=`expr $i : 'cuaA\(.*\)$'` port=1 while [ $port -le $nports ]; do minor=$(expr $port - 1) name=$(printf %02d $port) mknod cuaA$name c $major `expr $minor + 128` uucp:dialer mknod cuaiA$name c $major `expr $minor + 128 + 65536` \ uucp:dialer mknod cualA$name c $major `expr $minor + 128 + 131072` \ uucp:dialer port=$(($port + 1)) done umask 77 ;; # Digiboard PC/?? 16 port card. # The current scheme of minor numbering is: # # unused{14} CARD{2} major{8} CALLOUT{1} LOCK{1} INIT{1} PORT{5} # # CARD bitfield in future versions may be extended to 3 bits. # # See dgb(4) # ttyD?) portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" major=58 card=`expr $i : 'tty.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=`expr $card \* 65536 + $minor` name=$card$unit mknod ttyD$name c $major $minor mknod ttyiD$name c $major `expr $minor + 32` mknod ttylD$name c $major `expr $minor + 64` done ;; cuaD?) umask 7 portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" major=58 card=`expr $i : 'cua.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=`expr $card \* 65536 + $minor` name=$card$unit mknod cuaD$name c $major `expr $minor + 128` uucp:dialer mknod cuaiD$name c $major `expr $minor + 32 + 128` uucp:dialer mknod cualD$name c $major `expr $minor + 64 + 128` uucp:dialer done umask 77 ;; ttyM*) portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" modulelist="a b c d" major=101 card=`expr $i : 'tty.*\(.\)$'` for unit in $modulelist do moduleminor=`ttyminor $unit` moduleminor=`expr $moduleminor % 10 \* 16` modulename=$unit for unit in $portlist do minor=`ttyminor $unit` minor=`expr $card \* 65536 + $minor + $moduleminor` name=$card$modulename$unit rm -f tty*M$name mknod ttyM$name c $major $minor mknod ttyiM$name c $major `expr $minor + 64` mknod ttylM$name c $major `expr $minor + 128` done done ;; cuaM?) umask 7 portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" modulelist="a b c d" major=101 card=`expr $i : 'cua.*\(.\)$'` for unit in $modulelist do moduleminor=`ttyminor $unit` moduleminor=`expr $moduleminor % 10 \* 16` modulename=$unit for unit in $portlist do minor=`ttyminor $unit` minor=`expr $card \* 65536 + $minor + $moduleminor` name=$card$modulename$unit rm -f cua*M$name mknod cuaM$name c $major `expr $minor + 262144` \ uucp:dialer mknod cuaiM$name c $major `expr $minor + 64 + 262144` \ uucp:dialer mknod cualM$name c $major `expr $minor + 128 + 262144` \ uucp:dialer done done umask 77 ;; ttyR?) major=81 BOARD=1; Rnum=0 MINOR=$(($BOARD * 65536)) controllers=$( dmesg | while read first rest; do case "$first" in RocketPort[0-4]) echo "$first" ;; esac done ) rm -f /dev/ttyR* /dev/ttyiR* /dev/ttylR* for i in $controllers; do ndevices=$( dmesg | while read first bar ports rest; do case "$first" in $i*) echo "$ports" ;; esac done ) echo -n "Creating $ndevices devices for $i: " dev=0 while [ $dev -lt $ndevices ]; do mknod /dev/ttyR$Rnum c $major $MINOR mknod /dev/ttyiR$Rnum c $major $(($MINOR + 32)) mknod /dev/ttylR$Rnum c $major $(($MINOR + 64)) Rnum=$(($Rnum + 1)) MINOR=$(($MINOR + 1)) dev=$(($dev + 1)) done BOARD=$(($BOARD + 1)) MINOR=$(($BOARD * 65536)) echo " " done ;; cuaR?) major=81 BOARD=1; Rnum=0 MINOR=$(($BOARD * 65536)) controllers=$( dmesg | while read first rest; do case "$first" in RocketPort[0-4]) echo "$first" ;; esac done ) rm -f /dev/cuaR* /dev/cuaiR* /dev/cualR* for i in $controllers; do ndevices=$( dmesg | while read first bar ports rest; do case "$first" in $i*) echo "$ports" ;; esac done ) echo -n "Creating $ndevices devices for $i: " dev=0 while [ $dev -lt $ndevices ]; do mknod /dev/cuaR$Rnum c $major $(($MINOR + 128)) uucp:dialer mknod /dev/cuaiR$Rnum c $major $(($MINOR + 128 + 32)) \ uucp:dialer mknod /dev/cualR$Rnum c $major $(($MINOR + 128 + 64)) \ uucp:dialer Rnum=$(($Rnum + 1)) MINOR=$(($MINOR + 1)) dev=$(($dev + 1)) done BOARD=$(($BOARD + 1)) MINOR=$(($BOARD * 65536)) echo " " done ;; mse*) unit=`expr $i : 'mse\(.*\)'` chr=27 mknod mse$unit c $chr `expr $unit '*' 2 + 1` # non-blocking for X11 ;; psm*) unit=`expr $i : 'psm\(.*\)'` chr=21 mknod psm$unit c $chr `expr $unit '*' 2 + 1` # non-blocking for X11 ;; mouse*) name=`expr $i : 'mouse\(.*\)'` if [ ! -c $name ]; then $0 $name # make the appropriate device fi ln -fs $name mouse ;; pcaudio) mknod pcaudio c 24 0 mknod pcaudioctl c 24 128 ;; socksys) mknod socksys c 41 0 mknod spx c 41 1 ln -fs socksys nfsd chmod 666 socksys nfsd spx ;; snd*) # # changes from Linux voxware # minor Linux FreeBSD # 8 sequencer2 (aka music0) music0 # 17 patmgr0 sequencer1 # 33 patmgr1 sequencer2 # unit=`expr $i : 'snd\(.*\)'` chr=30 # XXX write this less verbosely, like std snd_security_hole=0 # XXX umask $snd_security_hole ln -fs mixer$unit mixer ln -fs sequencer$unit sequencer ln -fs dsp$unit dsp ln -fs audio$unit audio ln -fs dspW$unit dspW ln -fs music$unit music ln -fs pss$unit pss mknod mixer$unit c $chr `expr $unit '*' 16 + 0` mknod sequencer$unit c $chr `expr $unit '*' 16 + 1` mknod midi$unit c $chr `expr $unit '*' 16 + 2` mknod dsp$unit c $chr `expr $unit '*' 16 + 3` mknod audio$unit c $chr `expr $unit '*' 16 + 4` mknod dspW$unit c $chr `expr $unit '*' 16 + 5` mknod sndstat c $chr 6 # minor number 7 is unused mknod music$unit c $chr `expr $unit '*' 16 + 8` mknod pss$unit c $chr `expr $unit '*' 16 + 9` # minor numbers 10-15 are unused umask 77 ;; vat) mknod vatio c 25 128 chmod 660 vatio ;; gsc*) unit=`expr $i : 'gsc\(.*\)'` mknod gsc${unit} c 47 $unit mknod gsc${unit}p c 47 $(($unit + 8)) mknod gsc${unit}d c 47 $(($unit + 32)) mknod gsc${unit}pd c 47 $(($unit + 40)) chmod 666 gsc${unit}* ;; apm) mknod apm c 39 0 root:operator chmod 664 apm ;; apmctl) mknod apmctl c 39 8 root:operator chmod 660 apmctl ;; card*) unit=`expr $i : 'card\(.*\)'` chr=50 mknod card$unit c $chr $unit chmod 644 card$unit ;; ttyx?|ttyy?|ttyz?) case $i in *0) unit=0;; *1) unit=1;; *2) unit=2;; *3) unit=3;; *4) unit=4;; *5) unit=5;; *6) unit=6;; *7) unit=7;; *8) unit=8;; *9) unit=9;; *a) unit=10;; *b) unit=11;; *c) unit=12;; *d) unit=13;; *e) unit=14;; *f) unit=15;; esac case $i in ttyy?) unit=`expr $unit \+ 16`;; ttyz?) unit=`expr $unit \+ 32`;; esac mknod $i c 42 $unit ;; cronyx) mknod cronyx c 42 63 ;; joy) mknod joy0 c 51 0 root:operator mknod joy1 c 51 1 root:operator chmod 640 joy0 joy1 ;; spigot) mknod spigot c 11 0 chmod 444 spigot ;; ctx?) unit=`expr $i : 'ctx\(.*\)'` mknod ctx$unit c 40 $unit chmod 444 ctx$unit ;; meteor?) unit=`expr $i : 'meteor\(.*\)'` mknod meteor$unit c 67 $unit chmod 444 meteor$unit ;; bktr?) unit=`expr $i : 'bktr\(.*\)'` mknod bktr$unit c 92 $unit mknod tuner$unit c 92 $((16 + $unit )) mknod vbi$unit c 92 $((32 + $unit )) chmod 444 bktr$unit tuner$unit vbi$unit ;; tun*) ntun=`expr $i : 'tun\(.*\)$'` unit=0 while [ $unit -le $ntun ]; do mknod tun$unit c 52 $unit uucp:dialer unit=$(($unit + 1)) done ;; tap*) ntap=`expr $i : 'tap\(.*\)$'` unit=0 while [ $unit -le $ntap ]; do mknod tap$unit c 149 $unit root:network unit=$(($unit + 1)) done ;; sysmouse) mknod sysmouse c 12 128 mknod consolectl c 12 255 ;; snp?) unit=`expr $i : 'snp\(.*\)'` mknod snp$unit c 53 $unit ;; # dufault@hda.com: If I do much more work on other A-D boards # then eventually we'll have a "ad" and "dio" interface and some of these # "labpcaio" ones will be gone. # labpcaio: D-A and A-D. # labpcdio: Digital in and Digital out. # labpc*) umask 7 case $i in labpcaio*) name=labpcaio unit=`expr $i : 'labpcaio\(.*\)'` all="0 1 2 3 4 5 6 7" offset=0 ;; labpcdio*) name=labpcdio unit=`expr $i : 'labpcdio\(.*\)'` all="0 1 2 3" offset=8 ;; *) die 3 "Don't know LabPC type $i" ;; esac if [ -z "${unit}" ]; then unit=all fi case $unit in 0|1|2|3|4|5|6|7) mknod $name$unit c 66 `expr $offset + $unit ` ;; all) for i in $all do mknod $name$i c 66 `expr $offset + $i ` done ;; *) echo "No such LabPC unit: $unit" ;; esac umask 77 ;; perfmon) mknod perfmon c 2 32 root:kmem chmod 640 perfmon ;; ipl) mknod ipl c 79 0 mknod ipnat c 79 1 mknod ipstate c 79 2 mknod ipauth c 79 3 ;; kbd*) unit=`expr $i : 'kbd\(.*\)'` chr=112 mknod kbd$unit c $chr $unit ;; i4b) mknod i4b c 60 0 ;; i4bctl) mknod i4bctl c 55 0 ;; i4brbch*) unit=`expr $i : 'i4brbch\(.*\)'` mknod i4brbch$unit c 57 $unit ;; i4bteld*) offset=64 unit=`expr $i : 'i4bteld\(.*\)'` mknod i4bteld$unit c 56 `expr  . ..MAKEDEVconsolekmemd  memnulld random urandom zerod io ttyklogd stdin stdoutstderr pci fd fd0rfd0fd0arfd0afd0brfd0bfd0crfd0cfd0drfd0dfd0erfd0efd0frfd0ffd0grfd0gfd0hrfd0hfd0.1720H rfd0.1720 fd0.1480H  rfd0.1480!fd0.1440H! rfd0.1440"fd0.1200H" rfd0.1200#fd0.820#rfd0.820$fd0.800$rfd0.800%fd0.720%rfd0.720&fd0.360&rfd0.360'fd0.640'rfd0.640(fd0.1232H( rfd0.1232) da0)rda0*da0ad *rda0a+da0bd +rda0b,da0cd ,rda0c-da0dd -rda0d.da0ed .rda0e/da0fd /rda0f0da0gd 0rda0g1da0hd 1rda0h2da0s1 2rda0s13da0s2 3rda0s24da0s3 4rda0s35da0s4 5rda0s46 ad06rad07ad0ad 7rad0a8ad0bd 8rad0b9ad0cd 9rad0c:ad0dd :rad0d;ad0ed ;rad0e<ad0fd <rad0f=ad0gd =rad0g>ad0hd >rad0h?ad0s1 ?rad0s1@ad0s2 @rad0s2Aad0s3 Arad0s3Bad0s4 Brad0s4Cacd0a Dacd0c Cracd0aDracd0cEacd1a Facd1c Eracd1aFracd1cGafd0d Grafd0Hafd0a Hrafd0aIafd0b Irafd0bJafd0c Jrafd0cKafd0d Krafd0dLafd0e Lrafd0eMafd0f Mrafd0fNafd0g Nrafd0gOafd0h Orafd0hPafd0s1Prafd0s1Qafd0s2Qrafd0s2Rafd0s3Rrafd0s3Safd0s4Srafd0s4Trast0 Unrast0V wd0Vrwd0Wwd0ad Wrwd0aXwd0bd Xrwd0bYwd0cd Yrwd0cZwd0dd Zrwd0d[wd0ed [rwd0e\wd0fd \rwd0f]wd0gd ]rwd0g^wd0hd ^rwd0h_wd0s1 _rwd0s1`wd0s2 `rwd0s2awd0s3 arwd0s3bwd0s4 brwd0s4cwcd0a dwcd0c crwcd0adrwcd0cewfd0d erwfd0fwfd0a frwfd0agwfd0b grwfd0bhwfd0c hrwfd0ciwfd0d irwfd0djwfd0e jrwfd0ekwfd0f krwfd0flwfd0g lrwfd0gmwfd0h mrwfd0hnwfd0s1nrwfd0s1owfd0s2orwfd0s2pwfd0s3prwfd0s3qwfd0s4qrwfd0s4rrwst0 s vn0srvn0tvn0ad trvn0auvn0bd urvn0bvvn0cd vrvn0cwvn0dd wrvn0dxvn0ed xrvn0eyvn0fd yrvn0fzvn0gd zrvn0g{vn0hd {rvn0h|vn0s1 |rvn0s1}vn0s2 }rvn0s2~vn0s3 ~rvn0s3vn0s4 rvn0s4cd0ad cd0cd rcd0arcd0ccd1ad cd1cd rcd1arcd1csa0.ctlrsa0.ctlsa0.0 rsa0.0nsa0.0nrsa0.0esa0.0ersa0.0sa0.1 rsa0.1nsa0.1nrsa0.1esa0.1ersa0.1sa0.2 rsa0.2nsa0.2nrsa0.2 sa0esa0.2ersa0.2sa0.3 rsa0.3nsa0.3nrsa0.3esa0.3ersa0.3rsa0nsa0nrsa0esa0ersa0ttyv0 ttyv1 vgacuaa0 cuaia0cuala0ttyp0 ptyp0 ttyp1 ptyp1 ttyp2 ptyp2 ttyp3 ptyp3 ttyp4 ptyp4 ttyp5 ptyp5 ttyp6 ptyp6 ttyp7 ptyp7 ttyp8 ptyp8 ttyp9 ptyp9 ttypa ptypa ttypb ptypb ttypc ptypc ttypd ptypd ttype ptype ttypf ptypf ttypg ptypg ttyph ptyph ttypi ptypi ttypj ptypj ttypk ptypk ttypl ptypl ttypm ptypm ttypn ptypn ttypo ptypo ttypp ptypp ttypq ptypq ttypr ptypr ttyps ptyps ttypt ptypt ttypu ptypu ttypv ptypv ttyd0 ttyid0ttyld0kbd0d mse0d psm0d sysmouseH consolectllpt0d lpctl0ppi0d iic0d smb0d ums0d tun0d tap0d ch0 apmapmctlcard0 pass0 xpt0d i4bi4bctli4btrc0i4btrc1i4btel0i4bteld0Hi4brbch0H# $FreeBSD: src/etc/group,v 1.19 1999/08/27 23:23:41 peter Exp $ # wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: news:*:8: man:*:9: games:*:13: staff:*:20:root guest:*:31:root bind:*:53: uucp:*:66: xten:*:67:xten dialer:*:68: network:*:69: nogroup:*:65533: nobody:*:65534: ... ... ... . .. fixit_crunch catchmodchroot cp dd dfechoexprkill ln lsmkdir mv rmrmdirsleepsyncchownclri disklabeldmesgfdiskmknodmountrebootrestoreswaponumount mount_msdos mount_cd9660rrestorechgrp ftptelnet vigrepview extar ... ... ... . ..share . ..misc . .. scsi_modes#!/bin/sh -p # # Simple replacement for tar(1), using cpio(1). # # Copyright (c) 1996 Joerg Wunsch # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # # THIS SOFTWARE IS PROVIDED BY THE DEVELOPERS ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE DEVELOPERS BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # # For use on the fixit floppy. External programs required: # cpio(1), find(1), test(1) # # # $FreeBSD: src/release/scripts/tar.sh,v 1.5.2.1 2000/05/19 16:03:36 joerg Exp $ # archive=${TAPE:-/dev/rsa0} blocksize="20" device="" mode="none" verbose="" usage() { echo "usage: tar -{c|t|x} [-v] [-b blocksize] [-f archive] [files...]" 1>&2 exit 64 # EX_USAGE } # # Prepend a hyphen to the first arg if necessary, so the traditional form # ``tar xvf /dev/foobar'' will work, too. More kludgy legacy forms are not # supported however. # if [ $# -lt 1 ] ; then usage fi case "$1" in -*) break ;; *) tmp="$1" shift set -- -$tmp "$@" ;; esac while getopts "ctxvb:f:" option do case $option in [ctx]) if [ $mode = "none" ] ; then mode=$option else usage fi ;; v) verbose="-v" ;; b) blocksize="${OPTARG}" ;; f) archive="${OPTARG## }" ;; *) usage ;; esac done shift $(($OPTIND - 1)) if [ "X${archive}" != "X-" ] ; then device="-F ${archive}" # else: use stdin or stdout, which is the default for cpio fi case $mode in none) usage ;; t) exec cpio -it $verbose $device --block-size="$blocksize" "$@" ;; x) exec cpio -idmu $verbose $device --block-size="$blocksize" "$@" ;; c) if [ $# -eq 0 ] ; then # use current dir -- slightly bogus set -- "." fi find "$@" -print |\ cpio -o -H ustar $verbose $device --block-size="$blocksize" exit $? ;; esac ... . .. protocolsgroupspwd.dbservices# # Internet protocols # # $FreeBSD: src/etc/protocols,v 1.13.2.1 2000/09/24 11:26:39 asmodai Exp $ # from: @(#)protocols 5.1 (Berkeley) 4/17/89 # # See also http://www.isi.edu/in-notes/iana/assignments/protocol-numbers # ip 0 IP # internet protocol, pseudo protocol number #hopopt 0 HOPOPT # hop-by-hop options for ipv6 icmp 1 ICMP # internet control message protocol igmp 2 IGMP # internet group management protocol ggp 3 GGP # gateway-gateway protocol ipencap 4 IP-ENCAP # IP encapsulated in IP (officially ``IP'') st2 5 ST2 # ST2 datagram mode (RFC 1819) tcp 6 TCP # transmission control protocol cbt 7 CBT # CBT, Tony Ballardie egp 8 EGP # exterior gateway protocol igp 9 IGP # any private interior gateway (Cisco: for IGRP) bbn-rcc 10 BBN-RCC-MON # BBN RCC Monitoring nvp 11 NVP-II # Network Voice Protocol pup 12 PUP # PARC universal packet protocol argus 13 ARGUS # ARGUS emcon 14 EMCON # EMCON xnet 15 XNET # Cross Net Debugger chaos 16 CHAOS # Chaos udp 17 UDP # user datagram protocol mux 18 MUX # Multiplexing protocol dcn 19 DCN-MEAS # DCN Measurement Subsystems hmp 20 HMP # host monitoring protocol prm 21 PRM # packet radio measurement protocol xns-idp 22 XNS-IDP # Xerox NS IDP trunk-1 23 TRUNK-1 # Trunk-1 trunk-2 24 TRUNK-2 # Trunk-2 leaf-1 25 LEAF-1 # Leaf-1 leaf-2 26 LEAF-2 # Leaf-2 rdp 27 RDP # "reliable datagram" protocol irtp 28 IRTP # Internet Reliable Transaction Protocol iso-tp4 29 ISO-TP4 # ISO Transport Protocol Class 4 netblt 30 NETBLT # Bulk Data Transfer Protocol mfe-nsp 31 MFE-NSP # MFE Network Services Protocol merit-inp 32 MERIT-INP # MERIT Internodal Protocol sep 33 SEP # Sequential Exchange Protocol 3pc 34 3PC # Third Party Connect Protocol idpr 35 IDPR # Inter-Domain Policy Routing Protocol xtp 36 XTP # Xpress Tranfer Protocol ddp 37 DDP # Datagram Delivery Protocol idpr-cmtp 38 IDPR-CMTP # IDPR Control Message Transport Proto tp++ 39 TP++ # TP++ Transport Protocol il 40 IL # IL Transport Protocol ipv6 41 IPV6 # ipv6 sdrp 42 SDRP # Source Demand Routing Protocol ipv6-route 43 IPV6-ROUTE # routing header for ipv6 ipv6-frag 44 IPV6-FRAG # fragment header for ipv6 idrp 45 IDRP # Inter-Domain Routing Protocol rsvp 46 RSVP # Resource ReSerVation Protocol gre 47 GRE # Generic Routing Encapsulation mhrp 48 MHRP # Mobile Host Routing Protocol bna 49 BNA # BNA esp 50 ESP # encapsulating security payload ah 51 AH # authentication header i-nlsp 52 I-NLSP # Integrated Net Layer Security TUBA swipe 53 SWIPE # IP with Encryption narp 54 NARP # NBMA Address Resolution Protocol mobile 55 MOBILE # IP Mobility tlsp 56 TLSP # Transport Layer Security Protocol skip 57 SKIP # SKIP ipv6-icmp 58 IPV6-ICMP # ICMP for IPv6 ipv6-nonxt 59 IPV6-NONXT # no next header for ipv6 ipv6-opts 60 IPV6-OPTS # destination options for ipv6 # 61 # any host internal protocol cftp 62 CFTP # CFTP # 63 # any local network sat-expak 64 SAT-EXPAK # SATNET and Backroom EXPAK kryptolan 65 KRYPTOLAN # Kryptolan rvd 66 RVD # MIT Remote Virtual Disk Protocol ippc 67 IPPC # Internet Pluribus Packet Core # 68 # any distributed file system sat-mon 69 SAT-MON # SATNET Monitoring visa 70 VISA # VISA Protocol ipcv 71 IPCV # Internet Packet Core Utility cpnx 72 CPNX # Computer Protocol Network Executive cphb 73 CPHB # Computer Protocol Heart Beat wsn 74 WSN # Wang Span Network pvp 75 PVP # Packet Video Protocol br-sat-mon 76 BR-SAT-MON # Backroom SATNET Monitoring sun-nd 77 SUN-ND # SUN ND PROTOCOL-Temporary wb-mon 78 WB-MON # WIDEBAND Monitoring wb-expak 79 WB-EXPAK # WIDEBAND EXPAK iso-ip 80 ISO-IP # ISO Internet Protocol vmtp 81 VMTP # Versatile Message Transport secure-vmtp 82 SECURE-VMTP # SECURE-VMTP vines 83 VINES # VINES ttp 84 TTP # TTP nsfnet-igp 85 NSFNET-IGP # NSFNET-IGP dgp 86 DGP # Dissimilar Gateway Protocol tcf 87 TCF # TCF eigrp 88 EIGRP # Enhanced Interior Routing Protocol (Cisco) ospf 89 OSPFIGP # Open Shortest Path First IGP sprite-rpc 90 Sprite-RPC # Sprite RPC Protocol larp 91 LARP # Locus Address Resolution Protocol mtp 92 MTP # Mul# # Network services, Internet style # # Stripped-down version. # # $FreeBSD: src/release/fixit.services,v 1.4 1999/08/28 01:33:10 peter Exp $ # # WELL KNOWN PORT NUMBERS # echo 7/tcp echo 7/udp discard 9/tcp sink null discard 9/udp sink null systat 11/tcp users #Active Users systat 11/udp users #Active Users daytime 13/tcp daytime 13/udp chargen 19/tcp ttytst source #Character Generator chargen 19/udp ttytst source #Character Generator ftp-data 20/tcp #File Transfer [Default Data] ftp-data 20/udp #File Transfer [Default Data] ftp 21/tcp #File Transfer [Control] ftp 21/udp #File Transfer [Control] ssh 22/tcp #Secure Shell Login ssh 22/udp #Secure Shell Login telnet 23/tcp telnet 23/udp # 24/tcp any private mail system # 24/udp any private mail system smtp 25/tcp mail #Simple Mail Transfer smtp 25/udp mail #Simple Mail Transfer time 37/tcp timserver time 37/udp timserver domain 53/tcp #Domain Name Server domain 53/udp #Domain Name Server bootps 67/tcp dhcps #Bootstrap Protocol Server bootps 67/udp dhcps #Bootstrap Protocol Server bootpc 68/tcp dhcpc #Bootstrap Protocol Client bootpc 68/udp dhcpc #Bootstrap Protocol Client tftp 69/tcp #Trivial File Transfer tftp 69/udp #Trivial File Transfer gopher 70/tcp gopher 70/udp finger 79/tcp finger 79/udp http 80/tcp www www-http #World Wide Web HTTP http 80/udp www www-http #World Wide Web HTTP sunrpc 111/tcp rpcbind #SUN Remote Procedure Call sunrpc 111/udp rpcbind #SUN Remote Procedure Call auth 113/tcp ident tap #Authentication Service auth 113/udp ident tap #Authentication Service nntp 119/tcp usenet #Network News Transfer Protocol nntp 119/udp usenet #Network News Transfer Protocol rmt 411/tcp #Remote MT Protocol rmt 411/udp #Remote MT Protocol https 443/tcp https 443/udp # # Berkeley-specific services # exec 512/tcp #remote process execution; # authentication performed using # passwords and UNIX loppgin names biff 512/udp comsat #used by mail system to notify users # of new mail received; currently # receives messages only from # processes on the same machine login 513/tcp #remote login a la telnet; # automatic authentication performed # based on priviledged port numbers # and distributed data bases which # identify "authentication domains" who 513/udp whod #maintains data bases showing who's # logged in to machines on a local # net and the load average of the # machine cmd 514/tcp shell #like exec, but automatic # authentication is performed as for # login server syslog 514/udp printer 515/tcp spooler printer 515/udp spooler talk 517/tcp #like tenex link, but across # machine - unfortunately, doesn't # use link protocol (this is actually # just a rendezvous port from which a # tcp connection is established) talk 517/udp #like tenex link, but across # machine - unfortunately, doesn't # use link protocol (this is actually # just a rendezvous port from which a # tcp connection is established) ntalk 518/tcp ntalk 518/udp utime 519/tcp unixtime utime 519/udp unixtime efs 520/tcp #extended file name server router 520/udp route routed #local routing process (on site); # uses variant of Xerox NS routing # information protocol uucp 540/tcp uucpd uucp 540/udp uucpd uucp-rlogin 541/tcp uucp-rlogin 541/udp klogin 543/tcp # Kerberos (v4/v5) klogin 543/udp # Kerberos (v4/v5) kshell 544/tcp krcmd # Kerberos (v4/v5) kshell 544/udp krcmd # Kerberos (v4/v5) # SCSI mode page data base. # Copyright (c) 1995 HD Associates # (contact: dufault@hda.com) # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. The name of HD Associates # may not be used to endorse or promote products derived from this software # without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY HD ASSOCIATES ``AS IS'' AND # ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE # IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE # ARE DISCLAIMED. IN NO EVENT SHALL HD ASSOCIATES BE LIABLE # FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL # DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS # OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) # HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT # LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY # OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF # SUCH DAMAGE. # # $FreeBSD: src/share/misc/scsi_modes,v 1.6.6.1 2000/08/14 05:42:33 kbyanc Exp $ # # The ordering is alphabetical by page name, as it appears in the SCSI spec. # ALL DEVICE TYPES 0x0a "Control Mode Page" { {Reserved} *t7 {RLEC} t1 {Queue Algorithm Modifier} t4 {Reserved} *t2 {QErr} t1 {DQue} t1 {EECA} t1 {Reserved} *t4 {RAENP} t1 {UAAENP} t1 {EAENP} t1 {Reserved} *i1 {Ready AEN Holdoff Period} i2 } 0x02 "Disconnect-Reconnect Page" { {Buffer Full Ratio} i1 {Buffer Empty Ratio} i1 {Bus Inactivity Limit} i2 {Disconnect Time Limit} i2 {Connect Time Limit} i2 {Maximum Burst Size} i2 {Reserved} *t6 {DTDC} t2 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 } 0x09 "Peripheral Device Page" { {Interface Identifier} i2 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 } # DIRECT ACCESS DEVICES 0x08 "Caching Page" { {IC} t1 {ABPF} t1 {CAP} t1 {DISC} t1 {SIZE} t1 {WCE} t1 {MF} t1 {RCD} t1 {Demand Retention Priority} t4 {Write Retention Priority} t4 {Disable Pre-fetch Transfer Length} i2 {Minimum Pre-fetch} i2 {Maximum Pre-fetch} i2 {Maximum Pre-fetch Ceiling} i2 } 0x05 "Flexible Disk Page" { {Transfer rate} i2 {Number of heads} i1 {Sectors per track} i1 {Data bytes per sector} i2 {Number of cylinders} i2 {Starting cylinder-write precompensation} i2 {Starting cylinder-reduced write current} i2 {Drive step rate} i2 {Drive step pulse width} i1 {Head settle delay} i2 {Motor on delay} i1 {Motor off delay} i1 {TRDY} t1 {SSN} t1 {MO} t1 {Reserved} *t5 {Reserved} *t4 {SPC} t4 {Write Compensation} i1 {Head load delay} i1 {Head unload delay} i1 {Pin 34} t4 {Pin 2} t4 {Pin 4} t4 {Pin 1} t4 {Medium rotation rate} i2 {Reserved} *i1 {Reserved} *i1 } 0x03 "Format Device Page" { {Tracks per Zone} i2 {Alternate Sectors per Zone} i2 {Alternate Tracks per Zone} i2 {Alternate Tracks per Logical Unit} i2 {Sectors per Track} i2 {Data Bytes per Physical Sector} i2 {Interleave} i2 {Track Skew Factor} i2 {Cylinder Skew Factor} i2 {SSEC} t1 {HSEC} t1 {RMB} t1 {SURF} t1 {Reserved} *t4 } 0x0b "Medium Types Supported Page" { {Reserved} *i1 {Reserved} *i1 {Medium type one supported} i1 {Medium type two supported} i1 {Medium type three supported} i1 {Medium type four supported} i1 } # Notch page (0x0c) 0x0c "Notch and Partition Page"; 0x01 "Read-Write Error Recovery Page" { {AWRE (Auto Write Reallocation Enbld)} t1 {ARRE (Auto Read Reallocation Enbld)} t1 {TB (Transfer Block)} t1 {RC (Read Continuous)} t1 {EER (Enable Early Recovery)} t1 {PER (Post Error)} t1 {DT: # $FreeBSD: src/release/fixit.profile,v 1.8 1999/08/28 01:33:10 peter Exp $ export BLOCKSIZE=K export PS1="Fixit# " export EDITOR="/mnt2/stand/vi" export PAGER="/mnt2/stand/more" export SCSI_MODES="/mnt2/usr/share/misc/scsi_modes" # the root MFS doesn't have /dev/nrsa0, pick a better default for mt(1) export TAPE=/mnt2/dev/nrsa0 alias ls="ls -F" alias ll="ls -l" alias m="more -e" echo '+---------------------------------------------------------------+' echo '| You are now running from a FreeBSD "fixit" floppy. |' echo '| ------------------------------------------------------------- |' echo "| When you're finished with this shell, please type exit. |" echo '| The fixit floppy itself is mounted as /mnt2. |' echo '| |' echo '| You might want to symlink /mnt/etc/*pwd.db and /mnt/etc/group |' echo '| to /etc after mounting a root filesystem from your disk. |' echo '| tar(1) will not restore all permissions correctly otherwise! |' echo '| |' echo '| Note: you might use the arrow keys to browse through the |' echo '| command history of this shell. |' echo '+---------------------------------------------------------------+' echo echo 'Good Luck!' echo # Make the arrow keys work; everybody will love this. set -o emacs 2>/dev/null cd /  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x ELF FreeBSD4L|4 (JJJpFreeBSDxEUU WVSҍu^|=`~)}t#E8t8/u H @8ut R hl WVSgPa USg=gtv;uЃgw[ÉUSg=gtvЃ;u[ÐU WVS} ?t8uj/7+ pu7;t(3Vw u;tWuCvVh@mhMmhc e[^_ÉUVS]j/S ޅtp=t$3Vw u  v;u1e[^ÍvUVSu] SNVe[^ÍvU WVSh@mhmhc 1=tS;׍7Ohmhc 3hmhc ;uhmhc j_ Uuu uÐUVSu] hioj/] v$oggvggng`gTgg>jhXcp (ghohc j^ hjoSV 1HÃ=gu-=gu$=gu=gu=gu =gt SD ShXc{ thoj  5g] U WVS]cgp;t[ƿ pt7h pP% ƃu%3hpM g.cgV$ct Vz ;ue[^_UWVS}EE   uj=gtM}u9 `cxXcڈXcvhXcSQ ZE$=gt==gu4 =gt)EEPhphXcn dc@E u^=g}$ `cy `c;pc|XcʈXcvhXcj$P , =g^ `cy `c;pc|XcʈXchXcj^uP =I `cy `c;pc|XcʈhXcjI=gÀvS@  a4%M `cy `c;pc|XcʈXchXcjMO u- `cy `c;pc|XcʈXcvhXcj-aO )vS%@  a4%^ `cy `c;pc|XcʈXchXcj^N ?t @ `cy`c;pc| t Xcʈ/hXcQ: `cy`c;pc| tXcڈXchXcS^N t*OyWu  vPG @t$5ghp gg dc@thoj: e[^_U WVS]5cgp;t_ƿ pt7jjP ƃ}(3hp g4v5cgV.c9t VGX ;we[^_ÍvUlWVS=fc=gEPW t5ghpj2 E=sgPL guKhpj 1t6SgPWW }hoj v)ƅũ5g5gEPW Ã}5ghp6 ge[^_Uuu uÐU t}t<wsj jEPSѠ E} F "; 8tSh5qj E8tSh5qj EEE,Sd EuSh5qj EjWVR ǃu jjU 1C4H wz$Lrv}jSWR sz0 PshKq  .sR0 PshKqp  v}uC<@PEPa MʁC<@%9tOPs7 t }ushRq  v}tshUq W躷 Ãt 8thYqj EPI VS vUhrhc jS Uuu uÐUVSu] hsSV u䡈H)ƍ3c uhs t3hsj; v{t"CPs? shsj hsJ ÃusjhsSSw Shsj vUhshc jR Uuu uÐUWVSu1R.$|uDž<1Dž8Dž81Dž<Dž8Dž<fhYh hC hh+,h(hhhtE PV H)ƋU U =(htG=hthtj] <u 8uth uj7 v=ht<t8t1 hj %$h$hP NE װH =vRhduj RhH Huƀ. = v x/tۡE EPh ǃu%W 8thhvuj tE%f=@~ jO u=(hu=ht)8u <t@PU 2 @PE 0 H%f=@u=hu =(ht  v1SPU RPO U|WVSEhܘuuٮ Eujj vE`UB4w]$TwEp* PUrh8v* E vEph?v E} Ufz2u^} tNj/r1 ƒtE+PUE EuUr\vuE EP$UUEPp$+u:/t {/t/C-=~"Rhh`v; E(vVRS  = v x/tۃEPh u EPUrh w jEPUR EE =vt@UB<@ %Ph }Ghhvuj vE%f=@t" hhvuj_ v=,htjEp/ щƒ t5ihi bii v;iuii@jDj(bitiiiHjLj`it(iij8ibit+ithjljHPiPP ii4je[^ÐU=4ju u(v=4ju=4jDuKbitc=itci;isM`iti)‰Pj ii)‰Pj5i & ii=iu  t jÐU WVS=i}t iE iUvu1bi tB19s?u-@9s<8t1҅t}u5   }t j RP5i, uu5ihjw v}tjW5i)+  bVW5i* Ã;u5ih$j _ 8t5ihij 1߉ؙpjtj;]u U;iPjTjmXj\j9tZit5ih@j it)=Hhu Hh5ih` )/vi+Ei;iriEXj\j̃=itiPi)‰P5iج iiie[^_UWSjEP胱 EݝxE܅x%xjݕxEuݝx؃Xj\jRPPjTjRPHjLjRP@jDjRPhjd]Sp 0߰HPSj( hjhj Bt].=hju zu(PhjljRPh5jd]S#p ߰HPSjs( `j`j Bt].=`ju zu(P`jdjRPhMjd]So ߰HPSj( -pj۽`jjpjtjRP }-ۭ`۽`ۭ`]Eܵx$|xpjtjRPh`jd]So 0߰HPSjb' H[_USإ ̥ [ÍvU}%P=' UWVSi荥 ji1%iEUiEiEEURP5i( + 85ihj =ii5iEW5i5i_& ~$it)=iu4= u=v\h j% ait+}u=5ih E5ihj v 2e[^_ÉU VSi  ji1%jEUjEjEEURP5ir& 蘣 85ihj" itGfEUjBRhm5i6 5ihj jxS=jF5i5i5in$ u5ihji fEE@Phm5i舭 u5ihj' vj؉9Q9j5i5i5i# u5ihj ;it5ih%j vj؉9Qu,9jw"j9pu 9je[^ÐUuu uÐU|WVSDž5$hbhVkkvkkL{ mh+ h8 kEk9th`j` 5 vS hE PUR H)EU U jPt Dž1ۃ9}5H;~C9|DžU :PVPƃtIDž19}5H;~C9|19}>=uD2uRPjC9|ƒ􋅔P vEPU 2W }@ E 0nǃU 2h3 DžE%f= u61ۃPU 2Pu tE%f=`ZE 0ǃEU jh ƃuh DžpVg ǃuVhX DžShjjWh tK1ۃPU 2mu tWq V SW uƅPSU 2h DžjW: W V ovE 8PW蛥 }WhJ Dž6}uFщRPE E 8yx[^_U WVSjEPp 19}7EPEP4 u EL vF9|1e[^_ÐUWVSE}u"=kujPBp E EEE 9E}sURE4F-u2/2=wuU%v1u1Bt'H9rtU vEEe[^_UUHw r ÉU WVS}?tf?u_c j jwZ ÉE 8thj w _we[^_ÍvUVSuHvAjO Ãuhj{ vFVRPhS  ^e[^ÐUE8%ÐUWS48u 1v44߰uPhd tIW߰u3{=u-<u$SWPe[_ÉUVS];uC C%,1C8tSщ‰ t C Cue[^ÐUS] hj 4 H8uPHQRhHphW 5H>]ÐUhj vUVS]u S uV% Se[^ÉUVS]u SuVt&SV jjvV؍e[^ÉU WVSu} VuWt9VW wv 1RP>VSWJ F;GuF;G1QRÃVW؍e[^_ÉU WVS}u WuVt9WLVC vw 1RPBWV~ G;F uG;Fv QRÃWV؍e[^_ÉU WVSu} VuWt=V|Ws wvC 1RP|à KVW G;F uG;Fv QR/ÃVIW@؍e[^_ÉU WVSu} V$uWtMVW wvo Љ҉1RPà MvVW G;FuG;Fw QRKÃVeW\؍e[^_ÉU WVS}u W@uV0t9WV vw 1RPBWV G;FuG;Fw QR{ÃWV؍e[^_ÉU WVSu} VpuW`t9VW wv 1RP@V/W& F;GuF;Gt QRÃVW؍e[^_UWVSEU M]u}uvuv uv }}| v1[^_ÐU WVSu} Vhщƒ tWRщƒ uh̗jr FVGWRPÃCSRPGWRPFVRP(0thj" VW؍e[^_U WVSM] EUuu|1u}WV؃RPSQe[^_ÐU WVSu} V\щƒ tWFщƒ uh̗jf FV+GWRPÃCSRPGWRPFVRP(0thj VW؍e[^_UVSUM ]u tQREURPOz 9u9t1e[^ÍvUWVS]u S`щƒ tVJщƒ uh̗jj KfEUCFEFCEEURPǃGWRPFVRPCSRP0thj SVe[^_USEU M]uuuu v1[ÍvU WVS}u WTщƒ tV>щƒ uh̗j^ F FuhjE FVRPGWRPx RPÃCSRPFVRPGWRP 0thj WVz؍e[^_U WVS}u Wxщƒ tVbщƒ uh̗j F Fuhji FVRPGWRPu RPÃW V؍e[^_ÐU<WVS}W\E PP jE puV t&hSVP Shj vjEPjwEP u>E Eu6}|WEEGP6E؋U+EURP!}ujj hÃWE P EP֞ ؍[^_ÐUVS$u v'ہ'~'D58)tPR P\ tmDp8=TtP5T vP t(T0$DDX,1ve[^U WVS<(X=Du D8T01fu4=X}hX} Xu~Xy]̓;Xui8;,r G884]f000PX=(? (4uďt0Xx( ̓;Xu=(uh<=((8E~tcx[Sf<]̓uG;,r > 884]f000PH8;D80d=XX<])0@Ce$ @HO0@@<00p00p00p600p00p00p^00p*00pv00pb00pN00p:00p&00p00p"@?8)‰У80)0<]udu`88f00@=X}X} X=Xv} t$x ̓9u  4}z8;,r Zu*88f000@phg1e[^_ÐUuu uÐUWVS] }EM3%M}~b}=wuU%1u-j EP31I E8tE8t3h(j? v}~EEHv 3KE4|hB腿 j vhXcGj 3FuKM}h`B eָtRLE8-vR  a4%t3 E}qb=wuU%1tH`h7h`p\[hU RSs uHu 4u )ø n=ptll==pt-dtt Jt'AjhE 0Pb jU r2{PE u \EPS tShj- E%f=@tm1E 9t jSU 2 ǃE u 9uW vUlWVS} =puLEPEPX t EPE%f=@uv EPv}u"EPW  uKE%f=@u=j/EPB uE@PWhhS|? ߃ EPW~ %=`t tW v=hhXc Whhc cHyP  ccƃ t7t2cKyS cc tuԃytYthhc _W uWEPlЃtWh蔹 #=\tEPdPWhD 1[^_ÍvUhhhh#hca jd Uuu uÐUE @PE@P| ÉUE@PE @P\ ÉUUE H9t,fx2u#=uu u63xЍe[^ÍvUWVS}19s"vȉډF9rȉ[^_ÐUVSutPv{ t@vv S  `cxXcXchXcj - [ue[^UE=Ћu =t P '=uPh赦 vPÐU,WVSUfx2t8=u =t&UBH15PhZ E8UU w<=tvEp h =t6 AF8V<SQRPU RPUrh٥ EPFP9X _sUr3r,F Pr$EPh螥 0=܋tsUrh| F%f= tf=`u4F0=vPFPhcF0PFPh)NvExt/F0V4RPEP(Rh3)Ph4 F0V4RPUr(h =tv=t v( vv G@P=؋tFP1F%f=u W `cxXcXcvhXcj a e[^_ÍvUs Psh $ v= u3sE%f=@uSI %v= tEPSvSM ƃt.= t @ 8tSh $=tuSh $e[^_U|WVSDž} u]SEPhH !] U B%f=>jjEP' PRpH =} Dž􋕜R$ uhjD PhR蹺 E X0p4gv;u;w RPR 9)օuw􋅘PJ jjjR щƒ PjR E X0p4gv;u;w RPR辿 9)օuw􋅘PI jjjR щƒ PhR E X0p4`;u;w RPR 9uO)օuw􋅘P I u(􋕘R虾 u􋅔P菴 7$t􋕔Rj EPhB x[^_ÍvUWVS}u=tWh hc5I =t8F%f=t)ju G u FFuFDt =u 2EPFP1 vD à ujj~ vW;tP;tPjvb Pjv P} uPEPh hcIH 0S% hc虝 cHyP ccƃ t7t2cKyS cc tu1ytYue[^_ÍvUVS1];tnj/3J ƒBu:.uGzt z.u;zu5Fuh@ $Cu땃됍ve[^ÐUh`hhhcG j@ Uuu uÐU WVSu] 1?tpu vhSV5 uСH9u1;tC3B }3h0~ t3 ƃ;uV@ UWS]߰ЍDH9v8/t@4H9v8/t@S5B }Sh} j/SH u1e[_ÐUhhcE j螺 Uuu uÐUWVS]u vkhVSd4 u䡈H)Í4t@EvEvRş  a4%@tE͐1E8-uG vE8+uEE=wuU%1t&j EPu ~ 1ɉMEE8.u[]gfffvEE=wuU%1t!EC)‰uu}}~jEP j UhhcC jڸ Uuu uÐUYB j觸 Uuu uÐUWVS}] j/3F PuHzo%@(E/v7w`$ȭEOE1BE164)8Ev(shmSW1 xH)ǃD=4t5}t}uthjy vt}t0,=@tDj:3踕 uj.3襕 t@P3( 3jWS ǃujjw v1eC4H $v=4?jSW +s Pshz  8sʑ Pshy  v}=,t S<,;B u=0S<0;B}t<505,s; tZ=8uQsXv505,sU@ t=8usRv=(tshv W Ã3 8thj9v V vUS];t1<S uhܮSUv@0]ÍvUS];t)Sl uhS@,]ÍvUVSu2 j EPV运 2 8tVhj`u E8tu VhjPv ؍e[^ÍvUTS]2 8u =,t'=u1> tShjt =0ts=uj=ua= tSEPje< M0 x;u=}5<hju Shv ]ÐUh@hhhhc> j Uuu u)ÐUhhc= j U WVS}E E jjP }Rh"js jjh Q蟳 }Ph"jjs h PR- = tQh%j5t \Tt"hT\Ph@jt S0E M 9vE 0 ƃU 2hjs Vh*s ׉C!CS{xK`Kd t1 jRPQT }Ph"jr vRPQ߰ ;tPh"jq {x(VlB1 VljؙRPP趱 }Rh"jq QPP/ ;tRh"jBq QE: E E 8BRǯ j Uuu uÐU,WVSDž1v8$=LtB&L=Lt&&Lc=Lt &LG=Lt%L+!=Lt%L%hOE PUR( H)EM M =t=Lu4L(=Lu L}.%U 8/tCjcPh[ha5H HװУH =L%P5 ,, 8ug8/t]Ph[hh5[ װH=L%PRi }5hmjJn =LL$hv}t#RÃQSZvDžPhmdP6 hpjm }tu#RÃShXc S&/=t7}u1hjM q$Ehh6 }t"hE p"t uU rhmjm hPnu jͫ QhhÉ߾EShP Nv}u U ZE}t:"hSM q*PhhIÉ߾E SDžPhmdR?4 hpjk QÍE}uhjE pmRhhÉߍES uShP>R" U WVS]uuEP' uMQhjk ߉E=uD{t>C8/tPhhhX sh =uC{t=C8/tPhhh sh蔡 jsV3 } tjE PV e[^_ÐUVSu]SWEVǃWEVfǃS f =ShfdV1 }"& 8t& 8thjjjV蔩 EEPhmdV1 }hpj u V ;u)=t655Vݧ ;thj LEEPhmdV1 -ShgdV 1 }hƴ1e[^ÍvUS]% tRtmtSt`Sh״j hSh@j hhc2 0Shj jcShj ji ]ÐUSE=h hP趦 =5hmjg vwg=WEVuWEVt"vwA;WEVu큻WEVuw%;WEVuWEVuSft޿% u5Qz M fANv޿2 uEP2 }SRQVU BPv޿=uaQ }1SPRhhc >M AT+v<{ŸM 9vPhQU u QwSiuS }$SPhhc  u'Rhhc SSuSe }$SQhhca  GSp,s$tSPħ tE,r=wuU%1t"S -EDžv,Sh@Phahc Dž G G  t uRhvSQuS GsuQhCSS 1wG #vuPhvSuS5 GuRhSMuS 1wG uQh<vSS fG%uPhvSuS= GuRhSUuS 1wG uQhGSS fG4v-U fB!SQhhc EPhP$V 9U R%[^_UWVS}E(u h,u h0uhƼhc 4uhټhc EfHuhR8u G,G0G8<u G8G4G<uhhcp Ev1w(th uhDhc. E1w(th`fvjPh1faE;u{tsEPhEC;GEE}t EЋUԣ SQRPSщ‰ tVhj? =t51s EЋUԣPr uVh j ve[^_U WVS]F=\1߅u^=)ډV FPFPFPRS% FPFPFPF PFHPe[^_ÐUWVSEEPh`= EP =hm r=t;jSb }u'jh"= j5EECPEPh tECsEPh tECs EPhp tEC h 3sC$%CEC$?VEPhE tuEPEPhXtEEWEPhgt}C?$ˆSECsC$%CEC$?VEPhxtuEPEPh`tEEWEPhAt}C$?ЈCECRS'uCCPCPCPs sz CPCPCPC PCHPZ EPhe[^_Uh: 5555h: 0=?= =~h@s: hc: 5555h>: UVSh.txSEPht]Cvh9 Éh@t1҉B~Cw De[^Uh`tÍvUShk]5ShtE5ShtE5ShtEh@i]U WVS}u}u} uEMvE=)EE=)EEU?%‹M[^_ÐUtSEP53 Ãu5hE u5h@9 =u=u=u}t1P5 u!h8uD5hc*j t v5h]9 ]ÍvUSEU ]j RP5v =uB5S5Gu ;t5=~v5S5u ]ÉUSEU ]j RP5v 5S5t ]UhhedA5 t^ s5h7 UWV=t5{i 5jh u hX5jjƃu h 2fUu1h`6 e^_ÍvU WVS=t&jPvh5 {v=Ǿ1+vPRPÃtGRPRPӉ9u9w1e[^_UWVuh3 hcjdh : װD= tUֿt9ֿt&ֿtֿu 1e^_ÍvU WVSu1ۉVEPh"3 hcjdh : װD = t&  At t tu1dAtBЃ w \Bv t uAt( t tth h l2 0E e[^_ÉUVSu41ɺ(9uB A9|N[^ÍvU WVSu ]1vRU va4%@tCύv;;#CvRU va4%@uЀ;#vRuU  a4%t VD2C=wuU%1t6EjEPSX ‹FT0 ;]t ]F9e[^_U WVS}1ۋu UDvW5h @=t5h`ExS5h 1 1e[^_UWVSuEpEjS NKVSF$C <ujS EuC15t_5;=r +9vEP5hm0 +PsEPh@N0 5sC C15;Cwh0 1+s;s tVs EPh / s { uEP5h/ CPCPCPs s CPCPCPC PCHPEP~t5h`i/ *vF EHXEP5h=/ Ee[^_ÉUSE1*1ҐB~DGxt5h. 1 H AvQ5h. ؋]ÉUdSEPuaEuEPF;u|ȃEPb }t U11E 0 EuU 2hj$ vELP ÃtmEP3x u*ELPsx u}Ǧ*U 8/uxuh# þ;tEp0s EPEp0jUR EjEPURELPWE

ÃuE 0hjU# Cƿt:ƿt'ƿtU 2hj# s EPURs3sQ}u5h E 0 tjU 2 u#jEPURE p0VE  } uxh'h)^( Ãt]EPh=S u7}~1ju uo8th@j! vS} UR_ U WVS}G8/uxt]]KxWu ƍFLPw;v u4w9tP7v u vKy1e[^_ÍvUVSu`=`t'vV3u u  v;u1e[^ÍvU WVS] ;nu{ou v1u: E1=8nuxouSP uSP u1h4PBuEPCT e[^_ÐU WVSu}lSu$`uFu?tFVW: P\`1t uMEthG\RO\}th\P'\UthM\W\DžhhpUhShP\WnhE hh`hh=tY}WhT` ;h}$p4hc8 C;h|hg qÃt t0cvhi \P R 3u9u pPhx P \ t=tt=lUR3hnhVK pPV ;u$81һt=ttv;)ʃ;uRUP ǃuhzj t=tt0v3WA: {thW*: ;uӃWURh j[ \WP jdPS_ }hvdudt<vdt&t"4}`Ph/ q=tfpP`R] }`Wh 0v=tpPppP 1H[^_U WVS}GuՃ(t>h w( t 0h w(h= =tP4u8tw8w4h u th h e[^_ÍvU WVS}jEPn X|GWEP?o tWELP&o u EKy1e[^_ÍvU WVS]u t>uth;tc߰҉‰URL ǃuhzj vVSh!EPWP vV3 ǃt SM e[^_ÍvU WVSEU EP8tI8-u"UCj=P6 t+@UƿtU'CCh4EP襧 uE e[^_ÐUWVS}uhF3 vh*E Ph0E P uEEEEJ*߹u E P 0߹u EPSEPEh4EP̦ ÃuEP#L EPL 1EE v߰ЃPJ ǃuhzj 8f:GSW4 WVv WK jSh8 uCPVFSV1ƃh4EP ÃFEP>K e[^_U WVSE} t\8tWtS?tNƉu*SWk t>,u;tFCFuN,h4EPe Ãue[^_ÐUh@hhh hc jT U WVSEp0ƃVEnu~ou EEj=V. t@] ;tdװЍxWRV uы<t<=uÃ;t*U{ tUE;Cu [ +vC!v=uVhj v1hVLƃEPGE e[^_ÍvUSUM ˀ:tB:/uz/tBA:u)؃~ y/uA[ÉUtS] Su^t3EPS uE%f=@t1Shj@ ,09* PShj@ v]ÐUVSu] u#13*3Ve t;u=%e[^U WVS]u1;nu{ou 1؀8tv8,uF@8uPB ǃuh 11؉ @Fj,PI, ue[^_ÐUuu uÐU WVShgj/E 0 PuE R tv11E1B2w4$d)"E@ #hlE PEPu%=uhj t jj tVjj vup Åu P߀ t=tj"jhg/ Shj"jh Shj hhh}u jj_ uhj jjK jj0 uhj jnX }u jVX P@X Cj j u 8t&~˃h hc Vi0s& Pjjz uHRh_j vU=tgPh0hc jJ Uuu uÐUVS)j?J }h;A Ãu@E PEPB+t$ j P5ǔ p8t5h^j v=phj =tPRhjZ j P5 8t5hj = 8h j hJu uƒZH)EE =uh`jd hjG ujjG hjsG ujj_G hcSG }uEE E &$vIj)joD gI=l~z=thhXcK V+DjU) %=thhXc h<jh7,&!q"jv=thhXc jCj( =thhXc h<jh+V"$&j4 V'=t5=thhXc> hTjhc+jVy@oVBX +V " %j3&jV2@ (Gj'jB M}hVE 0E  Vrà thԳSV*M}uv?Gj]'jB M}t`hVE 0E  VTrà t'=t V9ihTSV*M}u~"m$j2=t%j7Uhhh@hhhhcg j7UWVSE 0UNM9-wP9 ËE t(}@P8 EEujj vEU:vMuUPh ? >ЃPG8 ujjn -MB6P; %}uE-EEUMEEE82}tUM u؋U +HMe[^_ÐU@ WSEEE@EE\E\EEhPhh@F t7}tEEEPn (EPhPPPv 93$װHPhR֯ WnÃ=t WehTSPy&װHPhRZ WLnÃS2uWhhc rPP9 UװHPhRƮ P$5t@uPhhc> hppP]%װHPhR> cj-=t jvװHPhR֭ hh h`hhhhh@hhhhh h`hhhhhc PװHPhR6 [PPxװHPhR uh hc| 'vPh hc[ װHPh"װHPhRR wװHPhR ?=t"h"hc Mh4hc /vװHPhER螫 j]+װHPhNR^ JװHPhSR" uK=t"hYhc Yhmhc ;vPhhco [_ÉU WVS] u~=vhhc hc} 5hhh  h@ u=  t@ tC ЍP t  u H8 t8 t@Sh K^48u$UREPURd EUDh 58u = /uEPURh 1h EPhhSZ UREPSFFPjj@URf\ }v4hhc ~tSFFEPFV)‹F4URo EUDN~uFPg [^_ÍvUVS]vC; t; tu n;\uC;uhhc L;'t;"t CF<C v CF8t;uCuPhhc K; t ; t;u؍e[^ÍvU WVS]޿tjhS虧 uU +;/uU fU fB} ҉ЍD;Erhhc j,vSU R ] ރ;t#C/u;/tF;uN>/u] ;tsCC;/t;u)u>.uNSV0 )uƒjh$Vz uNE @9vN>/uSV|0 뉐e[^_U<WVSuVdÃ=uHd=u ;|V$DžEPSVR} ʉˉЉU9u[13P0EǰHfE tvDžR"ÃuQG$RP+ uh'hc dV#uh:dVhShcO DžhVS0 hhSv ߰Hډv=uJd=u5;ss$t{C=~hCPRhXhcG =CPCPP R SQ P ÃR^"u&hthc輿 Q* hlj PR67 QPitCs.;shthc5 R* [^_ÍvUVSu ]FP-Cƒ:t=u <^v?B:uf+SfS=t!HdrC ^%uU(t@tC *C Fw$FPhhcU ;vC @6C =.C #&C %6"%u C /vC e[^ÐU,WVS} EEEME9s4;sC9E}E{ tE{ tE ;]r̃}tE}tE=t9Eօ~gfffvE)ƅUMTUEQ}EuEE|8}E19EU9UtM IM܋EE@U=t$3MQhhc̼ C@EfC}tDS cyc;c| tcchcRN& fCshhc^ }tBS cyc;c| tcchcR% fCU܍;Erhthc `[;]}G cy c;c|cchcj }% C;]|EE9EF;uoe[^_ÍvUVSuVoÃtf=u;t=uJdst2  C'C@PCPh( v1e[^ÍvUVSu uRÃt1=uHds=u ;u!3!u fF@fF1e[^ÐUUE prF U=iu=(tjh@3 h\u jR"ÐUVSu =؍FdsB=t&p}ukPhuhXc覹 uVhxhXc萹 ؍e[^ÍvU|WVSu}=ЉUE Hdr&=VhhXc* } u=iu ==u/E Ph]S/ ރuU RVXE PT!ÃtSW#PVXD t$WU RV#Ãu SSKEx[^_ÍvUS=؋E Hds)u!t`Hxt P$؋]ÐUVS=thhXc jh Ãtl=t_hhXc贷 HvsCPJsdsSVS$ u;5tVÃVrq=tS!PhhXc {uSSS#$SPs C  [uF;5tSe[^UWVSEEE HdЉUEP ǃt3MwƃuhY9tEU RƃtM^[t9uEu^9tZ}uWqRWp" 7v=tWS PhhXc蛵 WcO1eEt"t F;EuUt G;EtM}E$<N=VVPUREP}uWQW! vWNURE PURÃ}u SPK=ASt}u FuÃu1%3hPh t8uƉ؍[^ÉU WVSu u tbpp5lFЍx5lÃt!C9uWVCPÅ ủ1e[^_ÉUWVS=t?}} ]9ff;tVSLVS 9r81;u -]= tSh}:= t;t= uCCC)CuS9C $9=thhXcx Ct=thhXcT SC $9s!=t6PCPhhXc" =th_hXc Cƃ;S[^_ÐUS]fC $fCC$=~;(f+(fT5dhjQQ$CPS$P_ $(CУ$]ÍvU(f+(fT5dj5$Qן5d艭 `$U WVSU] 1BCjRsV ȈCfC $fCe[^_ÍvU WVS}] uW9tV)yShhc? j%RP7c %GthG P7 Ge[^_U WVS]{uBhC P3 C%=hhc語 C;C| C맍vsD3 EfxtP)9~(=tFUBPhhcM *vMAC9u΃u1tduuh>KS+ƃuuVB EPVE EPV茗 uV% cWj$jEP G +G @th >W- e[^_U WVSu} WÃuVWh@9>hhVu }NVhihc蓚 hc 0 Phnhca 1Iss5ll0Ř Njs ~SPW uL5x5|hhc R0_ Phhc这 0j=ukSPP uL5x5|hhcm ތ0 PhhcK 0j W P [^_ÉUutÐU,WVS}u jj Ãuh<Mb)Ѝ)‰{EC=hti}܋FENMb)‰UFENMb)‰UfEFdEFpEFtE5hj$jEP؍e[^_ÉUMMb)Ѝ)‰Ћt 9Htu1ÐU(= #th ˗ = #th 貗 u US]t;tr1'15ѡt 9Xt @ u1[ÍvUVSu] t;5trVhJt:15sC =t!9suhcS6[ ue[^US]t;trShr:15t9Xu@@ P @ uSh9]ÍvU WVS]jƃt]CB;/t ;t9r9t;vt(W6! utCu vu1[^_U WVS}j/W蹘 ÃtWH/u1~tWh8e[^_ÉUVS]~C9v7)ƃP3V8 j 9t#N/[S9wʃVhd8e[^ÍvU WVS=,t,C ,1 'j$j Ãuh8E$CMQƃub} ujtEPh7MQ}ȈC[Sjj/MQ @PǰȈCsFC^ Mt6E PRƃu h7M KFC^9v} t0E Pth66SM Q6؍e[^_UVSuf~thGVh3~u.~thZVK3~thwV43~tvvÃuhV 39u)^S~t8vS'v[t9suFCuhV2V6,F 5,e[^ÐU WVSu} WÃuhV]2;^tVx^CFsj/W X6% S‰߰ȈFRV3,Pj uN fߍe[^_UMQ9Ju AB/vRvRt9JuABuhQ1ÉUWS]uh4߰H9t 9)$P ǃuh X4SWG e[_ÉUWS]߰J [_ÉU\WVS=th&hXcw =HhBEP~ Eu9轃0 PhDhc* EPh`3E` ;=twEvWÃt's FEPC$Pj3詏[uG;=tvuE;=tvW#Ãtj$SV茇 EC$EC@ F{t C@ F{t C@ F{t C@ F{ t C @ F EPjj$V[uG;=tb1;=s?<u E@ EEPjjEP蝎G;=rE EtEԡEȋEEġlE̡`EСpE؋EPjjEPLE@ @t9Ձ0 PhhcB EPh1EP e[^_ÍvUWVS}=thhXc u[t%hjP uh1jjhItjjWh Ã}60 PhhcP Wh 0EPSۈ }6虀0 PhBhc Wh`e0uVj% Euh:0VEPS |jEPS }6 0 Phhcz Wh/ C5Df. j޿hhw huw}0 Phhhc hh2 hu2r}0 Phhhcډ j8 P$ S  uhhc葉 jve[^_US]p;H~V=t55  P$ uh@hc j\H]ÐUh=thhXc =Dtj50+=8t4vjj5c 4=4}5|0 P5hhch jv p@=8u=uh`bu`   <h`6uhhcՇ jvhhc趇 =8tBl=tk1 HuI)ȣ=u =tu hld`EPh }1z0 Ph hc j>EH=w 0U=w00B!t Rhhc詆 jv=lth@hc聆 jvh`u4=t5hhXc? h)h`7=`thhc j?v @t=tPhhXcʅ tPj uh)hhN =`th hcT jtPjv uh<(dhh = udUWVS}u@=8t)}th`(=1=8t j=Rt=rt =t]Dž1Dž`=u3hhhh h@ hb hc hm hc҃  f  #t+SVh hc芃  fGC~h hcX h hcB hc 5hhV h@ u t@ t j?vVB Ãh hcЂ ;u Sh hc蔂 h hc肂 5h@ hcg hc 5hhP h@ t jmi u \Kv t3P5N װD=Dtj5)jj5\ 4=4u-5ho hcm v! pA Pyu.=t5hhXc h  ;t&Ph hcۀ L;`u;ltXPR Ph hc芀 h`/ Ph hcg    =t|5<h hXc xu4|<V+ Kh|~^<B9|}M+|K=t# ~ PSh hcl KxV Ky=u=hB "tu,xt#~Vg Kh`2h` =@t@jh`[^_ÐU=@t$=u5xh` h ( x t|=@t@jhÉU= ==8th hc} j/vfE HE=Dt HPj3(AEPhm54 | }" q0 Ph hcx} ÉUhd Ph hXcN} =hthh  Ph hXc} =tAhXhh5h@ hc| hh_ hc| UWVSu5x AEyMb)‰UAEy)‰Uyd%=`(&=  =N/=@ti&v== =tPVhj hc{ w=Vh hXc{ |=t3Vzt @YVh  Cv=tVh hXct{ 5|Vf $hhh=$u%=Vh hXc { jVh 0}v=tVh hXcz =t=t=u Vz PV!w }n0 PVh vptppV0z PV7z EPV{v WVy =tVh6 hXcz ==t V&z p(PVy }Gm0T PVh` .ptppVty PV{y EPVu WV]x (=tVh hXc\y =t=t Vby hhV4T ‰|iptppRu P5u hh5 EPVt WVw Vl0! PVh hcx 01e[^_ÉU=`t=`tÍvUh8h8ÍvU VSDž=`uh R=xlth 6=@uh!R@1;5=,u  P0} 9 u wH 0PSUDž~Kuv H PSEDž|u r PhU ҃Hu w=F;5}A=,u t SuF;5|vF;5gh`*uH u=v4=`=t55xh hXcu ~" PPEЃh`r @[^ÉU=uYu u5 u=h0 P5x5|h hct 0j&ÉUE jRP5 uCu>#h00 P5x5|h`hct 0jvÉUU$E $=~/PRh 5xhhc4t jovRh " U5xhhcs j4US] Su5k ]ÐUS] h]ÉUÍvU WVS;}h P61;p} p DC9|=u p5p 1=DtVPvVP54 Ã=8uB;p},~(=thhXcr p=8tu%~ip 9t]=8t)ޅKDvt%=tp PSh@hXc6r ؅} +hghcr <t5<t<t h~,h 5xh5|hhcq =u hCu jp Sj5 =DtjS?&jؙRP54n 1Ƀu ȅt/d0 Phhcp j4=thhXcp =8u1@PEPrtp PWh hhPZh h5EP6h <e[^_ÉUS1;p}! pv DB9|=Dtp P5Lp P554 ƒ2b0 PhEhcho jvt,hh`Rhhc3o jnЅ} p=tPhhXcn ]ÍvU=4|=Dt354 U WVS]=S{ltJs=l= u(=thhXcJn  S\= _ShPh xPhwvV11󫋅CC C CCCC fC "fC"$&(C(C,,CHTC0XC8\C@`hdPPd kuVxu 1LClC(S,u uG=v@C %f=@u1=(u1C(S,uth (=(tC(S,щ‰ȉC(S,,Hwy$@C C(C,~,Qv1;}DA;|0xu  C3h != tC$C&=t S[^_ÍvUVSu>up\= tXPh`hc6k |t|hhck h hcj L=LwT$Hh6h*5Lh5Lhhhc~j H9tP5h hcWj h hcBj 1҃>t+1;}! ,u<tB@;|FLe[^ÉU WVSx |vExlt'PURtUB;`uًUH$v1ۋE;}5ǁǤ<;t VCU;|PEPbtUB;`uevE UB|Jt|>x\2xp&h' 5`h E8=P~5Phhcqh P[^_U WVS]1= u ;Nu3_ǃNuIu!5x5|Whhcg 1e[^_ÍvUE Puhcj USM] KxvAQKy[ÍvUSU] Kxv BJJBBJKy[ÍvUS]M ht89e0|`st# lt4NwtETPCEvuRQ=vuRQM uC1Ҁ;u]UEPhEEU WVS}j/W1 tXƀ>tQv>/uCW3Ãu'jW0WiÃS K/F>ue[^_ÉU WVSuF thV9N VPSU 6 V@PrǰȈF0VLPSu[^_ÉUVS]1svF@t9uuhSsVhhh@ @e[^UVSu] =u9SVa }(qX0~ PSVhhcd =tSVhhXcd e[^ÍvUVSu~thVV1Ã=uGhS` }2=u)N@W0ڴ PSh*hc9d v=tSh;hXcd e[^ÐUS]{thIS"{th`S Kc߃SoÃ=u5S_ }%W0* PSh*hcc v=tShhXchc ]ÍvUS]{thSrKc߃SÃ=u4SKc }$V0葳 PSh*hcb =tShhXcb ]ÍvUlWVSu} =t=u Wb }uA=WV` U0 PVWh}=WV{b ÃEPV] u3}t-jV` uWV8b ÃuV` }CLU0Y PVWhhca 1NvEPh-16v=t%VWO}uFPhThXcja e[^_ÐUS]=u=jhS1a }&T0賱 PShhca 1#=tShhXc` ]ÉUS]{thSKc߃SZÃ=u4S \ }$T0 PShhct` =tShhXcT` ]ÍvUS];ts'St xt@u C;trۉ؋]US]v#St xt@uKwމ؋]ÍvUS]u hhc_ SMPh+hc_ 0s,Ph5hct_ {t!sPhEhcM_ {t!sPhWhc&_ {t!sPhlhc^ { t!s Phhc^ {uPhhc^ shhc^ SPh]ÉUS]@@B@CthRL C thh@1 Cthh@ Cthh@ Cthh@ C@thh@ű A]ÍvUVSuV1ۅttCdrVhhc\] ؍e[^ÍvUVSuVhhc1] hc萲 hHyP vhvh@ uI t1hHyPu  uvh uytnayt1e[^UE Puhcr_ =u>h& u)h,u vjvÐUWS]߰P DtSPZ Dh(j C =@| 1e[_ÍvUSh=Xh]SD[ X Džxx@PjjSX@PX 0tQhS5X ~0| uRP5Dhj U VS=\h=tP \u.=tPhjs vY P `uhUj? vj@5D踭 Ãt/5DVu j CD v`0h Ãu hhXSV`0\@PhD@0}V5Dhv5Dh@hcPY p E=~EE vE}~%jEPhh5@V |˃jEPhh5@U E jEPjj5@U }h`g EjEPjj5@U } h1 e[^ÉU WVSu>t[Àu5vS va4%u_t-tWh1 F>ue[^_ÐUVSuu VhhS9 T SVn[^U=TuhhCTÍvU,WVSu hj]S Sh ƃ |819}0v)PEP5@ ÃU9|Ӊe[^_ÐU,WVSu Vhj]SW ߰HPS5@ VEP5@ he[^_ÍvU0WSuhj]S ߰HPS5@< e[_ÐUu u5@ UhAÍvUdSu uhjP]Sp Sh]ÉUVS=Tt12vhhz1 CFKv e[^ÉUSE |3PuhhS ShvÍvUWS] ߰HPS5@ ‰߰H9t9u e[_ÍvU,WVSjEP}Et}FuWhSSuh GÃEPP }Fu TVv}AtA]ډ߰ΉЍ\9v K; uEPh 1`EP [^_ÉUjEP5@ tEÍvU WVS}u ~< u C0vCNh`Wh e[^_ÐUuu uÐU WVSu1 Huhj )PV2CPC :QPVC 􋕰R艶 DH~|/tDPPPV RV荸 SV t$PPPSuIu@QV0 Phl 􋕴R膵 L􋍴Qm u uDžDž= uhj- j:R苝 Ãt<Q uhp CjPjjjPjjF P=P苚 Ã0uhj vjPj S tTP t8Sh 謁 jPj.S諳 1t u'jPjjJ u1ۃRa5 G th v= th~  EEEEEfEA vPB0]EP? DžDžDžPRPjhSG Ã0uh[ v[L DžDžCQRjhQh.jSЃ thS Z .jtEPR uQPh: z RO P PBЃ CS@1[^_ÐU WVS}]=huh 'h=luJjh@P1E ltjh@PE puh(j{ $0hKv}uNW P u+l<t }t !v3/WEPD3P7 De[^_UhE Pu肵 Uh`hhhc? j菴 UVSu] u#13 *3V t;u= %e[^U WVS]u1;nu{ou  1؀8tv8,uF@8uP輨 ǃuh)zw 11؉ @Fj,P5 ue[^_ÐUShh{ Ãt6u ujǍ PhS<> S 1]ÐUWVShh*{ uUl18u1hhj 1hj 􋅌PV 1vDž m08#F8 =8 4hP Ã; ; t}hP ǃt ? t? uWThPX ƃt > t> u V'vj jS $08"uSzhk ÃhWCPl4 ƃhVPP4 ƃǃ PhcPy n􋅌P h[^_ÍvUWVShhx EuhhE twvstctRWV3hEPQ; = tWVhs PCPdEuEP }u/h"; uhhj 1e[^_ÍvU WVS} u轋 Ƌ CtoVP/ u^u= t=Vh *WP u/= tWVh r hCP9 uV e[^_ÍvUS tPŤ ؃u]ÍvUuh@ j ÐUuu uÐU,WVS]u DžDžDžDž|Dž#vǃ< $!52Dž5Dž5ZfDžt5|P Sv5|P/vPPht5Z 3vhk!VS!'H9tHPt| SS& |Dž tDž Džtt urPW3 uWh{!jGim u (u ,u$fPh!ǃtlh!tBh!th!jGl 'Ph!sǃth!jGm v|PPP5 }Sh!jGel jF US]St@Qڀ:t.=wuU%1tC;u؀;u R Rh"jCl ]ÍvUS]Smt@Qڀ:t.=wuU%1tC;u؀;u R> Rh"jCxl ]ÍvUVSu1ۺ<wCjEP5 ƒt |E8tVh"j@l e[^ÉUh#h`#h#hc4 j@˩ vUWVSE Dž\8/u Ph#h`S Eh#Sq XuSh!jBoj vDžPDžTELvPtPP jj\PjXPmCÉP u\TPh#jAj vRl va4%@tCύv;cEPEPEPEPEPEPEPLPh#S@ 0t\TPh$jAej 1ɋTuƄ]9fVA~TTDžTEHPP jj\PjXP9BÉP0u\TPh@$jAi vR8 va4%@tCύv;oEPEPEPEPEPEPEPHPh#Sb? 0t\TPh$jA1i 1ɋTuƄ]92A~TTDžTEDvPP荜 jj\PjXPAÉP0u\TPh$jAh vR va4%@tCύv;oEPEPEPEPEPEPEPDPh#S.> 0t\TPh%jAg 1ɋTu]92A~TTPPo XP$ ([^_ÐUVSu] SjGuSh!jN`f 1ۉڀʀvRR a43ڀʀvR a43C~e[^ÐUWVSù Eujje u>nu~ou EEj=V t@] ;tdװЍxWRV< uы<t<=uÃ;t*U{ tUE;Cu [ +vC!v=uVh%je v1h%VƃEP菙 e[^_ÍvUSUM ˀ:tB:/uz/tBA:u)؃~ y/uA[ÉUtS] Sut3EPS) uE%f=@t1Sh%j@-e t!0~ PSh%j@e v]ÐUuu uÐUWVSu] DžXDž`Dž\}XEv7w|$'`pv`dv`Xv`P\PhP52`(v5 EXh&SV\H)ƍt`;PsWW\E}E`E }uTW3Eu$Xth&b EXtuh'b dPh9'ǃtkh9'tAh9'th@'jGa ?dPh9'ǃth`'jb vEP\PhP+ } jja jf Uh(hc<+ j@B U<WVSju3 ƃPhc@V\) ÃuV轟 X@)Cdƅƅ PPhcV( ǃtVK K|8uIx%Dt|Ȇ[^_UWVSu${ Eujj` u>nu~ou EEj=V^} t@] ;tdװЍxWRV uы<t<=uÃ;t*U{ tUE;Cu [ +vC!v=uVh,)jW` v1h*)VƃEP e[^_ÍvUSUM ˀ:tB:/uz/tBA:u)؃~ y/uA[ÉUtS] Sut3EPS>$ uE%f=@t1ShH)j@_ 0x PSh\)j@g_ v]ÐUuu uɞÐUVSEu ~a6h)^ )=t 3Ph)x^ );uh)&g#h@hh)5^ g;t3v u;uvh*] gSv{ tC 8tPsh* sh *]u3h@hY CCTDe[^ÐUVS]5XDu;TD=Yu} u XD=t;Xt8t ;Xu8uSh@* _ Ku#=hthhph*\vph *\uTD5XDe[^U()h$jÍvU()h$jÍvU()h$jÍvUh@>h*8\ gUhCh*\ gUhTh+[ gU WVS1}uEU BBG}h&+E PEPϺt(}h1+E PUR譺t}~$E 0h@+f[ gvE XHMPܾugU 9Zt 9ZuBBE 8atk+=`>tf+p+tH=]tE p)‹E Pt"=TctE p2+‹E P1ҋE 9XuM9HtRE ppVbE ;Xt p螎 e[^_ÉU<WVS}>hu+E PEPYu"E 0h+Z gE ]ThRj詗 hc蚜 =`c>uT=TVE 0=u=g;t;vRd} va4%uC;ù;uxtdvvR} va4%t)vR^q a4CGu=]tSo'Ã=TctS)Ã19u =CuPSVk+=`>tf+P_=Tu>=hct5CCh+h+кtTCjju ƃ5Q;uz=dD=TTE 40V9=]tE 4P&E =TctS'1ҋE ;u =CuRSE 4k+=`>tf+P^=T=hcCCh+h+藹tTCmv1 󫍅Pjh E 4諶u u+E 4h+X P =T7E 0=]t7$v=TctS&19u =CuPS7k+=`>tf+PV]=Tu>=hct5CCh+h+GtTCt ?PF;uPj T[^_ÉUh+ju u4ÉU^ ^+t+Rju uÐUWVS1Dž}uEU BB}h1+E PEP辳t(}h&+E PUR蜳t}~E 0h+UT +vE HPPϷug1BvE H)=gX;t@vvRw va4%uC;ù;E XtdvvRw va4%t)vRk a4CFuE PtH=]tE p!‹E Pt"=TctE pj#‹E P}PE p }u;}E ph+S 04^^3vu,jE pltf9 | DžRW1ҋE 9Hu 9HtRuE pph+5g^^ 9t P [^_ÉUVSj `cxXc XchXcj 譄 hXc5p =Ttm=hctdC5]C]5]h+ݳtC5]jhcvC5]TjhcߓvUWVS}>h+E PEPu"E 0h,P gE ]ThRj1 hc" :uTn=T_PE 0ò@=ggGӁvRs  a4%t*ӁvR*h a4؋Fu=]tV/ƃ=TctVƃj1;u =CuPh+PVh+>d =Tu>=hct5CCh,h+英tTCj5`cu 赮TRjW T[^_ÉU",}t,ÍvUS=]t,5Ta*=]u&,Ph4,-N vhH,=`cuHj艁=]t5Th`,M h,kjN5`DPc,8tR5l>%Ph,M 5CPh,wM 0hThCh@hh@>h-SM 5dDP5CP5]P5XDPh@-L 05]nP5`>_Ph-L 5>=Ph-L 5gP5gPh-}L =]th>hgh-ZL h.=TcthYhch&.(L h>.5^P5\c5YuPh`.K 5^SPh.K 5g4Ph.K =PD~Ah. 1ۃ;PD}'v>Ph.dK C;PD|g]ÐU WVS]} u>%buCh,w u<uh",w{ u7h.J &}t61PEPh.J e[^_Uh.h]u u1gÉUh/hgu u g裻ÐUh/hCu ugÉUSE] u=Y%Yt3h /lvh,sh tkh",sQ uYRj EPs ƒ~E8tsh`/vI gg\cY5YPh/%l> uSh,v ul>u'h",v{ ul>uwj EPv ÃwE8t!vh.0G g=`Dt5`D{ ShG0h`Dkhvh ` Pc l>=l>t,=Pct Pc8uh`0F l>45`DPc,8tR5l>JPh,F l>ge[^ÍvUh0hdDu uAgÉUh0h>u ugÉUSE] ~3h0vh,s uYh",s u Y]j EPs ƒ|E8tsh0E gmY=Y%Y=Yt ] %]YPPPh0ME =Y%g]U}h1E PEP;t}~E 0h*1D gbE phF1Du8=gu,=XDth`1? E ph1uDu dcU WVSUu  BFt6h1PD g~FPѧugvv }"vh+E gLvhS, tSh1C vh1D g;~t vw [^_U}h1+E PEP臢t}~E 0h1@C gE ph1CÍvUS}?h+E PEP"u#E 0h,B gE ]ThRjq Ehce ;uTyv=TtmSE 0tXSh14B=Tu>=hct5CCh1h+ͤtTCjju ÃZEPj T]ÐU}h1E PEPנt(}h2E PEP赠t}~ E 0h2nA g0E ph%2-AuE ph-2AUWVSE] @C@C52~3h@2@ g3g21t Er2uEm2CEƿ52t"CP6ugCEƿ52t;8|t6CPtshw2u g.jjh+ssEP=U hXc^ E9Cts't E9Et EPt e[^_U WV}h+E PEPўt"}@h&+E PUR诞u$E 0h2n? gvUE DEEE Du52t2E8|t*EP蹢tuhw2財tE ƿ21tҀU]ThRj| Ehcu uEwEajjEPE 4um2}tr2PS =Tu>=hct55CCE 0h+ߠtT5CG=Tt EH9fEPj{ TU9Ut ur e^_ÐUWVSjj|{ jjj{ ǃ TÅZS{ C~jj2{ jj&{ h2Zs u Dž2j/P Ãuƅ-hCSP^V E޺21t tƅ+=YtPOhXcn[ }~)j5 ^h2PW jPPWh2u= gjz ~Vw9uPjy Wjy uh2= g vg[^_ÍvU\WVS1}h2E PEPʚEv$E 0h3; gvE ph)3=;}h13R‹E PEE ph<3:us}VhXchD3@ hXcY hcjO]SA ߰DE X EE p hN3:FthV3$)u}uE p hN3O:]e[^_ÐUSXDXDhd3:u&=guh3h39XD]ÍvUShS" tSh39 vh3: gÐU}h3E PEP諘t}~E 0h3d9 gSE ph3%9u8=gu,=XDth4E ph)48ÍvU}h3E PEPt}~E 0h38 gSE ph148u8=gu,=XDth@4 E phi4A8ÍvU}54 g*u@hT5觸PhN3b4Uj蔥=`cu jg=]t h  hjgjh DwU WVS}=h]5E PEP u!E 0he53 gE p~Eu+hx5>hXc]R Ugvv}u h5Ex u+h5hXcR g1h Dvtg hpjp ƃjf Uz tM=]uDhH,{hXcQ jQfVjp gvh5hTÃ~-T)RTRhT E PEHPUBЃ=]t  h  hjeVjo e[^_ÐUh5hgu ugÉUh5hgu ugÉUVS]u u%]h52]gW]]gjvhgJ gu >jvh>J  >e[^U WVSE>=>tEU<t~];tav11Ҁ=gtB:gu;U}.>$Bg<t:uG;U} >FuFC;u[^_ÐUS}u'Tch5Tcg}h5E PEPat}~$E 0h50 gvTcgj 5 ^L Ã=`ctC; t ^j SL Ãh5 ^hcH C; thShYH ]ÉUWVSMc1E1U@~<$t<\uRF:tX~0~>@95F:Ft(>ύD(L(A9tF:uE F:tE}t,9tA}t >tF}t9t >k}u9t EY=YE<[t' <$`<\X~SFHF>$F=wuU%1tfF>0uU:XBA:uH>ύ|+T+܉߉}E;BAE;8u>>,>]}}v>\uF>$u{F=wuU%1tVF>0uU:tSBA:uFv>ύ|(t/T(܉lj}];tvBAE;u >tFA>t>,t >]V>uh6dvEN}t& >\u~tFF>tɀ>]u>빉F<,E<]N7vF=wuU%v1tVF>0uU:tMBA:u@v>ύ|+t)T+܉߉}E;tBAE;8uAF>u=t Eh[^_ÉU1=XDt26PhCu uYgÉUh?6h`>u u5gÉUhL6h]u ugÉUh[6+u2=gu&=XDth`6h6*u dcÉUSE] ~3h6* guGj EPsB щƒ|E8tsh6* ^ ^^ ^uh6^^RPh7>* ]ÐUh/7*ÍvU WVS=PDuh@7}hn7E PEP t}~E 0hy7) =Cth7>jE pPD>PB PD>uT>Dch7gR>PDN4>PDg%vPDD>@>PD4>TtjcOyW΂ vccQ؈< u$PD;>J~HFTucvNyVb vcc tuЃt2cHyP(  t뮉cc uh 8ge[^_ÉU1=XDtH8Ph>u ugÉUVS}h^8E PEPņt}~ E 0hg8~' g;jE p舋ÉփutVSE ph{8=' ge[^U}h^8E PEP7t}~E 0hg8& gLjE pEt)EP P% PE ph8& EgÉUE p8}~8PO&ÐUS] h+jSuntssh88& ]ÍvU WVS}h^8E PEP4t}~#E 0hg8% gE PUPgugh8[ Ãu8߰@PX ǃuh8j% vSh9Wue Y5XDXDYjjh+E pWh+@:0WDY Y5XDE U;Pt pY e[^_ÐUUE 02t8 ÉUWVS}HUzTMyu60S/[ S5^r} U0HDž;Jv߰H9s42:u,MB߰H9s2:t;sM;Qr9vJRVS< S5^qu_X `cxXc XcvhXcj !V hjEp0c UR>[^_ÉU WVSlE}Ѝp0=0tFװH9w&VREP u3EPl;uEPu EP|ÃjEPlÍe[^_ÐUWVS]j/Sruƅ.ƅAv9uƅ/ƅ )VSS ; Pi u sks ;s";tHS9wbHPSP u2SR; uh@;jP! PP$kPx Ã9Pm Pu Pà jPkÍ[^_ÐU,WVSuDžd;DžDžd;Džj/Vpuƅ.ƅ4K;/u9w)CSVV9 3=dcuhPt =tj5$j`iTDžk=Tta;uTPj/St@v؃Pq9 uh;jo vP5AiPjP~Ãqt h; vPh8U dcfh1;ps{JH9w@HPSP uSPJhF;rrPu PÃjPghÍ[^_ÐU WVSu}Nj_)ÃS7hT6 ƃT)ljTggDh=DE;gu5;Du(Pg4h| u E&5Dgg4h 6 D=guEPRg0gƃV װЍX9gvC~3TvR1@  a4%tg9ggV D/wr$;vEPh%U=]th;B8vEPh?%EPh%e[^_ÐUWVSDž0Dž,}.h<E PEPQzuE 0h<avDž444;PD}"j >PE pq uʋ4;PDu$E ph< ghT8PHQ 4>;>0vR\> va4%@tC;}̾T;<$t<\CC=wuU%v1tZ1C=wuU%v1t|PΉKE9|nE tVUP E |7{iuJDž,C0;U}9E 4V!P E 0<ЍtF;t C;dg0Cdǃuh<=guh<og t&=]uh<Dg=XDthTg05^GЃ=]tDt> `cy `c;pc|XcXcvhXcjMK 8PhTN c^EgE 4>;t C;,t00;E1[^_ÐUWVSDž|DžX1DžTEP1 duh =j jhC=dR ud`NjhK=dPn ud`dQhR=jZ j/`P3 ƃt>u URh= Ft>u MQh= j/V\t\\\t \8uZ URh>| } M Q~0 Xuh@>jv jhC=XP> u X9jhK=XQ tE Phe>X``t `9uE Phe>F/j/`RC2 ƃt>td`9[u)j]QÃtC`;:t#1 j:`PgÃtC=Yt \RVS`Qh> tڀ:uT}1EEtPEPR`P|u ËtTtWSt P`Qh>Y 0. P`Ph>) l}tvStp pp| |u't@tuh> =]\Dtt[t C;Buu\Dss|PuBt@tudj"jjj]Wss5 Wh>C ntpp|P}Ft@tt|PQ `Rh> vTQ!s XuEPh>vU RMQh>k V?Xt?Ph?h|S h PS|PdP ;hsh(?0 [v|1󫍽|G|9s(jW|P#P ? tӀ? uƅ{j |P. ǃGjh=?W tWhA?|1|G|9s-jW|PO e? tӀ? uˀ uƅ{||vRh) va4cujh[?W tG?u?ttj W- pj pPW ]]=]=]p8}v]]hh\Qw l}\Phl? 9Džxh`hRt&xxPjgM hTjQM x]]\cÉjav h]]| )hǃht'hQWlPTM 0uȃ=Ytu=^ulH# `cy `c;pc|XcXcvhXcj#A \c;5] u;]vhXcE- h|P|PL h=Y=^=]=]\c;] uF;]v> `cy `c;pc|Xc#XchXcj#@  `cxXc XchXcj @ hXcM, hth? vjft=XDth?xPjJ |PVK lRDK XtXQ5A dP#A 1h?)\Rhz? `Qh@ |t|PJ XtXP@ dR@ TtTQl 8[^_ÍvUjD}h@ hXc* jh`hNULWVSEh cNt!=]t jjtE@$vhjaI hj RI h/@A h9@sA Dž uvDžDž1DžEU 4% uh`@j vjhC=PJ u'RP%jhK=R t(PRwhj/SJ' ƃh@S螴 tf8/ta9t 8@uEU 4h@ vh@R= t8/uDžwvt8t8:t@t;tÃj:S& ǃt=G7v;[uj]St Cj:@Pj:SI& ƃK;Bt3Ft->t(j/Vt@ 1=Yt(PVWSRPh@ hS] Sht? =]tjjXE]Et?t}E=Dt DEPR`=D=]t'=]uARPSFdu#Sh@ E@vjj EAE?EEPj=dcDž1=dDtUt>thAVα t*:thAR衱 t Džt8>t3u/EAuEEPj=dct 8uDž=XDu#Ru?PhA t*PVh AhS_ E&AUEu t.CCE*AEPjYCEPj gQ)ƒt E@R$: E@Eu&E;E}j:EU 4" _=]tt jjM[^_U$S]jhK=Sư tkjhC=S诰 tT;[u#j]Stx:%4vEPSj tj:S! u1]ÐUlWVS];[uSj]S<tA߰ЃPCPh  ߰ƀ :v߰HPSh  ߰ƀ  }1EEEEEPEPu V e ÃtMS]d PVh@A u0 PVh@A g]{thsh  T uSBs ssǃ }%[uփhGAu g=]tc\DvRt B;Cuu\DrrW|u([tWA \hNAvssWQtv{tdj"jjj-Vss$ VhSA [j"jjj-Vssb$ 0VhiAa W@ hwAKssh0i: ub E EPhhWf}hA g<=hu1EjEPjjW) }hA hAWZ hhAWZ m =htuhAw 3=XDt5ThAD j~C=ht5h] =mt5m\ gGvEjEPhhW4 }=Yt hA T W> 1e[^_ÐUjq `cxXc XchXcj }3 hXc =tjhh CÉU WVS}=YhXchA u jWhAt uhXchAS 7jWhAH uhXchA' VW `cxXc XchXcj }2 hXc =mu!hB< g1vhj< Íu VW5mD 5mh#Br 5m h> &B%P5ƃ=tt jӃSj=< e[^_ÍvU,WVSDžDžDžDž?hj; DžgDž1CvhHyPW h~6hHyP}W hSh2hHyPIW hShhh+B5mr 5m UGuF} D=XDth@BmhXc g =XD=XD~z5uq~l= ht)tu=XDu5ThB`  `cy`c;pc| tXcXchXcSN/ 5=wuU%1tgDCУgtjt%dgv!=gDždDž=wuU%1t^Dž t#)tCs.Džv~(u Džu-ut guE9sFhHyPT h =XD=XD~V5uM `cy`c;pc| tXcXcvhXcSR- hXc u6)ÁvSPhiB ƃit'9gtg1t h>PjE7 =gt u}@=t"tt jЋ,v Pj6 g1[^_UE EE@Pjjuj 脿ÉUjiThB+ hXcG jhit;UWVS\cEU]BDž]]]]^=XDt?}t9} tU :-tRhB }tMQhB =`ctEPU RMQ.~ vTD;Ctj5C DžDžDž|DžDžxAhi:=h>tj=h>u=|5;5 tPj4 |t|Rj 4 gQjj4 QhjU4 hj@4 u B1t  uDžc^E 8|jj 3 |hA] CSK u?ShBRj3 |Qj 3 Pi^DžvhAU R uFM QhBPj(3 Rj3 g DžEPAP|E%f=tJE PhB Rj2 Qj2 􋅐PP pEЋUԣ]]JtRRjY2 QjH2 |t|Pj +2 ghi7^ ^uCtuCTDuj5^P 1|-(|#j^ ^QRAP53 }E PhB"^^RPhCNt&􋕐RDžx'C}t|EPURh+CQj0 Pj0 |t|Rj 0 o􋍐QrMQhBtgPjN0 Rj=0 |t|Qj 0 􋅐PxQ$jYjj / | TDK蚮1]])~VSBP/ ǃڃ=Y=^t =]E;]|E;]uE;]wfEv# `cy `c;pc|XcXcvhXcj#!$ \cEUډEUzhXc hPAP. ƃ=Y=^t =]=]=]\c;] uG;]v? `cy `c;pc|Xc#XcvhXcj#-#  `cxXc XchXcj " hXc }E PhBsD kE# `cy `c;pc|XcXchXcj#q" hXc \cEUډEU=Yt;=^t =]})E;]E;]dE;]R@ @ JyB;B| Rj ! ]]JyB;B| t  RV! ]]Oy􋅐P1H  0=Y=^t =]E;]E;]uQE;]wEAv `cy `c;pc|Xc#XchXcj#  `cxXc XchXcj hXc B @tM QhBa@ @t.8 th1C;]]jSt􋕐Rу􋅌PH jL Rjh* QjW* |t|Pj :* =]=]jXRj) Qj) |t|Pj ) =h>ug=|5* t􋕌RG j7gtt􋍐Q҃=] u=]v jW ^^^X[^_ÉUj8\Th@C至 hXc jhi-UWVSE lDžhDždDž\\cEU]uC]]E]]^t>pu~C%EEtZ=XDtQ}tKlt(}u l:-tlPhB }tURhB =`ct&EtEPlREP 0vDž`DžXDžT1=gu E%Ehi,=h>tj=h>u=|5?' XtXRj& \t\Pj& t^p>g:h`jY& XhjD& \ }u&lƿB8|jlR肰oj/lP莴8t7ڤ8 t-lRhBXPj% tj;ltCtlvCPƃt/}9lPhBXRj4% \Pf=]uh8 uUhlRm}:lPhBBXRj$ \Pv=]ts趣8 uilRN#luM=]t?lP$#lu#XRjN$ \PvEu=TDtLjj؈;TD;Ctj5C跈jURRJ]] t3XPj# \Rj# gw hi( Et3^ ^t&^^RPhCz# }t@UREPh+CSt@XRj# \P vURhB hAd] }lBu$DžhXc^>}url8|ugjj o" ThAl@P9h ul@PhBP^>Dž`FURlP hulRhBDd Dž`EPhBP|}uEE;!vX=!t5! u !uhC!Ẹ!E%f=t^>jTJTDE^ ^tsj^^RPhBP" }MlPhBt^p>`C hR?vg1ؙ]]=Y=^t =]E;]{E;]uE;]weE# `cy `c;pc|XcXcvhXcj# \cEUډEU{hXc 5!5!dBP Ã~'S5!hBP ƃ9=Y=^t =]=]=]\c;] uD;]v< `cy `c;pc|Xc#XchXcj#   `cxXc XchXcj  hXca }.e8 thC]]9/lRhCX vE^ ^jjhP5 |e=^~`hP`vd uE@E CdmvE# `cy `c;pc|XcXchXcj# hXc \cEUډEU=Yt;=^t =]})E;]E;]dE;]R]]NydPL8  uEtDh@ @ JyB;B| Rj ) t;tD 2hJy B;B| t RS ]]OydR7  @Et!EPhCl hD =Y=^t =]E;]E;]uQE;]wEAv `cy `c;pc|Xc#XchXcj#  `cxXc XchXcj  hXcU d@ @t.Q8 thC]]hB @tlPhB`j/Ct^p>`thR`҃XPj \Rj TtTPj x dR7 j, =]E=] u=]v jG=>`jEP=@xj|SNxEESlRz wxP P PlPh@D Et^p>TtTRj C jj4 =h>u4gXPj  \Rj vdPg=|5- `ththR`҃dtdP5 =] u=]v j FXRj@ \Pj/ 8[^_UWVSDžXDž|=hu&hf=tf=uhD$=CLihjjMiP肟}hGA =]tW\DtMi9Bt Rt 9Buu\Drr5uhNA]t5j|Pjh5衞 }hDMMit=Tto5XD=Yu XDDS5XD5ggfff)ƒu$thD.T E]DS>5ggfff)ƒuthD躟t-ESthEb޿ E ggfff)ƒuth@ExPtPUEPEPEPRhfEh?ƃ 1UE% ‹E% ‹E% †Piv޿E ggfff)ƒuthEOMit+xPtPpPUEPEPEPRlPhPhEh?ƃ0 hlp1UE% ‹E% ‹E% †PimxPtPpPUEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPRlPhPhEh?ƃ`hlp1TiUE% ‹E% ‹E% †TiUE% ‹E% ‹E% †QUE% ‹E% ‹E% †QUE% ‹E% ‹E% †Q v޿DDžt ggfff)ƒut h FgPxPfPePdPhFFh?ƃ uRdd:BuA:Bu<:Bu7Li0i󥍅tPtP҉P!th`Fftfx ІfNiLiPhLi5Ԙ$hwALih=^t fNi=t5! jjMiP~}hGA=^u3j|Pjh5 }hF>=MiuG=>%`j`Pjj5诗 }hF[=MiuG=>%`j`Pjj)5_ }hF LiPhLi5A} hNAq]t5j|Pjh5 }hDDž\\PhLi5讘}hAfjj5x}hF8=^=Miu[=TiuR=XiuI9\iu5EEEEENifE`iEuLi~u]~ujjjj-EPPVX t +F%PEPShFNFt t9VAPPBPBPBPFPhF }VAPPjBPBPB PB PB PB PB PBPBPBPBPBPBPBPBPFPjjh GM`u"=^u^DžX %Xt ^=Miu9Dž|j|Pjj5O } hA13v5 Xt ^8[^_ÐU0VSuhE=CEPEP5ȕÃ}+hdGj5d 1b5F =Miu1EjEPjjSR }hAV5% e[^ÐU=] u=]v j(9ÉUj=UWVS]hj Et%=`c+E"`c#=`c"E+`c]U]=Tt#h5TCP4 ƃCM T 0i0iu 󥍻h󥿠huh<U<hm@@mCDDCTDHHTDh>LLh>`>PP`>]TT]gXXg]\\]jhg`P ƃpE`Phg* jh>qP ƃEqPh> TcMTc hhcP_ ƃEPhc hhYP& ƃ EPhYi EPj\ =tjUҍe[^_Uj: `cxXc XchXcj Y hXc hTjhh UWVSDžxE~CuǹuC=]tkGtCu=d>t=gt9TDtjSj=Tt(hD:t T=Tu'h EthG豐j=]u&hG艐jog9TDtjSEjh?hGu[hhg hjI xEPEPh+CJ t"xPj jjjE@E E PtPh+Cujjjl joxPj jAEPE PhG tjjP u~C1t t=`cu j%vu~Cu=`ct j=h>u6Eu&E PtPh+Ce=h>t ju=`c%PF=h>Eu{E PtPh+Cst[j=h>t jj=ht gxPj =h>t j=`c%P=h>h|S hP@ j S *}hG=ht g j j =`ct jj=ht gxPj X[^_ÉUVShEP uh@ jVÃ}hGg tj*h[^ÐUWVS}j/WݏEE1tj9t Ct CP}ƃt/})WhB?1hH藋1Wh@5 @5Hƀ@5.A5}0u{.uC1CKu7E}dtEC<9uE0Ejh@5Ɗƃ}@5e[^_UWVS}=mu0h@HS=ht gD vhhhh+BS! jjSm@P* thGhhcH5m 5mh hS豊 hP@ tGWу j PM*}hGS=ht g,tBGبt#vhSGP) jTu=g(u j6j)h[^_ÉU$S]{uu{uoSzufz u`9BuOEEEEEEBEBfECEjPR EC]ÐU\WVSEU DžDžhHjgHTH`DhH à tShHh`D舉=`DuhHh`DjdDCDC>>XD^l>g^g\cghH ]u ]Hj/1Ãu vCÃhHr thHPh t C޿Hu C޿H u l>hH Pct8u PcH=l>t$Pc8uhHϿl>h"I Ãt޿'Iu 1ۃcP hctXDu gfcP ^̃B$HI ^ ]YgdD}CqDeCYgM] 5C)>XDXD3 h,IPR|t H)h>`cg^=]1DžPPjPs ÃtRS PRh>I\ u x0 PhH7 j~ \DMÅtS-u苃P-t qPo j+hljW &j:0a tN􋕼2-u7 ^QP?P vh ct jV hj hj  ~BP)P*h c؅t$hj hj vS7Uj*jh cUj)=]tv=mt/jm@Ps~5m m =|+j5?~5  ]j=]tB=mt/jm@P}5m m ] hjjUTJÉUWS}Q=gD `cxXc Xc$hXcj  MTE< uu}hZJcKyS" EcEc} }ugEP5^,>ǃt}ujj-ME<8 t=v!hZJ2}TuWS EWj5g $=^g0nÃu hvJ)u hJ{ t=]uhJ~~v]g05^CЃ=]tC{t= `cy `c;pc|XcXchXcj {=gp=hct#hXcnP hXc hchhT5 ujj~THErhj hj e[_ÐUWVSuu1}E1E0 0tHA8uv:tCBA8t:u );E~ E] );EuG u E v[^_ÉUWS]T>@^mg@^^yÃS5g<u݁=gTugD7v=gt+^gg|HDe[_ÐUVS1ۋ]5>:!t:$uumttWem]];gu ^g+ > DgJ:! Jvm] ^< t 2< u,B;guߡ^g+>Dg뼡mtt m m ^< 6,< $b<"t0<\uXB;guS^g+>Dg0B;guk^g+>DgH AB;gu!^g+>Dg;vtr<"u6B;g!^g+>DgvAB;gu!^g+>Dg늉tA >]t*mtt mm ^1[^ÉU WVS}ÃJ=`ctJPhJ諰 0&>t=`ct~ t6S09rȃSjSSE E Srƃu ShJu Sh K v6j h%K Oe[^_ÍvUPPPPh@Khc'y j* U|WVSDžhL ÃuL߰Ѓ=v!j?P PSh&Lp1QShLhS5 h4LS謵 @9uk8tSh6L4몉hP- }ƅj.P 0Dž9L!t tDž h`9URY h`95TX j.5T% ƃtLPVX u5T)Ph`9R\Y u+T`91j.UR ƃ1PVIX +]Sh`9URX `9 t vrCE 8u/h`9 U ch:Lj{vh`9E 0 O/U :t2NL t-P@9@Pq| ?\E8h`9 UhLjǫvP@9@P3q| ?cE8Wh`9e U:h2MjR=`c_v@9HyP @9t t̓ tȃt uhFM5=PDPD>>16Àu*vSC  a4%@u8FG/@9HyP v@9u t8@9HyP @9V uɃH=PDu/>D>vPDV>PDvPDD>@>PD4>TtY@9HyP  @9 u ~iFTuTu"hMh`9h N«t: t5$*h`L臫hMJ5@9^ hM hMqh`L;hL. 5@9  x[^_ÐUS@9@ `?@9HyP @9 Bvǃ tƒ,t`9"/\u'@9HyPh  @9C@9HyP> v@9tx"uq\u'@9HyP  @9C@9HyP v@9t t t t,u=`9u1>vC6v=t h`93} t҃;u ]UVS=]t5Th@N9v}hkNE PEPIEv#E 0hnN g=l>t `D vg}~E p. ƒ=l>t0=Pct Pc8uhNjR5Pc RE p荡=l>t>E phN.n=XDt5PchN& ]TO@h OfDhCTDC O OCBABfAT@>OO@>BfABA]OT!OTXc"Ofh^=DtjjE pp5XD=Yu XDh$OuetaEj hi Ãuj hi Ãt{.uKEhih)O貤 tEjhDOhi.Q uc=`ctg d>C@hVOVO@hBfABAt`Qh`O, P=`ctg vd>t(j hOhiP u hOnl5XDe[^ÐU|WVSDžDž} u8PEPE PEP}g1} t }= ^1Df@*5E u$kP u E OE hP! u hOhS( ]E O } u4ÅuYkPttSEPhOvMQh Pw hcjOVt D}u] MM } hu hPƒup}uhP&Euh(Pšƒu=uh0P%h9P胡ƒu-u8t/h9PTthAPo=`cue]1һTPB;PD}IOP<>uܡTPTCfTg05^膅x[^_ÉU WVSuTЍXvhZP5iuhuP艠 ƃT Chc)PTPu uUTЍ\~CT< u^;ȉgE ȍe[^_UWVSu}=TuE=dDu==(5( (=dDu7==u5====v=(h{P5]hPhS% S% }ShP61vP+ XDt XD XDYY} t=`c%P#P>t,jjP6ShP蟳 P>uۋ gQ)ƒt ti} t=`c%PXDYhPSl (Sjg =(u"uhPYfP5(hh9謤 u5( (jj h9Y t9[^_ÉUS]=C=]u ShQ hXc˻ hchP u1yvRP va4ntat#9pu3ChQ e]Sh@Qp ÍvU@WS]=dDtg}1 EPjh 35u}u 3hcQ!EP-1!E0_ EP e[_ÐU WVS=XD=Yu XDuhqQ|upj hiu ƒttBj EPRHÉ֋E8tUvRU va4%@u*} t=Yu hic=XD؉e[^_ÉUlWVSXDE gME=YuEXDuhyQ蒚]ShQhi q1߰ЍxEu'jhQSF uQE uQt }1 EPEPEPEPEPEPVEPp u=EEHE}t EEvMMEPh E}u$} u =YtEPhQ蔙 &EE} t=Yu hibM XD}uEgEe[^_ÉU=,u <`,EPhwt@j`tE;,u jÐU<WVSDž}u>jh=_====^^==jP^=^=]=]5]=]5^=^ ]]SQRPHÅ}1ۃd~dShQ+PP  $h~WٺQ)ÃhQ)PhRShR+PPD  1ۉ vC  u vvBQ u PQPQRhR+P*P  =)=)É؉B}B@Bv;== uV;5=vN==5===~==Dž=)‰=)ȉB} B@Bۅۅ5R=]=];=]u ;5]~*؃hR+P)]]+^^߭-]ٽff f٭߽٭uC?~v;؃hR+P*P jhVSDt#PhR+P)#hR+P*PM jhVSBÃ<֙R)PhR+P*P  QPj7 }uh< j j B}uTV]E PhX諆 hY螆 hY莆 =tL;Ѝx7A~h4YP 3h7Y9 ;uh=YvjhV8^ÃS^ tE PVh@Yhc:O t߁[v|BA< v9tE PVhYhcN KvE PVhYhcN +=tjWEиhWK 1e[^_ÐUS=t&v{ts3hY ;u1]ÉUU=~,5Tjh5t} hYɄ ÉU=th Z舄 h`Zw UE| }<$ < u  } u  }= }%u9$ < uhZ NvhZ jp2v uh [ƒ h`[賃 jpÉUEu%4u5th[[ Lh[K jap2vuh \& h`\ japÉUEu%4u5th\迂 Lh\诂 jo2vuh ]节 h`]{ joÉUS=t7v{t&C8tP3hb h=Y' ;ũh=Y hch>ThY 1]ÐUVSu=tCv{t2C8tP0ct)cP3h8c h=Y蟁 ;ue[^ÐU WVS}E4h`cVhc VhchcJ 1E E 0E jhVCYÃSY ut{ t:C 8҉{t&sC d8tdRhdĀ {tjC!ErEe[^_ÍvUjh, uXÉUE=TtBt8tPvTTPPhh' >t8tPB̊̊PFPhh ÐU WVSuFh>TE pVuh$TU rVt_, =, ts3hYn ;uh=YV j\ hch>ThY'E pÃjhU r,WÃuE ph@iS_WtU r{ tiE xuC 0vTU zt hidvC {t&sC d8tdRhd:~ {jCЃvthi~ 1vSwVt E phihc(G 1{tU rCЃs 3hiQU BTǹtPƒvC C PP3hjS} Pe[^_ÉU WVS} }h jh>TwTuh$TwS, =, ts3hY| ;uh=Y| j hch>ThY| 1:vVh`j VhjhcE 1E}v7VÃuyjhVMTÃtSTu{ t5C {t&sC d8tdRhd{ {tkjCЃ\S3T,{tjCЃs 3hj!C C PP3hj_{ m e[^_ÐUjj"0:jj8 jj8ÍvU=tjj8jj"N9jj8ÍvU=tjj7vjj"9jj7ÉUU"uhkez h.kXz 18} tEUE EjjEPFÉUjuÍvUjuiÍvUShmy = t7v{t&C8tP3hY h=Yy ;u1]ÐUVSu }t hmhjh vQÃu vh nSQtvh`nhcoB A{ t&=uhWx h.kx {tsC1e[^ÍvU WVS}=tNv~ t=~t7F 8t hT hn{x vhnhx >uh=YPx , =, tJ8 tB{u'C PmP3hn x vs 3hnw ;u5;}%E 4.ÃjhE 4Oƃ S!PuVPtE 4hnu u E 4hnYw 1tC~ t=~t7F 8t hT hnw vhn w tN;tI8 tB{u'C P5P3hnv vs 3hnv G;}je[^_ÍvU@VS]u QW~FPQW~_Pho_v ~F'h?oCv hcj2]S@} ؃ 8t̊=Ȋu!̊PWPhVou hXc訔 e[^U=Њ%Њhou d=ЊtdPhou hXcD ÐU$SdEPEPl,؃jjA=EPEPE, t"=tuE;EuE;Etda;(jUd]ÍvU$S`dEPEP+ЉU5Gt tvhot ho蛪 Ãuoj/SZAuv@}~jhaxhoPS{, jPSh,hpHt j&8jjEPEP+ t$=t}uE;EuE;Et/`]ÐUWV=tJj5w9hps 5*}uE pp tjhEe^_Ujhph$ph0jyUjjB0 ÉUSx =x t7v{t&C8tP3hY h=Yr ;ű]ÍvUjhx uJÉUVSu }t hqXvÃuvh@q6vSJus CBvhqhc[; 1e[^ÉUS = t7v{t&C8tP3hY h=Yq ;ű]ÍvUjh uIÉU WVS}u  h@sAvÃuvhsvSItvhshcw: 1bvC 9tB3RW{ uQWPs GQW9C }sRhthc+: 1vv vCиe[^_ÐUVSu}t!vVs u u1e[^ÐUWVS`;ts Ƣ .j趡 á}}C};tXVvGCCV览 C u 薈 C ؍e[^ÉUSuVÃtES;tCB{ts { ts  S ]ÍvUut@ÉUut@ÉUVSu'u VhtVÃuVhthc6 3DsHDjFe[^ÍvUS}t-vs s {t*Phtl u֋]ÐUU }th}6@1v=ht#hxt9Ptܡhhu1Uuu1v@ ÍvUWV=35}ht(l }~E pu Z"t\h uk Fut@uPhIuk Fut@uPhZuk <<D=tu hu!huok =\thuVk ut@uPhu3k !t/Fut@uPhu h vj ̊P9PhVoj hXc芉 e^_ÉUjhuhvh488 ÉUUBt t vBvBv1j.hnPBP nÍvUMxu@t9Puu1ÐUlWVS] EEEEEEEEE=t(5}h vi U2Pc2* }x`w:v`w>vfCh@voi hc߰Ҹ)P߰_wPDp  `yMyMh$T3@h>T3?3FvuMtwEg3IvuMLY3LvuMt+E}u Mv}u;}Mh`vv}}t}}1EEEEPuVj}WÃuEEPVjWÃtUS PEPhvhc0 `$0m PMQhvhc0 }܉}E8@t8!uI=tj:MQ3}uj@}W3}}E E}}u`Ev%vM9-uE` `}1EEEEPuV}W5}Ãt{EEPVW5}oÃtZSP5}hvhc/ #0 P5}hvhcj/ n}uN=\t+jjjhh`vE؋@PEp tzhEP_v}th5}FE؃xt/ph`vG 3E52hMQh`v~ _w}`v}؉}}}u$hEPh@nr~ ?r E@nEEPEPEPEPMQu uH=u'}u!EPeu EiD-PR-u'}Whvrd -P$-vEpPhv@d Ep pp*,P, =}>=u}uEP6hvc 3}t1uuuu5* }hvc E؃xuV=} =t:jhjj5) } 8*thwUc =Tt+jjh5S}hY!c }EE܅t!UE܋@E܅t@;Bu}uMM܃Epp5,)uH=u}uEP=h&wb 5Epp5(}vU؋Z}t[tC;BuEpxPh+w1c t]؃5A&h`wc5!.=]}W1}tEP5}MQ=Lt\}u\hYtl EtPiÃt-)9Ct#)P ÃEt]}t!}WhYt8hYtC jhuhvh48vh虣 uEPG5jhwf }tMQ }t }W1e[^_ÉUWVSM yAptpvCAupPCP׍X[^_ÐUS]jhXS8ujhS8]ÉU WVSu }8O}u2 `cxXc Xc1hXcj 赒 jj@ jj4 =Tu5dhxP_ ti`w~#`wFaw< tvO~ FB< u1`wt3J: u-`wt%=Tumh`wh x^ V=Tt5dhx^ hchh`we u c`U=`wR=yt5yWÃS6 t hx*vu h$x{ t=uhW^ hy5`yCЃ}u"=ujhРjMe[^_ÉU WVS}h@x] X=Xt}{ts3jhnxu] ;uXE E 0VJÃS5 t Vhwxu Vhx sh x] O1e[^_ÉU\WVSE}HE} Ѝp=PUR]Sn ]=Pumhx蚒 ‰Pt+װЃ wRhy yhxhyy Pyhx5Pb ǃ(+UU)Ev=`w#}t@`wvR  a4%@uE}`wvR  a4%@XEPURh`w uEPE`wPXVU Rh`w uEP`wP/vjhxh`wd hhgwh`wBt =`w t=`w t =`w E=y5yÃS3 t5yhxtZ Uu5yhxYZ :v{ t=u5yhy2Z hy5`yCЃWhh`wa t =`wW e[^_ÉULWVS]u}t+}t%E8tIE܋@t tvU:M9vE8tUЋMUCr$EЋUEE̋M MԋExu+jU2E؃MԀ9@u)AEԀ8!u EԋUMEЋEԀ8@WEЋUEEԍ}1UBEEEvMyt1}:t@uv}@tUztՀ}:uF}u1EEP}WjMQIÃuEEPWjEP(ÃtWS~PURhvhcV! u#0q PMQhvhc+! UԋE1E܃xuj@PMQvE܋@@UЉEtVuԋE܃xu&MQ&U؍D ;EvvEЃ;EuƷE܃xujMQyU؋M@EEЋM*B<EHUEЋEЋM+MuKe[^_ÐU5DxK>Uh@yhSyhgyhy5dhyhc j U Bt5Sh`}9uh`}t1e[^ÐUWVSuU 1ۉEFVV‰V [^_ÐUUBH;Bs B@J)ȉBÐUUB;t1vÐUE@ÐUUBE ;B r+BBBÐUSUM t`zt+Z)É؅|9|Z)ÉB9}B;B r+B J;Bu ;JrBB[ÍvUU;BuB;BrBB )ȅ}BÉUU;Br uB;Br BJ B )ȅ}BÉUUztB;uB;uB;BvBJJ)ȅ}BÉUUztB;u!B;r uB;BvJ JB;s J J)ȅ}BÉU WVS} utSEP9|EPSWEp SEP )߃ ue[^_ÐUfcchh`zP hhz> hh`{) Uu u5& Uu u5 UÉUU 9u c71 9u=t7ސ38֐ 9u"th9뺐 9u 8막 9u 5듉u/ 9u O5s 9u 5\vÐUjhtfcPÐUWVhju  e^_UEHwx$| k c [ S K C ; 3 + #    " 1UWV ^_ÐUU7jhbU=\t 27jh4ÉU=\t=tW22ÐU=Tt (u=\t3U=t$4ÉU=t 3ÐUh \j[ hP\jL h\j : h\j+ hx\j h\j j6j5 jhh57u h}G UVS1} t z}t z}t `z}t `z}t `{1}tPh`{hzh`zj à }Cu 8u10_ Ph }E j&̡`{t!!j~3`z!h@}jP5D}5pà }8#u1 =tS5D}j<5tSh@}`z!hP5à }.]8u1ۅ}M8#} uTt+5h t "`j5  =tS5j<4Shuzt! ơzt%! PZ1~e[^ÐUW}|1@ĊȊ̊T}_ÐUS]} t'u uoud d}jh`}d}jh`}d} jh`}Shh`};4]ÉUS]} t'u totd$d}jh`}nd}jh`}Wd} jh`}>Shh`}3]ÉUS]} t'u uoud d}jh`}d}jh`}d} jh`}Shh`} 3]ÉUS]} t'u totd$d}jh`}>d}jh`}'d} jh`}Shh`}s2]ÉUS]<t tt uy"w?$h}@H@,=t $$>1tjSj/jS]ÍvUS]<t tu t tJtA=t7@H@%=t $$T$tjSj1."vu=t ]ÐUS]<t tt 'w{$}jS%%h}t@DjjR "jSp " 5 zv1tjSDj-LjS9"u3jj " jj v]US]<t tu u?t6"u $tjSjV,]ÉUWVS} t8} H(wU RP,vE E] v;|uEC;t;:uU Po EEƃE}U}|t}:u|C}uK))B} tPWE Peu U: vVEPW?t>}:E<|u CU|tE} t}} EZvUvR_  a4%t)UvR a4CEEU9Bu,ǰuB9rU^E8u6} tU U9sB9rE8uEe[^_ÐU WVSu}׋] 9s#WEP3u19rݸe[^_UWS==t=t5Jn h~ÃtYEPjSRuSh$Bt(߰H(wS3) {{8u {{{e[_ÐU|WVS}})‰ЃPh|j<5/}ƒ}o$$vX};}G}88~É߰׍wh`}9}MhhSjjhhh~]Sx 0VSh`}GPEjh~i> };}}8|EPEPhhuujj hhh~uVw }а׍_@h`}9}!SVh`}GPEvh7 !};}}t4 t:t t"Ċ Ċu&jG&S"D};}3}=t2 =tI|+=t\v}})PR}})PRE}})PRE}})PR}})PR]ej}})PRG};}4t' t!}})PR #};}}8h}ujj#/hhPjj#hhh~uVu }׍_0h`}9}#SVh`}GPEPj>* h4 x[^_U} hdw4 ^Eh`}v*jhh`}jjhj>5*vh4 ÐU}  h|3 ÐU} h3 ^Eh`}v*jhh`}jhj>)vh3 ÐU}  hc3 ÐUM} 9tuz}u h`}<v,jhh`} jhj>( h2 j"US\ sCC C r,jCt,C C PjCtPC  vC \jrCt\C  vC tjBCttC b vC jCtC  vC j CtC B vC j CtC  vC j CtC  vC j RCtC  vC j "CtC  vC ȍjCtȍC  vC ԍjCtԍC  vC jCtC  vC jbCtC  vC j2CtC  vC DjCtDC b vC =u' j]ÐU=t*=u $1Ph@(/ ÉU"tUEu v"t PÉUh`} vQ}t#j hh`}jh!vj hh`}jhj>k$hbO. ÐUS(O,sm{ tZ;u C vC C{tCPCP- ЉЉP rx j]U WVSu} >~Fjj VڊV: u؃Q9twufA$ 9uFFAPvA $9 F AFuA $<t A AAPAPWE } at je[^_ÉUS,smv{tYS:tP h* ]ÉUS1ۺ,s.z}bztJ:t  rӉ[ÉU WVS11E8} ujbY;] }NUt,t%u tW'EtCt UFC;] |tWjoe[^_ÍvU=dth5dr^ h\ d=du.ha) XdJdX'ÐU9=t @ÐU WVS]=dt;ufjj SjjȻÃu߃jj賻 Sjj蘻ÃunSϻƉ߰ЍPt'D;Xw;XXXd)׃WR\ du2h' Xdd X)щʉ)щ XSt C7…|'~=u vCut1e[^_UWVEƿt_ƿ}tLƿt9ƿ t&ƿtƿu v1^_ÉUSd)Ã}u~rh`}19~2S5dh`}CPdPj> h% =dt,5dY Xd]ÉUWVSE1EhFOE=}Q}$Hv}0 u9u0=Њu'= =ď u} OBu/FOE==ď (vu3 u.FOE=f=Yď =u#=uď jh=Њ==ď }=u#=uď jhA=Њ==ď "=u=hďjhJ$l}#}}}hhh#j @P@v}|}v=o=bďjhShh#A-Shh#%SShh#ST} Shh#S u !Ċ jShh#yS j}Evu}+=}}}}tt=}}s'}}=}}s }}}}}|Shh(2}4=}}}}=}}s(}}=}}s}}}}}|}h~P}}t"EPh@}~EE5@}h@}vǃ5}tEPh@}61}u}te[^_ÍvU=u1+jhjOUWVSE1EuH}t"EPhEE5hǃFuOE=T=t(T9E=.t  9u!jhjF 9u!jhj̊9u!WVj}vT9t GNM‰Ӄ t u|p=̊t[̊9uPt,u$%9t 9u FOE"WVjl}=t|9uq~-u$%9t v9u OFEB=%@D@j tRuj tv tvtd} jh`}d} jh`}=u#d} jh`}Td}!d} jh`}1d} jh`} Vu4d}jh`}d}jh`} d}jh`}h`}:}tEPh1}u}te[^_U WVS1h`}Ht2=u$"u=tu th1h t =`1Ƀ=uh@}aȃ=Ѓ}%PSVRWQà ht Ãh@}ftJ É؍e[^_ÉU=`jjjj jjjj jj!jj" jj'jjw h}賬tjj#=Ht 5H ub(juju8ÉUÍvUd}jh`}+d}jh`}d} jh`}j8 jhh`}= ÍvUd}jh`}d}jh`} hhh`} =XtÍvUd}jh`}?d}jh`}( hhh`} Ud}jh`}d}jh`} hhh`}6 Uad}jh`}d}jh`}~ hhh`}ÐU$Suh 1cvEEEEEE]h`}U)Ӄ9|!SRh`}CPEPj>[ ]ÍvUd}jh`}d}jh`} hhh`}=Xt=tÍvUd}jh`}7d}jh`} hhh`}~=Xt=t!ÍvUd}jh`}d}jh`} hhh`}=Xt'=tÍvUd}jh`}?d}jh`}( hhh`}=Xt=t)ÍvUd}jh`}d}jh`} hhh`} Ud}jh`}sd}jh`}\ hhh`}U$SEPEPEEEEˆE]uE]EC]US]tjjt jj!]US]tjjit jj]Uhh hkt jP hh hAt jP vSXU WVShǃhÉރ ~}t vS5Ã~W=tS5j>r9u(9~$)ރ}uV5ȏ~ƃ~Sh|9ut 1)@e[^_ÍvU1҃=Ȋt tvu=Ċttt=t'u-=t!D;H~"t ÐUS]etP]Uj|ÐUÐUVSuSvvSW4  a4%t%vSi a4Fue[^ÉUjEPuu uGÐU WVS]=$t=$Xct5$k tQ޿(t>h*S $tSh@+F 2Sh,hc $Xc@=fe[^_ÍvUWVS} uEEEEPEPhO5$C = tM~9s.P ;u*PhX5$ C9rԃE=v ~ 9s!Ph_5$ C9rE =$XcuhdhXcvhg5$} 5$, 5$, e[^_ÉUSMU ]=.u+w4QhiSQhst4t$t1uv  t[PQh}5$ 'w4hu h Sh5$` vSRQh5$B =$Xcu#hdhXc! 5$+ hg5$ ]US1ۍv<'wP4h7wP4hPSh2 tJ'w4hÄw4hÄShф'w4h߄ow4h߄QShFtD'w4h&w4h Sh R <'wP4h6wP4hPSh. tJ'w4hEw4hEShS'w4haow4haQShoFtD'w4h}&w4h} Sh Cb]ÐULWVSE}=u!?=E 80h uh[^_Uj"h@}ͪuhXc hc jZtÉUS]SD8 U WVS]u hhc߰HPjSV8 Uuu u ÐUVS]1=p&t p&uASHC@;C4s 9t.vC4D9u C9u9Ctp&@uu 5p&Qut p&@1e[^ÍvUVSuM UFX$tKvt\ ǃ u%PhhV;hj ǃ u!PhnVthjhXc ItSu qvthjhj苍hXcO -tp&@p&@ . v1e[^ÍvUSE] @@$P2 =tDwKt=w2t6Dnt/=t(6=,tw =t"=Xt =t X%1]ÍvUUtjhtj4 8vt@R8<u tW1ÍvU5p&ě%ÍvUM =p&t p&v=p&t p&PEE@H)1ÉUVSMA9u 9A=p&t p&0=p&tp&XvjQHA@;A4s vA4DP5p&Etjjjj5p&/ SV5p&j5p&%e[^ÍvUVSEU @X$t`thj4whj$Pj P胊tW `cy `c;pc|Xc XchXcj y' hj%1۾ `cy `c;pc|XcXchXcj' C~1۾ `cy `c;pc|XcXchXcj & C~ `cy `c;pc|Xc XchXcj & hXc v{* v1e[^ÍvUj5p&%ÐUSEU M]@@$trtt3v<%1[ÐU WVS]} uVCHP5p&mt1sHVWhjSOye[^_ÉUE@@$t12} tj5t&h5p&譓%USE@X$@\}tGtijhPvuRu hhXco ,t"PhhXcA 1]ÉUjS t j- E PuSeES SX t%PVjtWh3hXc t'j+ P EPK, vUVSuj/V>tphjM Ãu jV3؍e[^ÉU WVS}hj ƃuj7w$j t TtPj' t6Yjjhw Ãt=PS' uh7j0+ S* We[^_ÐUVSu] EPjSEtt$>Vhhc轵 j* vSVhhc蟵 j* e[^ÐU塘@$ ǀÉU塘@$@U塘@$ǀÉU塘@$U WVS}u _$h+ jhR+ hLPj=jh+ hlPjujjh* uThPju7jh* u!hPjj7thLjjkuHhljjSu0hjj;uhjj#thjV,q1e[^_ÉU,WVS}u EE]EPP* EVSW*e[^_ÉUSEX$PjjPjj Pjj׭Sjjĭ]ÍvUEǀXǀ\ǀ`0ǀdǀhǀl ǀpDǀtǀx4ǀ|xǀ@ǀDǀhǀбǀǀTǀ(ǀxǀǀ ǀдÉUS] uh hc tSh hcױ E0R Phhc貱 j& U,WVSu }UBX$Eu @t(@tFTF H tF#v}F vtWEPEPEPjUR t }tuuEPF u1EPD PhCUR)PhHMQ PhKEPt-uHtB ǃt ǃ0 󥁋<<@<1440PjjY u1h0jEPEbe[^_UEp$1U WVSuu 5ÃtStN߰Ѝxt7P3 ujjuaGPS6- 1e[^_ÍvUS]t ǃt ǃt ǃtk ǃtG ǃ]U0VSuE t jPuhPj(]S_ jSVe[^ÐU WVS{t{3ƒt_tZjj{HPsװHPR{HPsUR0X{u؎{3ƒtnti@C 9@t v9utJjjjAPװHPR{HPsURR0{r{v3~ƒֿHtu{ujjjjjj{HPsװHPR{HPsUR葭0t Ov{KUBDt-vG$tw wwwwEP ?u1e[^_USEDt@$t P蟯؅u1]ÍvUU t)tuuuuu R1ULWVSE@P`PhJj@]S\ Sݽƃttu1tTE@P_Phj@]S^\ ƒ ju uuHPVRSEP vh`EPjEP`ae[^_ÍvUVS]M uCP$t0ttz?tJt.lCTY>%PRSN@>tjjS%{ tC xtjpS1e[^ÍvUlWVSu} jÃuhEPSO}ShquEt}t'E %PS#}@t5Sh%E$%PS}tShjV[1e[^_ÉUWVS]}t E11EPhht@j"tu}} tlthQ t@S8;4t-;!`tX@S8;NEU;VjjSW BCM;vVUM;uBQ)‰@v1PMq1W ECU;s%vVjjSW CM;rދUM;tVB@PjSWx 1ۋG }tlE1a4t/UvRa4vUG@6t8VuE}tw$E1FPxFFe[^_USE1ۋ@@t_vBσwJ$DB2taF>:t>uF9sWRhhPB  URQ谁uDžt^@P ƃujjEP=C;@PRV U rf M qE1[^_UWVS]CLCPEs tC @uvCLPSm'w{LuCLCPjj HP hS6 *dž t'CLPS&{LS BtBCLBCPHltd@S8<u dtS CLEEPjjsLS tCLCPXv}uCP;EvE}tCPCPPsLS«CPCTCLEUCPBjRj'Sc?e[^_ÍvU WVS}u uw_ GLCGPCKC{ s tths jWDs  C {}VWB09u CB4 CBWB09Cu B0 S{ts S G Fxt5P@Ѓt%}uh sjWKDvVW&VW< FX uV~Lt%vLvthvLjWC~Pt%vPKth(vPjWC~HtvH ~TtvT ~LtvL ~PtvP V 1e[^_ÉUWVSu]FuF9uӃ}u 1EPE PVe[^_ÐUS] CC C,C0C(C$jjhhjpC t1hju6KX]US] {tCP@C{tsI CC C,C0C(C$1]UMQBXt11z,tALB,APB01ALB,APB0jQÍvU VSu^{ wj C PsV1tuCSE jC,PC@PR C(EMACEE@ SjPQsBЃ t C(C(C$1hhVe[^ÐU,WVSu}^CXt1IcX{,tjV#C,uDEPEPju Vn tH} tu V EE3!EPEPju V* E;C vPC PsVހCCjE PC@PVQ uuCPAQ C(EMACEEUP SjPQsBЃt C(C(C$1hhVye[^_U VSu^CXt1{,tjVC,{ wjC PsVttCCju C@PbP C(EMACEE@SjPQsBЃ tC(C(C$1hWhVe[^ÐUHEtuhjU2>vtMTt DžPjEPUMtZqMAȃB9A u A EPBUB$MAȃB9A uA vEPBUBtDžDž7t *t t 3P4twWhĞhS ߰HDžDžHjP$( tqjjjjR0 jjjj)90 jjjjD 0 jjjjH0 t@Q8 A4`tX@Q8XA8u5t,/ru2E8u*iqvltd@Q8 d@U u t QnfE8x tg@ xP EUuj\>0M1p@ pE0UP(P$ ru @x x$u jƒ:@$0藻ƒ@tJ jjR˼MA|xt 1}tUBtM;Htu UEP0 Pe[^_ÉU WVS}uuEPE PW_1EPVW l1VEPE PWo }t'1tGt;ptu U vV藨 e[^_ÍvU,WVSEs@X(tU @ыQ8 E 11M\Gv#9w#M9Qts1ȃ\Gv1ۃ}tEXt Ut=EE}wehEPjUR>dEA{xw#hCxPstMQd{CtCtECxEUuEEE1U\UM<}t E ;F FEE4hjVEEEPU<%dMQR uPV E FUTUEPM1EP uPVʪ EEUEG# EMQmUBMQURjMQЃ 1}tUBtM;Htu UvEP e[^_UWVSUB xHE1ۅtZt Ut>EEE;EvbPEPjURbEBE;CxvPCxPstMQanCtCtECxEUuUB X;tv;w@MQ]BvPEPE;w@MQBXPEPuPV uC;uu:F FUtmz$tg1ҋMA$8t B8u~@Rjh]SPV=Ѝt:F FU1ɋ]C @t6`EPhSÃuSV= u UB @t,EPhRNÃuSV u t,F FMA@XtEPhQEPhġ]SÃuSV襧 uUB @t;t,F FEPhӡMQÃuSV^ u ]t@S8<uGEt;t,F FEPhURCÃuSV u t:F FMEP]S}u,EPhSÃuSV菦 uvEPhEPÃU 1uPuM QSVЍt0=EPhUR[ÃM QSV语Ѝt  F+UU]Mt\ЋM;A8vRE9s$;/tvC;]s;/u)ڋMA89w;]u]C8)K K.K.K.)މuEPMUBuSjRЃ 1}tMAt];Xtu UEP e[^_U,WVSu j/V8ÃtY{uSh%v t8uh1] t&8t!PVh6hS jjjjS u= hϠSj@DžjRPP‹B Ѓu u;tFP‹BЃ= t Kh`SjEPk3 UBxht @hP@ЋUBPh1[^_ÉUExht @hP@ÍvUMU E$lPhQuovPhQa[vPhQMGvPhQ93vPhQ%vPh@Q vs vÉUWVS}] u=wuU%1C=wuU%1C=wuU%1tu{|uoEEESE1ɅtOtCyht=QhjEPEPqhB Ѕu$Extt@HUEDEt߰H؍e[^_UWVS}u >t;vR va4%tF>ù>u E zvE@v}t&1}tUBtM;Htu UvEP輜 1E}u"UR螛 Ev1ۃ}tMYt Ut5EEE;Ev_PEPjURXt@ECvM;KxvQCxPstEPXtCtStUCxEUp]}Ou D>w@MQBX PEPBC:t9rF>t9r9Ee[^_ÐU<WVSEEEEUMjjjj?EP  UjjjjR~  M jjjjQX  E`jjjj3P2  Udhh tRh hS߰HEjPURo tDž( h tRh hS߰HEjPUR tDž =-t+--BBB HEjPUR tDž 8 =:t$::BBfHEjPUR tDž=Dt"DDBBHEjPURtDžQhPhghS߰HEjPUR9tDž v=qt"qqBBHEjPURtDž.}=tǾ󥍽HEjPURctDž&hhhS߰HEjPURtDž'vhhhSE߰HEjPURtDž+^v=ǭtǾǭfHEjPURAtDž2vhݭ× tRhhSj߰HEjPURtDž4=tǾ󥤍HEjPURjtDž5#= t+  BBB HEjPURtDž6=t-BBB fHEjPURqtDž9*v=$t$$$BBfHEjPURtDž<hBh.hS=߰HEjPURtDž>VvM t@Q8HEJu Džh6hS߰HEjPURtDž0vMARQ`ЃXw DžLw Dž4E t@MQ8 UHhAhS߰HEjPURtDžIȣ1ۃ=ȣ-uvGtt-ttvjjjSMQ j6v[Ut0@ыQ8 v[PjjSEP v[Ut0@ыQ8<u_v[<tSj[Ut0@ыQ8[Pj SEP! 苓 vC?U :tgȣM 90t40SHEjPURSuE M 9u1/E ȣh`jUR[^_ÉU;nu{ouESE}uSEP{uȣvUE}u uM Axu8?u E UBrvMA t}t hvUB t}uhSjMQ}t h MA }t=vUtMЋ@ыQ8 vvUЃ<uHvvMtUЋ@Q8<vMЃ<Ext!EPjURMQUBЃiEPjVMQNEPjVEP33UBURjVMQЃ}tjjjVEPjjjVUR) }th`SjMQku}u}uEEHU=wuU%1Lj EPMQEPSJǃEPSEPƃEPURMQà r tt28SVhjEPSVhjURg 裎 v}t.1}tMAt;ptu UV }1}tUBt;XtuU~vSC jvE8vRz va4%EPSMQƃEPEPURsà SVhjMQa }t,1}tUBt;ptu U V臊 }1}tMAt;XtuUvSK rvE@ @t}uh SjURMA u9vUtMЋ@ыQ8vUЋ;EMyt#EPEPURMQUBЃEPMQVEP(EPURVMQ角UBURMQVURЃujjVMQa}t"h`SjEP EVu}u}uEUJ1MA vUtMЋ@ыQ8<uYvvUЃ<tJMQvUtMЋ@ыQ8 vvUЋP1MytjEPURMQUBЃugjMQVEPuPjURVMQ5u9UBjMQVRЃujEPjVURL tE賊 vE M x}tEPURgE؍e[^_U WVSU }uRMt@Q\8 RUt+VfmƃujjMQet0 t u{t s s3EC) tu;t 3轆 3U1e[^_ÐUS]M It@S8It8u'}uhȣjS%1]ÐUWVSDžX EX8!DždXX~8UZ81X$d ~ʃ$d1dXDž\DžlDžpȣ=ȣ_UPp-ȣpA } 2$} t} vpC CvvUtP@ӋS8 vvP v]t!P@S<; cvE; IgvvMtP@Q8 vP v]tP@S<; vE; vMtP@Q<<uvE<vUtP@ӋS<vEPvUtP@ӋS8 vPPu'vM  vv]p8H`pBt[rVvvMtP@Q8 vP<` vMtP@Q8 vPPhjtS߰Ћ`T`vMtP@Q8<ugvvP<tUvMtP@Q8 vPǰЋ`T``d9`\4\l4lpp8\X9\~\XDžtGDžT9TTDžh(vhd)PhİURhX9h}-ȣPEP;\|T9T| ldhȰURKDžTl9T}TTȣPEPLTl9T}hȰMQl믍vhȰ]SS8[^_U WVS]} 1ȣGtdr7It@S8<uI<t ʰPhͰIt@S8vIP7hҰ{It@S8<uDI<t5It@S8IP7hٰSƉe[^_ÐUWVSu Eȣ=ȣ0EEUB -ȣBt{rvMtU@Q8<u&M<tE0hV oU2hV WMtU@Q8 MPE0hVr UtM@ыQ8<uU<hV M MvSl  a4%u\u+\NyF;F| vVj\{Ny F;F| t VS^{EEn=NyF;F|Vj=%{UtM@ыQ8UEMvSk  a4%u\u+\NyF;F| vVj\zNy F;F| t VSbzEEn NxVj 1zF @tjjUREM91e[^_ÉU,WVS]]h^jj&h@EP t@ȣ]h^jjOhȣEP…t cv1\߰HEEȣ=ȣt0ȣ!2ߋMu }uU:t :|~׋Ee[^_Uh u juÉUUE 02̚ÉUUE 02谚ÉU WVS] uE1УUԣH}u0vt8@S8<u9 vv<u+jjjVS jjjVS jvt8@S8vPj VSl tjjjVSU yvt8@S<<uov<t`jvt8@S<vvPj VS tjjEPEFNEe[^_U WVSu1ۍУԣ[t8@V8<u @[<t6[t8@V8 v[Pw [t8@V<<uJ[<t:[t8@V< [P2w CNe[^_ÐUE8ujjjjCuo1ÍvUUE8w jh8w1hhjRbÍvUVS]u>u jh >vhh`jS"6jjjS >ǃltd@S8 dltd@S<; t= v;ht0ltd@S89 w9djjjjIS/ jjjjISHltd@S8 vdltd@S<; t9 v;ht,ltd@S89 w 4v9dv)HPjjjISy HPjjjISc1e[^ÉUhjut1Uuu1UW}Шt1hju&}US]S虘 1]ÍvUUE8t  1ÐUS]@t􍃰PtP1]ÉUE 1ÍvUW}Шt1h ju:}UE8ujjjju1ÍvUS]CURS`Ѓt}wuuu S1]ÐUS]CURS`Ѓt#EP=wuuu SZ1]ÐUS]CURS`Ѓt}vuuu S 1]ÐUVSMu t@Q8H9s:H9r. t@Q8Hu1[^ÐU,WVSE} u&UB E hjӁvRva  a4%t.ӁvRUa4vڋMA@E E t 8Pu} uMwÍ@MQBXvPEPԕPhjURpM YE8unEPUR6uσ}uQ,vssujMQ艤 uEE@\E 9u͋UB1M AtUE}uME@M0vssujUR .EMA\E 9uɋE@EPU2MQ -1jUEEPEPjuMQw 1}tEpt Ut=EEEC@;EvaPEPjUR+tEAvEC@;FxvPFxPvtMQ+DFtFtEFxEUu}t)Uz}tGtWuMQ@s }{tssV#s s}tUB}t }O) v})1EM}t1}t {%UBP1MAE 9uVtWuVr +EPEPuURZMAX;EwEAXA`iE @ E+uu1}tUrtM;NtuKUUB;FxvPFxPvtMQZ*FtFtEFxEU0vUB;Ev PEPMQEP*EuuUrrVq tMAWuPq Ex+EPURuMQ<uqUBX;Et5EBXB`*vssujMQ٠ u:EE@\E 9u̓WVujUR誠 u MA\11}tUBtM;Htu U EPl ؍e[^_ÐU WVS}u Ehj ÃujjV߾EGGCC {C,CxCxC|uǃt R f}%t&SD)t&S )t"S(tMt|Wi ujjS`ujjVG~Wn SVzu; SVfuSVqu E1Se[^_ÉU WVSuN t1>t6VB9u FB FBVB9Fu B VV!rVet u3~$t-^$;t3^i ;uv$Hi ~xtFxPhti th @t􍆰P th tP th t{h V;Vfh e[^_USUZKC 9t9tC9tavC9CtTK9u AC ABC9AuCQCCA9C uK CHKv1[ÐU WVSu]ExLw4EPUR um}uEt`jUR^PE t*u}tFU2:Fuy}tE0UujR E@UuPEPjjE>Fv:\u B9uBKBAKt9uB}tE)Uu}} Ut PEPEPEPSVEP^U@t U E1e[^_UwӋMAS< t%MvUB:Rw u )<~ N9w F)SWRW 9u9)u} tAPMQ P[W th!jUR10} u ATtP W [^_ÐU|WVSjj+EPDt vUt@ыQ84 EVuh3`uh5VjURTDžjh@ShISbǃsjGPjjMQ"n v ?WhStpjhS!uYj Sc4ƃtEWhSet)jhqSuj S4u%h`PjEP+vEPPt!8u􋅜PABEPGPPEP PhDž Wir􋕘R[n.uh0􋍘Q>c1x[^_ÐU WVSjj+EPt vUt@ыQ8 E||R^uh|QjEPU RDžDžDžtDžxDžDžpvjh@SS|PhhpR諚 jjpQ1ǃjWjjEPk trMvDž DžWhS trjhSu[j S$1ƃtGWhSt+jhqSuj S0Ãu hpRjMQEPPt'^8u􋅜P/vPPZh EPW8xt;UxtpQn-xu!jjEPəxv􍅠P1-tu0jjUR茙xQF xt HtVF SF Et􋕄R~P vWgP 􋍘Q)j􋅘P%_xu!hRjMQtC~h jEP藘9~h`jMQsjtPE PURMt8xQE tPE 􋕄RlO /MAxPPHTuU JHX@1X[^_ÍvU WVSjjEPLtZ,1t&S>PE PN |4)ƅuh PPN Ãu1hEPju聛[^_ÐUVS]uE HPSVN t'j S-tj)@RPVO v1e[^ÍvUVSu V@ÃuhujuEPV؍e[^ÐUSEPhthhju薚-u hhhS' SxÐU WVS] }Et 9rn=s7u V;B VSC Åujju辕t)PjRF 7 1e[^_U VSuEPEPEPu ust}%@}t7;]s2U)U vBEM}t E8 t8 tЃ}uH1e[^ÉUS]j/S{t@؋]ÐUVSuFP!A Ãujju豔tVu S9F 1e[^ÍvU WVS} u]]SVW4(UB8u !v+8"uE8u v1e[^_ÉU WVS} u]SVW\U8u 5v8"u&E8uU:u 1e[^_ÐU WVSE0~VtKss sVЃ;tCBSs @ S@ _luTtLJLJC Wt@%PjVQWVUVt!ujvLVV<t4@V8<u 4t@t@V8<u t@FTSj:FxPV6 FTujjjVSiu,FTt hJV誟V- jtjPB VxzuLJLLJvBBLJVt TFTujjjVhu)FTtFThNjVT|E01e[^_ÍvULWVSE@E܋UUM܋I|MăytA ]܉Au@t,ELP}W+uGPEtU@ Mċj3jȃQP6A u V}W9 EF1~%vUċB uMB /vS,  a4%tuFNuEăx:u"vUJBB:tMăy"u4]Kt CC8 uuċF8 hFNVEăxtIvUċBvS,  a4%t MAIuË]ă{uJtuu }t.EP^&U܋R|zMf}ytyuA8t ]ĀEPuV}WP}=~tDUċBvS+  a4%u:u MAIuE]ă{C8|8 Ph^#tsuCKz}ċ}EăxtCUċBvRn*  a4%tMIAyuuċ^+]uhij}W"U$оMXEΊ:uAEE:t9lt9pt9+t9-t 9^t9#uk}ċG)ȉOG$XljE@0EMvRa4uS}W'UĉB uSu}ăt!GEH@xt UċB9tMċA+EP]SQuVD3"}ā u E@(/Uāz xu MA(]ā{ 8u uF(}ĀKE@ 8UR( x`u#Mu@`YLCXdAPuĉFh}ĀEt@MQ8<u]tuĀN} }ĀEt2UċB @ u}t MċA 0hj]S؈vuċF @ }uEE}ċGG t t t  8|Eăx@8!uUBJJ}BBMăyv]ċCvRJ%  a4%tuNF~u}ăG8+wGOGEEȃUċBt tA[vwӋMAS<t#=uF:Rw.SV[u}ăvEOGG,vSk$  a4%uEEUJBzGMċA+]ȉ]؉Auā~ t~ t ~ un}ċ}vEEUJBMăyCA\u+yv%x uEIAAuA 뮉 u}ā t  hEEăxvUċBvSJ#  a4%tEMIAyuuă~|!s~ t }`}ăSG8 GEH@x2UċB8 u"Māy XytC]ċCvR"  a4%tuNF~u}ċGvRA"  a4%u UċB8|u+}ă$X}G(e $G cUăztXBBJ]ă{t>uċF8\u~v FNv}ċG9uJEH@xtuEUăztB8 ȉM̋]ċ[]uă~}ċGt tAvwӋMAS<t#auF:RwRSVDXu@}ăv7G@E t|uCEUB EԋMIA] t|u ]ĀuN}EEH@x-UċJAMJJ]ZBB)ʋE@)‰ЋuĉF~ uMtv}?\uEHuUċw tV=MċA`: t/]C` tBEPuV>g}uCd}GLUĉBdMAL]ĉCduFP}ĉGhvE@`MċAlQpˉCdShuă~`t}ă`G`Exu Gl!vEălPURufM tyluAd ]CduFpFh}ċG`G`ExLuX tOEPURe1}uGlGd&vMAL]ĉClCdvuFL}ĉGlGdUBPMĉApAh)]C`CdShuĉFlVp}ă`2Eāx @`UJLAHdJL@t8@]S8 ȋu8}ĉGlUBPGpGhEPRd8}tUM;QLv Gl9vWl]C\C @ E8u>!u(}ăG8!GOO}Eăx*vUċBvR  a4%tMIAyu]ă{uF$P}ăQvUċB<^t8<+t* <#t41v<-t %v]K\6uĀN}}O)EĀH}UJ)MĀI}]K)uNF~k}ăvUċB<.t,<+t2<-t<=t<<^t,yvMĀI| :v]ĀK|@.vuĀN}"v}ĀO|vE83:UĀJ|MIAyu]ċC8+t8-t 8^t8#uj1uV}ċG=wuU%v1UċBBQBJJ|EMċA=wuU%v1u ];+huċF8+t 8-T}ċG8-uO|UċB8+uJ|j EPMqEP }u ];0 uċF})lj)FEFE8auFlVpMĉAdQhEAdHAl E]ĉCXuĀN|v}wwWEP'EPEPEPURMQ s }` }! }tu]SP` EuĉFT-v}ăt+ %PwwWEP% 5UrrRMQ]CKuċFEE~}ċGt tA[vwӋMAS<t#=uF:Rw.SVOu}ăvOGGU4vS/  a4%6ME]KC{CE+EPuuV}W#~JvUċBvS  a4%tMIAyu]ă{CEE{vuċFt tA[vwӋ}GS<t#=UB:Rw.SRLNuMăyvIAA]u}OGEqE+EPuEPUR"NMqqQ]S'Eu>NЉE~ou }$UB$;EvM9w@]SBXuP}WKPUċB 0h jMQx E];uă~tI}ċGGvS  a4%tEHu‹UăzuhIMQЛt!]ċC phLjuV@xav}ċG`lu2uyEu udjjUr MQ ]sluV\u7C|u jjjVEP}Wl\EUĉBlMăydu3uR]u u=jjuv }WEpdUR[ujjjMQU]uu@}}G`tNUBLlt ;Glu ~twMċQlu]SLCP؃PPRSFuFL}ădt ;Gdu 6t/EċPduMQLAPȃPPRQ]ċCCCCut/}GLEUGPBjRj'WPt6Et@,Uztu R#]Mf}Q]{t>t5uTu)u y uj}WU܋|ЃMĀ]ċC SuV@Ѓu+FTujjjVLu-FTt!}TVEGUt RyMy]ă{\} C\9ALwjh`jQtuFLЋ};G\s jjjVUċB\MALPQXuhj]S|tvuċF\}GLExxLUĀz|}fb|Mtfa|]C|%6uLuu@t@V8<u v}tE@tt&UBLEE@QPPMQRc{ }]tu؋}Ȁ|7tZgvE؋UȀ|wT]CS<t0=uV}؋MȊD9:Rw$PVGu]KCCuċF+E؉F}~WURP$ @MċAAAA]11ۋuF@|aUBPwH$luDhjMQvu(h juVhr v" vEċEąu/'UhyvhɼjMQr5vh]sjuV2vjjj}W PjjEP UăzzMċAAtt>PwӋuFS<t#5}G:Rw&SWEuEăxv H@v t|uUăzvB MIl]ă{uE܃耋u9F|th`j}WqWe jEPlNthjURpEEMǁ]Ee[^_ÍvUWVSu] EC`{C2'$~ ClPVT{l%CdCpChC`15~tPC`t5t @t8FLCdFPChC`"vClSpCdShFLClFPCpC`C8;u9C`tt )t! vCdFLCh ClFLCpFPCKEPEPEPSVz E8Y}tqC`t)t Qt3IEUCdShC`3vEUClSpC`vClSpCdShEUClSp1C` tvtgFLCdFPChC`jvjjjV wjjjV gjjjV WYjjjV ?ClSpCdShFLClFPCpC`{`u!Cl;CdshjVmE1e[^_UWVS] EUMyu:CPhjtjjjEP UC8$,ME@PURQCMj EPsEPƒtRj]EMACU)‰)CECM{uhjEP_ljMQC@PEPaiCC{vCx/t)x?t#hjMQlECKCu8/uruMALMMAPMAptpPEPssEPPMQ҃ uCU)‰)CECMEUBPMAzLu-QROt E8t UBLM{vaC@=wuU%v1t8C+6CvR  a4%t CK{u1{C=wuU%v1uC8+t8-t 8^E8uUBLMBPA{CvR)  a4%tCKuʃ{TC=wuU%1uC8+t8-t 8^C=wuU%1uBC@=wuU%1uC8+uFvNKCC8-t8^uCK1j EPsEPƒuC}}}4);E(!~}~);Ert Rj\vt+uvuCM))CECaE8tEtA}؋U;v/hSU9sjjjMQ=U21e[^_ÐU WVSEPUvEp|9u'UTv@ F=~3FP^tFBVV9 FHFVL RQP] FLFCUBLFDCFP t1e[^_ÐU WVSExvCPtVKƉ91uAC@AB9quC<QQ K<9uƃsH ;tCBCS_ _|9sG|@1e[^_ÍvU WVS}1ۅt_t Ut.1EE@;EvMPEPjW{1E@;CxvPCxPstWUt_CtstCxEUE0Pu V hVjWui 1tGt;ptu U vVg e[^_ÍvUS1ۃu u]t=t=u؋]ÍvUSUE |!t1H1ۃPRt =؉؋]ÐUWVS=t0U:%M:uΉ׋M u ;u1[^_ÐUS]U MEt4rtt&jj}vh.nhIb{uj1tPSgwb$Th.EPSwHu;}t uhhjSc v2h jSuc]U WVSU Bxu5jjEPٶhjUR/ctf U BtPTvR!  a4%u*U BtP|_thjEPUvU Bt;t9vRva4%C;uȋU BtxpEvR] a4%u;_uE1SvR# a4%u{_u9}u^CNzjjE PtBpB0p0jjURhu7UBT1+vh vh`jURaae[^_UVSuE @tFTtjs3VPth3jVNev1e[^ÐUju u2Uju uUju uUWVSUE@E]{ujU B 0Smv] {dExLBwtOuHU zdt?jփlVӃdSjEP !jVSURI  ] {S[vօt > tFKu9uuIEt)Ѓu:.u Ft`KS)PRWGjUR@ t"FKujh WGjEP@ uhstU rE XUEjPU􋂠Ѓt#j] C 0EPbvU4th Rljh ]SmPSl h SlSm E @}u5U t@ӋS8<uEtU<t4@ӋS8<uE4t@EE@E@QjPUR5]$ssWGjEP? E9u֋UzLujRAt ]CL1e[^_ÐU WVSE xxu&Uz(t B(xuhgjM'E thxxuJMQ(zHPrU RMQiE PUR<M QEPvjU B|%%PMQ*E xxU u6z$t0Z$;t3 ;uMq$ E@(jU Bx@PMA$ujjQ9\vEX$U rt&p0MQ'tŃxuUB$B(0Rt1ۋM3UB(pRjM@tH  M A}t$RjPEP-tUB(M1e[^_ÍvUVS]u EPSs t juS:uHFt0uƒt F}$%PjRut juu1jVS‹EP$P(EEC1e[^ÐU WVS]u C(;C$uhjSEZt3S(zHPrVSWupVS9ijF|%%PS*'uCC(pS t- F}t$RjPSuC(1e[^_ÍvUVS]u {$uhjSlYjjF|%%PS&uGC$C(0S t/ F}t$RjPSQu1ve[^UWVSu~$uhjVXEEE^$;v;HM;^(uUF8H9ErUEh}tEhV5fE;^(uP3;^(uPhVeF Tu+jjjVl/u FTu ;5hVe1e[^_ÐU WVS] tCxj@PTEujjEPWut4u4}HPEPEPut:1=[t'vp0EPGtփxuEe[^_ÐUVSEu C$jPf CFtC$Fx1e[^ÐU WVSE}uVP. S$CVW0% S$CS$CpC$CU BtC$Bx1e[^_ÉUWVS}1ۅt_t Ut:EE}w[hEPuWE9{xwhCxPstW蹿tuCtCtECxEUEuEPEPEPuuuE PW0t91҅tWtE;Btu Uvu v}tX]u9s5vRPva4%tC9r9tuuE PW51҅tWtE;Btu U u! 1e[^_ÍvUWVS}1ۅt_t Ut6EE}wahEPuWQt(EC{xw&hCxPstW)u yCtCtECxEU'E+EP]EjEPEPEPSuuE PW0jj4Wtzijj5W\zQ|tt@W8tE];tcvvRva4%u2vRV a4%uC;uEXuxt&NCPEPt~vRva4%uCvR a4%uPEPruCNutt0]EuSF;*uEPE PW 2EPEPEPWF tuuE PW<Ã1҅tWtE;Btu U u؍e[^_ÍvUWVS}EEUvS a4%tEOu̅UuEME t tAKvwӋMAS<t#-UB:RwSR\%u vEO+vS a4%u EEOeMQEP1MQ$AMHMA}tgvE t>tGF>wMAS<t+*EP:RwPUR$uFFCMuMA$oUBM AtB$Ax1e[^_ÍvU,WVS]E 0U$EEE}kU<# lu8EPVF#t }uGlGdSE0EPGlPGdPWV3!UVL tFPFPPRV茨 vEFPuhdVK1e[^_ÐU WVS] UB@Xt)C}u#B @8/thjR=vCxt thvhub6Pt)ƒtztB8uh jMQ>=hRCt _vPu 1+v{xCt:/xu :.xv!8.ux.ux/xUHt@@ыQ8 E@vF>t>:uF9sjQRhKhW(; W~u/hWQ hQWjEP5@V>xhoRjMQ @[^_ÐU WVS}8u!E PW(t  v8U Btp~4vRva4%@tNC̅]~7vvR<va4%@uNC̀;t;0vRva4%@tC;ũEPuhjW:SU RW@Ѝe[^_ÉUWVSuh{E }ЍX1t~t Ut/EE;]vVSEPjVߣt"E=v;_xv"SGxPwtV轣u GtWtUGxEUCPEPUR>EE8tPU RVQhEP]Au1tFtU;Ptu U EP1e[^_ÉU|WVSuEU ZxHPVRUR7E 9XxuhURCU 9BxtjVEPbU Bt0EPVvtVjEPz8jE%f=@uVhVhhW77 EPWgvtWjUR!8Dž!j/V}t ЍX7PjyǃujjUR7G4G_ SVP8EGWEP unRWEP2uSBtBxxGWURtjWEP 1Wcx[^_ÍvUlWVS} hwhhS5 EPSt uЃFPG,ujjEP63vjjPSÃ|Vw,S9t0hPjEPq:SmS_G,1ҋG,8tv8:uxtB@8ujBPwG(tnÃhw,vhj`u1ZwG,jj/w‰W(t G,1,tw,G,[^_U$SDžBRnj|PXj}hjEP/cU Bt;vhjMQ4txtptxt pvj tjss jss? .EPU rhhS20jSh!h$h'd h/SjMQ7jpPM Q$ h9p~U B Bh;\M A1U,WVSE~uh@jP2vEE96urj jztEÃXUZ j,jRtEHMAUZ9Y uQ MAUPEMAAEPuUR9ǃMI ME@LEURPUEy}M ЉUE^trv MGPuhbs Hts  EPWSEP_t(}tURWMQޝl]u}uhhjEPl11IGGU B|%%t,PwMQ輔E@EPwUR 96u%M1q9vuN vUPMEw9vu~x>wWUR) }t/MQMA BEPALB MQMAPBUBMHBUP MAUP}tMQ}t EPye[^_U WVSu ]JvRva4%tFύv> VvR a4%E=t':tvEE8t:uU:uQh>w@MQBXvPEP<PhjUR/vNM~tAEvR a4%t EU:uNjM9uhbEP51U:"zzu}RvR a4%t2MQvRڿa4 vEPMA@t8Put@PUxv}ЍxG#Pj~oÃujjUR-tBCCC SSCB OKCWURPCD8K1e[^_ÉU<WVS8j VItVE phjUR- M qhV(PPhV|uvE phVڬj VuCvU BHyrvM A5 u+1\vtS t Kvt+AװHvRpF!hP3uzmϰЍXPPPRM QEP u u Dž1ۃD0PjlǃG(Gt+P`W/BGRRP)GOt#WBW _$CPPRUMA G9QuyUB 8My EBU RMQ1ZjjEP)AU B@ t _M qhjEP-jU RMQ[^_ÐUlWVSuE x(?trUR7hhSG( EPSwgu4U?HEU ;B%U?u[^_ÍvUuuÉU WVS}u tQ>tLVÃuVhW6fs3h%W6s h7W5AhDW5=t!s3jhVW5 ;u1e[^_ÉUS]u`*PjS]ÉUVSu] Uu9~Yv@t9uuRhjV'{ts{ ts jEPs;tCBS{,ts,{(ts(S1e[^ÉU WVSu} {thWVt1e[^_ÉU WVS}xuhW64+XtssVhW4 Fu1e[^_ÍvUWVS]} u~ u(vS u wj@vFEWEE@jjv$v PPSFm twjS2u ǃUSLCPCPPRS>1e[^_U WVS]߰Ѝp=t#vV7SuЃujSVl>CHys>uC9u CHys bC9N1e[^ÐUVSu] ~ujC 0V(ejClPCdP1C|tCQPV ujClPCdPVZuCdFLEPVuFL;EvEFL1e[^ÐU WVS]U BtctV btstktBtx0JHSBtx wm0RHu\SgBtxwE0^Hu4S9?Btxw0fHu SCj B pS跭e[^_ÉUVSuF@u! uhkjV"!vF@tyvC=wuU%v1uJC9CtjSVFTjjjVuFTuF@toC=wuU%v1tBC9CtjSVZFTuAjjjVCu FTu"uF thSV 1e[^ÐU WVSU BtPEu7M ywA@MQBXU BPMQ\PhEP.U z_wNtw;w@MQBXvPEPPUR.MATuLjjjQ!uUBTu*CshMQl.?E 9Ye[^_ÐU WVS}U Bxt tA_ t{}jWÃ1ENU Bt0WÃ1EU Bt0W v vE t VSPWgZU B|%%PWu2E%U B}t PjSWu1ve[^_ÍvUVS]uEPSs `t juS:u6}uEE @}$%PjVut\juubevUCBE@Ep EP C @fBUCLBLUCPBPvjS‹EP$P(EC1e[^ÐUS]E {uj@ 0S٨?tEPSt @dEuhGSa+1]ÐU WVSuU ~ujB 0VgBxt}up^ Btr0V褈ǃu`{|sVzs{c?KFjV rVЃ ovjvLVv$1e[^_U0VSEMQMQ9ujj4EPCt FEEEUBE} tRQ} huEPQ}hjMQWhuEuhjEP,gƃtvhjUR}tu=Extp&}tMQv}tuExpv}tjua[j]sN[jsA[ }tuExtpzulua j/Epth@MQ8 UhPe`u.Mpth@Q8Uh@jMQhPEpth@MQ8 UhPK hMpth@Q8 UhPjMQ_j9W}tuSuEE Hwy} uu(jEPEPURhMQ- tEEUB\} M9u EUEMvUBHX9OÃt tBhjMQAu utESuYhu5 u j VjjjURMQPhEP0PUu} u URMQ,t?E6jEPEPURhMQ}, tEEUB\jjhSMQD tE}uH} uBjEPURjMQ设 ujEPURMQt E"E8v0UR uM UB`X1ۃj1} uM%PEPVURCu}t؍e[^U WVS]u jjuw,SM u@EPVSu+CTujjjSuCTtF @thjSV1e[^_ÐUU B}PRuÐUju uUu^EujjP avU@uojPjjRb tE뻃jEPEPEP)PVMQIb uEǀUBLEUMAPBjRj'QMhjGVƃujjEPOFtFBVvV 7EPURaEEdEPEPjWMQ EEEEEjEPjuEP螈ƒ t t}%}EPRURi^@;]tG9C uC ZjjTÃujjMQ7{ {EЉF@CU9Vt1uuF|UWVSjjhEPEPo v!uhURMA@|xt Q}Eh螽ƃt1jjHPVhUR hWƃt2jjHPVhUR hƃ>hVhh@S  jjSEPMQ2 ttrtOkhVhh@S]  jjSEPEP u+SURv@PMQMUB@|xt R>|MEt@MQ8<uEjjh@PUR4 r tMjjh@PMQ u\@;Eu D;EtFhEP"@;Eu D;Et"hUR9t vMA@|xt Q${1([^_ÍvUWVSu dPjjjjj6lS HPVEPS-SEP*vjWE PtBpB0pSjjVPe[^_ÐUVSu] C}tPCtr0VRu1hCt0jVe[^US]M {ujA 0S97vQtxujAdPPSvh@jSL]ÐUlWVS] Cxt t*E'vCtEPEP?vC}u*EPEP?uhEPj(vhhEP:ǃhWÃuq60WƷjhSEPVC @jhSEPUurC @uljhSEPUuTC @uNSEP.u:C @u4S t 50.vh EPjEP1350S50hEPjEPe[^_ÐULWVSuE~ujU B 0VU BdRhẺUЋU BlRpEĉUȍ}1EEE];]w }䐃WjjSV u:C;]vMU BTE܍UBjEPRjEPV#: t Ev]+]]ԉ^LFPEPAEe[^_ÉUtJC4Ev4vEPHE4F4 uEG>u}t EP e[^_ÍvUSM4t"A4S4RjQǃ41]ÐUS]M {ujA 0S{GvCLEUCPBjRAdP1A|tAQPjSO,uECLECP1v]ÐUVSuE @|%؃SV蠾uSVKztt1e[^ÐUWVSu} FEGxt trEovGt@E;!uFCMEdt\@V8<u/v\t#j G E vv~u,jV蓣jjPV}}WxUjEPSWV hU;Wxuj G pJGxHE{ts~GtU0蘂Cujj}t' t_GtU0hVXAv tGtU0hV&hV~Vut-jVUЃtjG KjGtU0EPjGdPWV @UVLtFPFPPRV^X1vF @EEPSWVGx~ tvߝvOtQEF @%f=u[rA0VXÃtF p觚F XF `?F H VjF pVЃ0URV'jGt0VwhEPslÃtEPCP*thURjV뱍vE%f=t&f=t ShjVw|jCPjjVػ uEPh@jVCjEPGdPSURV4tGdFL}tFL EGdFLЍh[^_ÉU,WVS]ESUUEEb0MAQ9uYCTjjjSu CTup}u$uPWSUh1uEp,VjSm UUFEEPEPSsDUB @Ruw}tUE}u_EPE PSǃUREPWhjS0}t*1tCt;xtu UvW˗1%hU RjSEPk }ujjSUhЉe[^_UukÐUVS]E Vxxt @t1PEPSˤtt EC1e[^ÉUMU B|% t t t%1 j B pQt PrXQ[ÐUWVSuFEX9uhjVvEEErC xHMUF8H9ErUEh%}tEh'VC pVwEE9t3FTu`jjjVտbFTRFTu-jjjV袿u FTuh%V1e[^_ÐUS]E uhjS(xxtPSduSu1]ÉUVSujj4V@UhГÃujjVb-C CCCC\Pjuhvc`cdCTPhht@j'u hSvCTPC\PCPCPCP` u h"t tLKvhjV{tsĝ{;s謝+vjhh)jhh|) jhhe)$jhat s& s@js% js%js% spth@V8hj/S+u@jhPShSjV jv"V'uFT 1e[^UWVShS@'pDžxxFUlB VjjSlA@Ps$ t.u)hjEPhjURp)¸)ЃPpQlp讛tu&hjURmvh Wvp;p;wMAS-vEP:RwPURv1t uFtPMQI+)PWtjEP {C;p]9vp)SWVމp9pDžxx@PjjPlB@P" t.t%WhjMQQp)ÉptPEP=u#SpRtjMQ tEP SPURX[^_ÐU l{C9s9)dtPRWMQt tDžllFh]ShB VjjShA@P)0u-dPW\R\d>dQWEPt vdRW||jMQ uD|UBLdtdIJP E@PjURU`1}tMAt\;Ptu U\Q譇`H[^_U WVS}u{ ts vFPgC ujjW{ tVu s `sC 1We[^_ÉUWVSE} uX9rPH tMtA9u)t;vAKt49tt+t'GNt :utGA8uNKt ut1}tE0[^_ÍvUVSutpVk{tsC{ts/jjhB3V( s S dž1e[^ÉUUJQA9tt T 9u怡TÐUWVShOvEt@EES=S3UX=Xpjjhyƃu 8tEPPhhh hTjjh à tYU2E }thUR0}tEPjS0}tURhgtS16V_G?EE8 e[^_ÐUMU zxtB prtQ4tjQ1ÐUVSujj4V1t pth@V8 vhPhhS#FjjVЃ 􋆬4PjSu V/à VjF pVЀ؍[^UVSuEXjj4Pbt UtXjRЃt#jE @ 0MQ`vjjEP\ЋU}thMQ t!VEPhUR MQeu t t(vhjEPvj/Upth@ыQ8 UhP u.Mpth@Q8Uh@jMQhPEpth@MQ8 UhPQ hMpth@Q8 UhPjMQjjjURPMQe[^UWVSu ]vw 8i jEPVtЋE}t C; t; tEPSEPƉЍX}} PEP`PvPV؃vPhjUR } 1}tUBt;ptuUVEE}C; t; tEPSEP(ƉЍXEPvPV؃vPh=jUR0}tA1}tUBt;ptu U!VhjEP1e[^_ÉUM1Ҹ\9u@#vBvQhRj(h`=`ÐUju uUju uULWVS}ujU B 0W[t@W8<u" uhjWTjE lPE dPjW%w uM AtEE/t@W8U ]EE8>t̀8 E  O$ȉ,,DB$LH8u@B$B;8r 8HB,B;8r 8IJ,FL0FPjV7 jjhHVPV&jjEPVf  Er EPV菙vj$P,PE PVg d$P,PVYBhjt<~tvvPtH@V8<iHZPtH@V8<u HutlPtH@V8<u MHtD7PtH@V8<u Hu AGMuErvU1ۅt^t Ut-EE;MvTQEPjVt E;;Kxv"QCxPstVu CtCtECxEUU :EE]<[z<*p<.hv<\t<~|v}MG<t6<~t8,v $$BfCBCPtH@V8<uHtx~vPtH@V8<H\PtH@V8<u ,Ht#S]=v~4vPtH@V8<u Hu\CCGM@EU )ËU1e[^_ÍvUWVSUEM91ۅtZt Ut0EE?;EvXPEPjR5t#E??;Cxv#PCxPstRu CtCtECxEUU ut&|;/t|;?uOt|;$u OE Et ;/t;?uCO;^u^CFOt?;\u{/t{?uCOvPh,@t\FCFOuÃ}t$FEM )ƋU21e[^_UWVSM1ҋE E]]tE8 uBEMuE]E +B@ҍ\Z]1ۅtYt Ut2EEU;UvZREPjQt%EAvE;Cxv#PCxPstQzu CtStUCxEUM M]^G3󥤋]EEtPU: u߾3󥤃*vUPhM?t\CMCEMu߾3󥤃$CUE )ӋM1e[^_ÐU WVS}jh\WE PƃVTà ujjEP*VSWE PSh]jEP_ SUe[^_ÍvU,WVSEEUUM ME]ЉE싃HEvF&t \tBUPtH@ӋS8<uyEHb}MAڃO$lFUPtH@ӋS8<iEHU1F]<u |1]|u | M|)U UgEvUB:RwPR+{}}t$w}t#v}tj}tkvEӁvRC a4%ӁvR7fa4VEӁvREC a4%t6ӁvRVa4 vVvE@;Evc=sE}uMQQEPURSEujjMQz}FEEEUEEE]FEvFEvFEvFEvFErvFˀwӋMAS"UB:RwPR!y1t M;uuPPvUP]RMujjQ@EuǀMM E}}t$w}t#v}tj}tkvEӁvR@ a4%ӁvR5fa4VEӁvRu@ a4%t6ӁvR膧a4 vKSvE@;Evc=sE}uUR.OMQEPPEujjUR誢}vMMMEEEmMU E]MU 1e[^_ÐUWVSudPjjjjj:lS]* } HPE PEPS*SV?u1H[^_UE PuÉU,WVSuU Bx{tsNU Bt04CujjVZt@V8 vtJCEǰH9v/E&{uhjV+Qvt@V8<u 4t+U %PsVlEu (sVE EE9uxj jEǃxEx j,jEUBUzE9x uP vUBUPUEPP~ FLEVPUEt}E uEU B|%%t'PEpVvPUrVh9u%EX9[uC vUPEUUZ9[uS vUPEpUBp$Bp V }t)EPF BEPFLB EPFPB!vUBxBUP UBUP1>}tEPK}tURKEPV e[^_U WVS}9ujjW yC0C9uh jWVE @|%%PVWt +sCtVSWLwsv$v W 1e[^_ÍvU WVS}9ujjWo xCpC9uh`jWcUE @|%%PVWDt +sCtVSWvsv$v W 1e[^_ÍvUVS]u ~uvSPFtNF;C u1GjuSiu+j jvSQu1e[^UVS]u ~uvS0PFtwEPSs"u`juS]RtjEpuZ+F;C t4ujPu2QtJjuUu+jUCBE@UFB EP C @fBFpjSC‹EP$P(EEEC1e[^ÍvUWVSE96ujjP%MvU Bxt t 6u U BtEj EPEPU‹E8uD9t J9u URhjEP谚]}Ѝx9tQ;t>C@@Ej/uuEv@WPURt ]9u9uhEPjURY4;u 1*OJvU B|%%PEPURVe[^_ÉUM9t%E @|%%PBpQjjQU WVSuU XC;F uC FLCFPTjuVfu-SC BSCBF Hj jsV]Nt 5vSVHu;] u98u PV,1e[^_ÉUWVSEE9ujjURMy8"wh#jQ苘EE0<v^!;^uURh:MQ h?EP迥{u SU C@E}ҍJvMDPjjhCEPURjjhPMQW 9^uhYEP>;^uY~tSMQ8BvE~ЍHB9vvQ`9^u[PhfUR hmMQ̤F9E6UBTu+jjjRnuMATu ;u1e[^_ÍvUWVSEEE U29EPVE P$^mvEPSU R9^u UEBEUUE@ BUB9BuEB EP EEUP F9uE8UGB9?u E WEEG6;u7EXt?EPSU RouTEUG BW EEG u‹Ext-p&)GujjU R脕1e[^_ÉU WVSjAÃt,ߋu E p(CtE1jjue[^_U WVS} tw!V>AÃujjuΔ1vVWSUFCCC CtCCE1e[^_ÉU WVSu ,~t~-~ tF$|8W@ÃujjuA0WVSE~tC(C~ t FC@C E1e[^_ÉUSE] ;t CBCB SsASA1]U WVSE] KC9t?ƍv91uAC AB9quCQQ@K9uƃ;t(9;u CG CB9{uSSx@1e[^_ÉUUE Mtr t!/vhhjRܒhQjR CvÉUWVSEESUREXuu u>t1vR/ a4%+}j>ÃujjURvGP\>CujjEP{uS0?KWURs\CCCUB CB Z FE>tF1e[^_ÉUVSuPV9uvPVFCu{t s>1e[^ÉUWVSu} U=wuU%1t.W1EuV u EPjfE]ChjRWSSV tHj(Wt)hjRWSSV tEPjV<1u džUVLFPFPPRV1e[^_U WVS} u];vvR-va4%@uC;ù;wC;jvR,va4%@tC;ù;+; vRp,va4%@uC;ù;C;vR$,va4%@tC;ù;E;vR+va4%@uC;ù;tO?t;t*E8tS虐~ 1e[^_ÉUWVS} Ӎ{C Pjƃ FFF FF~SU RPq?E P}tPhhS藌0hS[YװЀ| uװDR u鍅PPPPҋЍD,PjÃC(CP<HCC@C P`<VF C 9Vu^F ^ RhPu Pw\F9Fu,hU RjuMV`9H뺋FF1[^_ÍvU WVSEE} ӍsC PjYǃGGG GGwSU RP=1EXt/U RWSEPtKvcuҍG9GujhU RjEPZtCUZt9Ct,Cu&‹C h.sjEPKuȃW#8 GG1e[^_ÉUWVSjjE pE}oU B EPMQ|u'jjEPjjuj<t u&U B MQeAFvtEЉEPtRMQxEPxRMQCx xEU9s8 tvEM9MsE8 uE9EeE8 Y]CxUx12vtt #|p߰HEFh1EPÃuu(}t"tuЍXEPURMQŘEEPE pUR謘à Suh4jMQ蘈 }t11҃}tEPtE;Btu Uu5}1}tUBt;Xtu UuS5cv|QEP)VEPEPpRM QEP# EED0Pj{ǃG(G}tuuP;9WE/EEUBGRpRP9EEGG@G _$SRVP8UMA G 9Quy UB 8My euЋtPZthPjURMQ1>thWjEPˆ1X[^_ÉUlWVS]E;/uVStqj/U rǃtXSE ph]hS;/ VSku!U BUǰHU[^_ÍvU WVS} u)89sGC< u>vVSEPuމ)89sC< u9ue[^_ÍvU WVS}] u9s5VSW5utv9s C< u9r1e[^_ÍvUSEU ]: t: }B;@B8t9s : t: uӀ8u19s: t: tv[UlWVS}EE 9t*9u{ wU RJ1 C@vj jjEP0ÃU S9RuZU XE UBL@CRUTt*dSCXcXct%@SjjEpLP蚔 kWURSEPlEjjEPUR#[4EH w$EEPEPD`C@;C vPC PsUR:CEe$ER t{tSC|\3tSSB9SuJC|.u@E 9u CU CBE 9CuU SS/+vj jjEP.ƃSBVt^}u3VučEPjEP u/ VsSjURݒ EWEPVURE U BC9u U BE XC;CEC;CE1;ss9CvRva4%tF;sr;su;CCUC@ `chXcj Q-8{.}t}tpvC@9CEECvPEPjUR'Essu#2CEEEC@9CEjEPU|CC1C;CdSEP_ O0vjURU|WEPSUR} @t>UvR a4%t} t }KSE CEve[^_ÍvU WVS]} u@tuh Vt?t@S8<uvtwh#twwh*hXce[^_ÐU WVSEt@MQ8 EUt@ыQ8< E11ɋU ;rs)BEU< u1)FAE ;HrN1)119w1)G1)9v)ˍD;U ;B v%PЃ PrMQuMU B;M AAtM QA AOutE P@ U BKu1e[^_UVSuFLEUFPBjRj'V{uQ^{X| KXC4C4t$rFuIEPV(kuC4/vEPVgt"C4 v'-vEFLEFP1e[^ÐUS]hS蔊hS膊 h@SuhSg hSV1]ÍvU,WVSU BxdBtEvRN a4%tBEUvR ƒva4M E=tAE0=Ht;t"U2;Ju;t }t\C uV}t4MvRƒ a4ME0phUR覈IsshMQ茈 t8 u 8 sshEPKu kC tbE[vR~va4EEE]PUpMt vFAuu3sVj h UR觇 ;tDMATu5jjjQqQ>UBT+ #*v1e[^_ÉUVSuU Bx3Btxtj B pVBBt~a[t]uBt@9uH~u3 t@V8<uvt9 xuFTu2jjjVrO{FTk '(v1e[^ÐUWVSuU] 1!E <@<~ V`MNdEFlFpFh}tN}Fx^tt[^_ÐUWVSUM u}ZxBt 1yBxJxBt[^_ÍvU WVSu EE{,U;S0r)@;C0vPC0Ps,EPt^C,}{,NyVIu)F u葬8u&臬f 돍vt u}u vEU1 GEYe[^_UM} uMA0@9A,tDy(t>Q(zt5A,A0Bzt 8u+A(HPh jQu1UVS]sjSЃt sjjS\ t@S8 vC4`tX@S8XC81e[^UUE M $ Ph jh PjRRyrPh RPh@ Ju h uI{>uCM;t7vvR va4%tC;űU zxt;uEPj߰HPSU RVU Bx~ tvvE HtQ:F @%f=u[rA0VNÃtF poF XF `?F H VjF pVЃ$WV<jSV|URWE lPE dPV|.e[^_UWVS}EMURU0 M}tE UEEEK};uvMAQ9upUBTjjjRfDuUBT}$u1}uPEPURUhEEPEPjVEPK Wuju;EE OxوvWj  uEFE;uWuQEPGP$u"E%f=uGP莭uW@u13vUB@XuhZu jRoW@}$ujjEPUhЃ}tUE UE؍h[^_ÐUMU yujB 0Q"vjBlPBdP1B|tBQPQÐUWVS}u ujF 0W'F|t^X(ltd@W8 vdKEEFdEF|%%@t~t' tRM==B1E9Ev U)‰@FdFdFd!v9]v E)@FdFdEEK9]v E)؉Fd Fd]^lGLEUGPBjRj'WgEK9]v U)ډVd FdEHFlVWqhWOwUUVdVlVWp chW wE@FdEHFl%vtEEEFdEHFl}t&EPWMFl;EvEFlVWHp}tUWL1e[^_ÐUh`juhÐUhjuphÐUVSu] EPC PCP3VF t }thCjV&h@v{ ts sltCCCCSC1e[^US] Ct$vC PEPj3uF t CwvEC{ ts PtCCHCCCC0C H9Cu CCCSC vKv1]ÐUVSu] {ujSvLRIISVu{u/SvRva4%u1e[^ÐUVSu] SV~t@{t{t܃{u,SvRI a4%u1e[^ÐUS] {C$T;t~C PCPj 3uD tv{ ts stCCXCC HCSC?v{u;u C(CvKCSC vwv1]ÐUVSu] SV t@{t{t܃{u,SvR a4%u1e[^ÐU,WVSE@E @1tPU}@t}*u(Mf|jjQEEUUvRm a4%t.UvR a4vUMA@vt 8SuuIj}wE@MQBXEPEP5PURRMEs C9tNCu9>tjjhjUR7 ujvvjMQ7 uv9uE @1t-phj]SbjPSjUR7\1e[^_UUM AwN$R8QR,QR* QR&QRvÉUVS]U BwZ$vSVRS:RS*RS6RS 'vЍe[^ÍvUVSu] SVDt1K@{,t C,@ u C t}u|}uVWdEHC8EC1tSM9Mv E9u9MtJuE)HC@CuGEtEPV4u!U RV0u }u1v Ve[^_ÍvUVS]u jEPjsLS4tCLCPCP;Er}tEH1CPCLFDCPFHf0N0 1e[^ÍvUVSu^{uVu5EPVSu juV1 tu?oUC@BE@UC@ B EP F @fBELPua9ExLu@LvEEF1e[^ÉUS]EPEPjsLST3 t{LujjS@}t*jjuujSHu!CC1hB*jSS]ÉU WVS]} CxuSguSCPC;Bu1FsC@@CEPSL8uwwujS4sse[^_U WVSu^jVǃtDCPVSu/jjWsSuC@`X1sIe[^_UWVSE x#u@+U z+t&z-t jB(pMQlE @1t#x}jURՐM IMEEPEPEPE p4UR0 t }h됋M I8|;MQvE|vR. a4%@t||;Er|;UM ;Q8tEPPjP9u+|E|<0|Xt |xDžx|E=wuU%1u EPh*9E||Xu*pN*p;vE|<0u]vXDžxG=wuU%1E<8t}<9tw*pvt`E|<+t<-uKDžx |G *pE=wuU%1tLiDžx |*pE=wuU%1"h*jUROx xtvxE=wuU%1tE<8t <9E<Džx *psvE=wuU%B1>E=wuU%1u&EPh*u vG;}+|1ۃ}tEXt Ut?DžtEE2;EvcPEPjUR;t@E2;CxvPCxPstMQ uCtCttCxEU;}u/V|EPtRitt |Ex j jPEP蔹UE x-uڃ}~~+E9}}}+E9Uup;*u *pupPjdEPLƃxRjPEP艸M y+uE;Es EEU9Us M)MxuuVpPjdEPKƃ |RutQVEPt|S +|lE)PEPS|E+|+l‰UutRM q4EPt/à PURNtt51}tMAtt;Ptu UtQ ؍X[^_UUE tr9tt-vh+jRlKh +jRXKÐU WVS}hjƃtRE džudžHt^HCDujjWJvHDD*HH|t:|HP|E P芵|u'1e[^_ÉUVSu0t0PDtD6|t|tSdž1e[^ÐUSME ]2t? &t zItcqXtP@Q8PPS-St@Q8 vPQE0Q1]ÐUVS]u EPjjv4S' u}t EHv1CPSt+@u S/VSe[^UWVSu} jWVadžW4VLEPEPEPRV&0t}uMEv}tFP@9EtFPFPSG1tGPjjuujWVP9e[^_UVS]u CPCPPv4StASt+@u S.VSe[^ÐUWVS}u jVW9LJV4WLEPEPEPRWy%0t}u7E}uSF1tFPjjuujVW>8e[^_ÉUju uUju uUWVS]u j VSqǃ{Lu4EPS*}uEE1E+CPSt+@u S -}u:jusLS(u_EPEPjsLS$ uBSLBJjusLjS& u EPEPjCLsLS]$ t ,vSLJWF1tFPRjuujVS6e[^_ÍvU,WVS}u f0N0 V4;VKss4V‰S@{,tMC,@ tD;S8u?Vjt{,t"C,@ t{8uVkOvC@C8;C@s{,t)C,@ t K@C4S8v{,t C,@ tK8C)t? (t(‰ E<h M A4EUEPEPpE9uG E;EuOtHEPURփ}tʃ}t}uօth,jMQk7EU BF,@ t5~8u,uF4PEPbN4N0vN8~4sEPEPjWUR QF1t^ۃ}tuuat EKE~8tGEPEPjOWEPh }t}}tuuatKEE8 u K뎉E8.u}zU|:bMv:Auz u}tB:AuKtO:u1}&uu` KtEv~M9t6U:Bu"y u}t UA:Bu Ku~<5v9ũEPEPjOWUR uF<F@~8uf0N0@N4N0N8FEPEP6uK G4;EdG8;EX}ujtKEPEPruÃ}UvRLva4%o}u.KEPEPw\K[vETwL$1Bt<5u 1u1)u KuEPEPtVEPEP苮}G4;EuG8;EujEPpDvEGvE PURWMQ跹Ãs9vu^XC8}GLCGPC}tNE* tUJ)@C(E+BHC }+{{ E) tEpSUR*&E(t1} t+SjjM Q}W CC!vE(tC$CC vCC$E*@tKSE CCC$E(t$SC CC jsEPDžDžE+@Ut@ыQ8v}tEP8+FMt|@Q8 }| vDžDžHDžDž(0TtE*%(DžE+tDž(e*Dž Dž$E+t ƅ;ƅ;DžDž DžLE*t Dž@ Dž@CUBLCBPjRtM A1 }䉽4@j4PUR'LMu~DžLE,\;A4s Q4)‰EԋMA4E܋,LJ\LJXLJTEPQJjEP蜄 4BH wR$h3vMEP}WjjEP|9D 4RMQi) u?E+u94 u-,DDž(e*M+7v 711E)ttUTtL@׋W8<uOELtCUTtL@׋W8 UL4G 9uE*tvEt@}W8<uPEtCUt@׋W8 U4G 9uutC;C$u C8uLPSEP4BtL~DjMQdth2j}WDžDžE*B),;Hv/PHPDMQGqL,D+Nj,D4E+t*+,D4tDž4x 44B  t up@E*t@ u&4AwDž KC(2 uDž 4 Dž ~J4B =wvU$%1u"Dž SMQ%4GH $3E)tbE*t jsEP%Utjjh 3jR C;C$C8(u{E+uu0TtfHPDPE(%P4 PS}W( Dt$E*aD)Jv(t Dž(@tE*t@PSURE(t { tKK CC4CC0CjsMQəVC,{({ E+CsvRHva4%t FC,uƃvRva4%FC,OCsE t@MQ8<uBEt6t2vRtva4%tFOuDž9B PRVEPƃUxMA|F9QxuqxUB|0Mq|~ ~(C@FE($uTVuEPjQM 1҃}tMQtE;Btu U1vu蹯VsSj}W .Dž$FFtuxu ptFxp ;F vPF PvEPk FxtpPXFFP<xtpFtFxF(pF Dž~(uB~ u u}tEE1)EEEFs}}u 9]11;]w 1)G1);EvU)ʉUM +A9tO)ӃQ)‰PV)P*M )Y)Yqr  Fsmr  FmsEe[^_ÐU WVS}U Euu;uFvEPEPjRW tv@E]}t5vRva4%tCMu+]tRF;F vPF PvW{XtF~tvFPP(^Suv(^1e[^_ÍvU WVS} uM^9uAuh4jEP"xS4S{(u{ uC C C !9>u FG FB9~uVV輚jC@PEP u1e[^_ÉUWVSEt@MQ8< EUt@ыQ8 EE11U ;ZseM A< u 1)BU B<w@MQ]BvU BPMQѾCE ;Xru}t1uE)EME1u)UE}tU B$B9BuEM A;A$v*QE H@(U B;B$vR| t| t11M ;YshvU B< u 1)BM A<w@MQ]BvU BPMQݽCE ;Xr;urE16vE1)E1);EvU)ډӃ}t E؋M AE }tuvjVU RMQ MuE tujVE PUR Ku1e[^_U WVSDž EU zuDžJuvDž] sN{vRڇ a4%uU ;rt;r$tN벉M Q)֋A@;A v"Pȃ PR]S.T3} GE p21*jjjjjjS-r S]S@PWPEPt9]E tt) }GWd]װH9[֋@ NEP0'uE%f=@u  UBRdMPS}WhE@E9Xs @1;s?:u$]F;s:t{EtKt*Ct!u؃tU )BB(M y(t.CE H(@x(uԃM Q)֋A;A v"Pȃ PR}WPU BM qyyy tq PP*!rCs惽EPE0$E%f=@M y(ulQ)֋A@;A v&Pȃ PR]SOu_} GE px tp R@P^ M A v] K(} G/Dž 1[^_ÍvUv?w@MQ]BvPEPȶG?u;uvuKEE%<4@EEUtEEEM;A8EPUMPEP=Nj] vK~!Wh+4URMTtڃ}t,1}tUBt;xtu U W;MTlYvEP8J1uE9E vE 1uEtE EE]1;uEPMUPMQRǃWh/4EPE }t.1}tUBt;xtu UWgMT];] s3h24E+EPh34EPZUTugF;uIh74MQETu=E܋U9U h74MQiETuUR MT}t E1e[^_U WVS} UB5WE< uEPEPwRMQq GWE<w@MQ]BvGUPEP蹳E9]EG;G v&PG PwURrKu GM)ى˃ t w GUBREDP__(Ewƀ> u؉Erbv FsTWE<w@MQBXGUPEP ]r BFsWE$jwURve[^_ÉUVSuE XvKSVuu^LuFLFP@e[^ÍvU WVS] SC MSJC1v;StC;S$t>HJG8upt/jjVc8uvSCM `SCM S)S){CL{(ts(CCRP{ ts CCC(RP1e[^_UWVS}u Et~(EN(~(2FEE8 u4VE EPEPvvWnVE 8U:w@W]Bv]PWİEEbN(VE< uEPEPvRWm AvVE<w@W]BFUPWLEE;Es E)EEF;F vPF PvWG"FE])ÃF F(PVE@PUDP`^^(VE< uTre BsXVE<w@WBXFUPW蠯MEVBr ABsE}t ~(}t0F+EFt%F F(EPVEEPUR}tdF@;F v"PF PvWFu RvFF~ t0~ uNVD vF F(PFFP@P$NV] F1e[^_ÐUWVS]} u{4u E #~wG4W8GDWH VF|\u|\FVDP|tt@S8 vtPqt~t VF|\t G4W8GDWHVN:D u$t| \tG4W8GDWHM!WFE􋃜SMtG4W8EU@vGDWHEUHV:/uPjFHPBPGDPEPSF"PjFHPF@PGDPEPSR% u7GDCLGHCPE CujSJUt xM Su㋃FM;t(jjS1uCjS1e[^_U WVS}E EtEPSWEsssW^uz}tjsW3ou_sdvEtEPSW vEssVjWӺ u}tjsWnt FGx9u1e[^_ÐU}t}uրw EGSW蒪Ph@4jWa1E9uF뙐E;EuNuE;EruE;Er͋EGLEGPjWRu j@\tT@W8TPjW@e[^_U WVS] sN{EvRtva4%u";st;s$uENOE뱐OUJEB$EK )J C(B(E)CUtEC(S D)CC vEC(C )CC C(vRtva4%tKK;st ;s$tON뾉M1e[^_ÐU WVS]}{(E 1Mx9us vB,BƋ9u9sU);{(v{(jEPjU pEP4 u(CCUWRP談C())CC({ e[^_ÐUh`4juÐUWVSE X4p8@1trxm}uOM AHV7;ErEP))NjE PHT71BM AHRVuuSMQ t WtC1tBEPEPjSEP6 oujjMQ vKE XD1e[^_ÍvUWVS}u ^4EPEPjSWг u<}t?F0u ;^t'EDU;Sxv'RCxPstEP=u eCtStUCxEUEPuUR?E1uuEUDE9ӁvRp a4%t&ӁvRba4RӁvRXpva4%t.ӁvRda4F;uFt"EPURu EP.tE1}tUBtU;Ptu U EPEe[^_ÐUUE @HBHXB@4RϾÐUSM] A,AxX|HX@4C1 ux4uP4@4tu"CDPQivCDPQ v]ÐUVS]u tEPSau&;ErjjSFh@5jSte[^ÐUVSu] t#EPjj3VO u(EH9CujjVh5jVe[^ÐUh5juÉUUE t8uh5jRh6jRÉUh@6juÉUVSu] Kt:vRmva4%u1 FsƸe[^ÉUUM Ewr$87h`6Fh6j:h6j.h6j"Qh6uQ h7jRQh*7jRUju uUju uU,WVSu F1t~F4EF8EEPEPfP}t7}UvRJl a4%t[~,t9F,@ t0}t*u%==~,9~,0,EPEPKhO}tOt]vSEPf}L}u.UvRk a4%tu*~,t$F,@ t=t =0SxSEPg}OO1ۃ}u4UvRj a4%u}_tvEPEPe}M}UvR|jva4%uzu>UvRIj a4%n}_u@cvUvR j a4%u }_(u<~,t6F,@ t-=t=0uyEPEPetbv}u,UvRi a4%tEPEPeu@}t OJ~,t F,@ u'E;F4uE;F8uF4PEP7JEFjuVXjjCDPVsjsD~jvDuF1tMFf1E܃8uPVW E܃~u3 t@W8<uvtEܐ9U܉V(:.tD} uPwÍ@WBXPW?P$} <;G,uF(N1 M A1 uh: F1tE H1FU BF1t FM Au 몋E܋@EF1t }u]Uu F1Mt=jEPjW s} 0Et EEFN1>[t>]t >ZjEPjW #} Et U]8tb}uM܋AGE8~u0 t@W8<u t9UjP|>zjEPjW ~} ;Et MEFF=wuU%1tZFPFPWN1jEPjW } Et EEF}tFU8t?M@u4wÍ@WBXPW菄Ph :Eةt1jEPjWuu} t6Et UEFMA*Wu>}t1r}t'hK:jWGWd1e[^_ÍvUlWVS]C0% u2}uEPSEPjEP tz}u M eEtEEEC1tCEMc1K1:Eu~K0 UBLC4C8UMQLJS0E1e[^_ÍvUS] EDt# CtdStYt&VE$c"vE$dvE_c vE_yj jEPju~uv1]ÐU,WVS}E E1ۍu䐍EDP9vMj VjWu2E=wuU%1ujh ;jW诩Ej VjWCuE=wuU%1fE1e[^_ÍvU WVSu]1vE PjSV襀uS1CH w_$(;{u ˍvMFVdи6SV#t} t vSV肅1e[^_UWVSEu\ UtHU +ЉЉ؉MA@;A4r]C4H9 E xЉH}ur MIl|PxP]SpЃjU +ЍЉЉPSlЃ tPpPj] 3EP舆LUR8d Mt @Q8<u] t1E @TU zOdωT]8t0@S8 E0@Dž<U@<t@ӋS8<u`EtSdLtU :u;Tu2M 1h;h]SGPS]SlXЃ Lu t}tKM ];CLu>+ȍЉЉUC8+dMH U BB BBTLt:t DžP~<DžP$PwP@MQ]BPSEP1wPPwP@MQBXvPSEPwPURlXЃ]SllЃ|xSl Tu'Dž\] C Dž`CHtsE @ \M Q`p]t @S8<u! E ud9T,MI8d]U ;M yA;A:AtY\A`RB\Dž`\U J `ZpEt @MQ8<u#v] ud9TTUR8dCDžXDž\Dž`Mt @Q8<u|] l\;tpPp u~@uuMt@Q8 ]Et'4@Uz8X14Ӊ)ZX]1)APwP@MQ]4BvPSEPsXT9Xs\\;t][8dT9X\U J X+T)Ɖ``Zp\;t#pPp @uyEt@MQ8 ]Et'4@UZ84X14X]1)APwP@MQ]4BvPSEPqrXd9Xr)XMI8dOt\\;tXt.\E P X)Ή``Xpv\\E P @}t#M ];CLu\9CPr d;CPsDžhHUJP+\hh}]8DžDDžX\;tspPp @Mt@Q8 ]Et'4@UZ84X14X]1)+`XNPwP@MQ]4BvPSEPep+`X1ɋd9XrouX))ƉE XXX5] SX+d)ƉCd9Xv DžD\] Ct\hh]u DU] +؍ЉЉU]tX)EXH]Ut@ӋS8<u*vEtUuTu]H-HtK]v;8r#)PSEPlXЉ߃ Gsv>;8r&])PSMQlXЉ߃Pw"P@MQBX`"vPSEPAn`r BGs\Dž`\;td9XPw$P@MQ]B] CvPPURmM A] CCtHC<t_XUB5>;8r#])PSRlXЉ߃]S0r BGsd9XsURllЃU9v!)PR]SlXЃ|xMQl1[^_ÐU,WVSuFE?@PV~EEPEPVU苂pЋ ;}t @V8<u  t{ v{;t}u3V~tzj+ЍЉЉPVU苂3h;j Wc PWVU苂XЃ;'uuVU苂1e[^_UWVSuE{~ w tOW?`\*`ǃdjtPpPlPVpЃ EPu VPEjF@;F4rF4HPVЃ uEPVXЃhPEPVpЃ VlЃhF@;F4rF4HPVЃ Tv`D`\u3`u*jF@;F4rF4HPVЃVlЃ pl\`jEPtM))ʉ)ЍxM)щЃ=GEUtxdu ǃdhF@;F4rF4HPVЃjd;PdVXЃ hF@;F4rF4HPVЃjVЍe[^_ÐUS]SjC@;C4rC4HPSЃCjSЋ]ÉUWVSuFEt1Eu;PE u;Ph;V舣Vs EPEPVUpЃjF@;F4rF4HPVU􋂐Ѓ VUlЃ} t@} ЍXًF89vÉكQU RVUXЃv1ۃ}t?}ЍH~8G9vC)QURVUXЃuuVU􋂐ЃjVU􋂘Ѝe[^_ÍvU,WVS]}E@EUUEu UTt2EtUTPdЃ ETUu3tBjR EPH9} ujjURU\ЃSWh; } ujjEPU\ЃhXc+EUBjREuWSU RP vEPEPEPUpЃ} uWSjEP`$|; uOUz4uEPjR\ vEEEP8JUE샸Xt]UXE;Evjh;PEP/jh;UPEPjh;jUR U E쉐PޅhvR/va4%tFOu΅.E싐X:;EE)Ѝ09v4vR@/va4%uK9w9uEU+X<]SvR. a4%tKύv7EËE))u)~|.uK)PVU REPtjh;jURrUBTu,jjjRhuUBTu uuuEPUЃjEPUЍe[^_UWVSE@xUtMh}EPj URDh+Mpu EpvtXpЋM;A8v A8)ЉptXNMy4\uljA@;A4sH UB4PMQxЃMQxlЃ MQt\Tt\M;A@ut\Tt\tjjURyjMA@;A4rUB4HPMQxЋt\TUBTjjjRfuLMAT7tXUB@;B4rMA4HPEPxЃ} ujjMQx\Ѓ}M`EdpJl\d u wÍ@MQ]4BSEP'`ƍ>;`r1+\P\RMQxXЋ\wÍ@MQBXSEP_ƒr BGsdl2U9v!)PRURxXЃ} ujjEPx\ЃMQxlЋtǁXpE)EhSEMHhu(tXP|PURxpЍH[^_U,WVS]} CEXt*jh;PSdžXdžPt$CjSЃt,ju\wHugCTu[jjjShcu CTu<%t PWS PWS?tC9t@t jjSU\Ё\vWE\;C4s S4)‰EC4Edž\džXdžTEPSdž\džXdžT1e[^_Ut! @V8<v E UVLM;sFP;EEPEPEPRVZ[ t}=vFPU;E؋+~PG;E91ۃrGEMM؃ wEč@V]BEPV/NÃsK}wEč@V]uDjVWjS=1s8tAuuȍe[^_UEPE PjuSO }t} u}t E1v8t0@S8E 0Ut @S8E v Mu uE1t@S8<u tE}M}UEE uo}uit@S8E Mt"@Es8u܉M14 1E)/v}wE؍@S]BEPSOAUUEǃ}u;{8r} u1E1s8)U+{8M}vM MMUEE up}ujt@S8E Mt"@Es8u܉M14 1E)/v}wE؍@S]BEPSO@UUEǃ}u;{8r} u1E1s8)U+{8}}t}u C5E}t u+uM1Ee[^_ÉUUM }t"EPjjQRLu$}tEHzTtrTQR v1UMY;s8<}F}t } u1+s8mu؃mMUE us}umt@S8E }t&@EC8E܋E؋M}14 E1E).}wE@S]BEPS=;ur%U+UU;uuEH9vOKvEBvE؃}u)M;K8r!} uE1s8) v{8)}؃mEHe[^_UWVS} ]Eut u$ujURNu uGM;8U;8tr t?nWvMQt]ujjSZV}uECt @S8<uQ v uCxt1S7PCvjSMQ_+wFvjSEPEƃC;]s;uve[^_ÐUWVS]u CE{4wjh>jSIYjjS軾{4}t vj@P‹ujjS8Iu CL@@CD;C@ЉUC8F8E}uVEPSju7U)‰ЍЉЉ@9s uE}toC4)F4CHFH{4F4CHCFE9Cu UrC0sV4C@)Ѝ@PRR|5~4C4)C4CHFH^E9u Ep p3{4tC4HC@~4tF4HF@}tj}tF4)Cu@>PWjVH}UC9uBC E@BUC9Bu C vEPjuVtEKUCB9Ku EC SEECQvC9u FC FBC9FuCVSCF9SusC0s1e[^_ÉUVSu^EPVYt }uh>jVfCC9u FC FBC9FuCVSCF9SusC0s􋆜TǀEF1e[^ÉU WVS}] GEuWCƉ3 tW GLBW GPBG HwG8F8G4F4GHFHFD;F@tEltd@V8dFPvF9C@sjh@?jW?}؉E)s4ECHq4EAHq a4% %ÉUUv R a4%%ÉUUv R a4%%ÉUUv R a4%%ÉUUv R^ a4%%ÉUU1 t uÍvUWUװH90rP5,R_%1}ÐULWVS11ۍv=0W,0, 0Fr $P@ =0uh?N  H=4;=4+=4   ,=0 t=0~-,8)=0~,8\u x)f=}=0~-,8|=0~,8\u x| =0 ,8  v @ 84   4 vp c 4v vD 7 4J v  4 v  4 v  4 v 9| u =8f 4y H u =82 4  E  9 u =8 4     49 u =8 E}̋ ,09ƒЃ w9Uă}|E̍TBЉU EăЉEȋUȉUA9tXBЃ v9tI9,uDA9 ƒЃ w1| DBvBЉA9BЃ v}99}}| ;}@=0u@ Pz,0, 0FЃ wYv@DFУ@=0u@E Pxz,0, 0FЃ vvh*@Gz,=0u@Pz,0, 0FЃ vDЉ5DDDFУD=0u@}Py,0, 0FЃ v=D|*D;@}h*@ny @DuK\th*@Cy=0u@P!y,0, 0}t h*@x84  w49b"SK>84  G 49 <84v 49=<u  <84]STSc @uS$P=}EPj8$EP1vWs a4%u_uEPW8G~WvEPbEP`=0uA@Pv,0, 0^uB=0uA@PPv,0, 0E vE[(E4=4]48= tH t u 1uvWӃt VWG~݋Eԋ4װ,H,װH0)‰У0uA@*P]u,U, 0EԸ4Uԃ<\u?t6=0uA@Pt,0, 0=0uA@Rt,U, 0-=0uA@OPt,8, 0]u ,0\u?t6=0uA@R't,8, 0=0uA@Ps,U, 0E܋EܴfE܉EEڴfE1]EE޴fEރEPEPeEPEPJSV}= vVlva4%t&SvV赾]a4NvV a4%t0SvV)1 a4PFuԃ]5}]SS$P8= vVXva4%]SSV vVva4%t*EPvVV:a4*EPvV/va4PEP24%C4e[^_ÐUS]P;P|6|ȋP҉PP;P}PRp ¡P HP @w$B L@LL;B~B]ÉU=Hv`=HT=HtH=Ht<=Ht0=Ht$=Ht=Ht =Hu5HA=Hu@;Hj`=HthXBoHhÐUVSu@ D=|= ~== }4FP@#FPÃC)ƉPDe[^ÍvU WVS}u 19}!v;@ 4C9|e[^_ÉU WVSZ=H pơx)=D}h k=@uhR;@}UVW2h ) C;@|.vVW h h C;D|TH5H9HHe[^_ÉUvh ~=Ht=H t =H}US]=H u=Ht h vh =H tċ]ÍvUSEU ],(048<=uheBl HCLj'=HthyBlC PUh H { t h2C ]ÉUWVSu} 1;^}T؉ىTC;^|FG[^_ÐUWVSUM 1E;x}.;sGE;x};r];{};u L1Ӊ΋E@;x}!ULtGӉ΋E;x|[^_ÍvUWVSuEEFEU;BM ;A];E Mϋ];v]ߋT~TEgUM ]؋};s^TىT6v^U}TىTEN] }D DEFEU;B}HM] ;KI}E;x}.^U}TىTEFEU;B|ԋM] ;K}-^} }TىTEFEU ;B|[^_ÍvUVSUM u1;^}:;tC;^}-;u;^}!N;^}DT ىTC;^|[^ÐU,WVSE}ЉU}ȉME}] ;{}Kv]D1EE9M|EE};G(_$UM; uf} G;DuZD 9EuPD 9EuF1U<FM ;q} UB$T8D;Du;tًM ;q1EE};G(sUB(‹M;A,|1|A,9}]C,}G,Pw$`G$UB$M}<U BP‹MA$TA$P} WUB$ML B$UT MA$DA$DA$D1;wP]]}<}EEvU ]C <T}t @u vt}t ux}t @u t}t uYuP}t | v t}t u1u(}t | )v t!}t u t }G$MT}_$M| uDU G D 0vM ]C <uC$UDC$DF} ;wE@(Ee[^_ÐUWVSU BP%E1M ;y}EGU ;z|1 EEM A <<<UTEUuMQUTRPEM<tOU}M A w6$B&EU} G0};|}/אUЃMQVSMEE H0U;T|ԿGM;y}We[^_ÉU\WVSE UB4BPE؉EMAPEԉE uFPdE̋FẺEFPFEЉǃ FP/EȋFEȉEFPEE E;F}UċMEċuċE;p|UBPEjMquF0E E;FUB Mċ$BvuEEE1UBEMMu1;_EEURMA0PEPEPJU މMME;|^|&vUM܋UBH މMU;}݃ދM܋PދMA04EދMA0M ЃUB0PMQC;_AuF Uā< 8MA)uFEEEGu1;_UUMQUB0PEPMAHEމUUM;|^|&vEU܋ ɉ UBH މMU;}݃ދM܋PދMA04EދMA0M ЃUB0PMQC;_Au~t UBB MAEEu~t GG:vGuƋ_KxvMًTމTKyGEGG1u~t;~%-MAAEGG1u~u~tUBEyMA UEuā<%EEEEU2M1BAEj1‹MA0EċuċE;pqEUċM;Q]uF }ā<~<t <~nSUB0MčPuVSqN0U }ċD;B}BP4‹F0UB0MčPSEċuċ};w\EEEċU;B}-]S}ċu<7WVwEċ}ċE;x|փUREP1E;u}3M]v}ċD%T09tEċE;C|֋UB,B(jMA$jVEPQ uVE}W9 EP*UR MQuV ue[^_ÐU(WVSDž=DžddvdPia4d%u d_uhdQdd~h$PPGDžd] S$ӋEEd;t\vU Dd ؋\u F <w\W4Z8M A <\SPhu V$}| t|# u\P$P] S$u| t@u:u2Dž(( ! ((v勍] S$u| tu<u4Dž((!((v㋍E P$]| t u<vu2Dž((C~EUz8u R11] EH@UE4CtP胲e[^_ÐUujQÍvU WVSu Ѝx];tWVS (u C;u1e[^_UEt PvUVSut%1ۃ>t4QC<ue[^ÐU WVS]E P$E uSEU 1;t vE P4uvG<u1v<t,4U RuF4葮O9uPS Åt"E DU RT1e[^_ÉU WVS]t} tj$ƃu1~;tq1PE 5{tC:AuB<t: t9v׃PAPsutWSVoƃtC;ue[^_ÉU WVS]t} u1:1FE <t(װHPRS ÃuΉ؍e[^_U WVS}t} tjƃu1VEE8tpv1U :tTE 4UE4uÃtSVƃS' S菬tGU <uEEU<ue[^_ÐUSUZJB 2]ÐUU؋B 8t"Mqr]؉CUԋB 8u M؋A]sEpU؉BB 8tC 8tPr M؉A m]؋C f|utq~VzFVkN VFN VF@BAjv 6d tEEU;B}tMj bËU}PAC URP貨MATCYTuE]E;XY]44` tQtE t 6EUM;Q~V訥e[^_UUM :t9u B:u1ÉU,WVS\E`U=}99E+EU+U9~@U19}.E+EU)‰UM}UF;u|U)U6}+}}19} MEU<<F;u|EEU9U~ }9h+`\`[^_ÐUS]`\PhC(X;-uTC7;+uTC$=XtT vT؋]ÍvUt>=u]E"}u]EE vEE;tJP)PR3Pu؉+P;H9u]UUE}tR}uL=tM 41hChc5PװЍDPBv}UU>Myt F5l$=tTU Dx-uM12h@Chc5*E0U DP2hChc4P߰ҍTPUB #MyE9}U ll=tM t1hChcj4P߰ҍTPUB ?M9:9:/PװЍDP}tMU Ex,UB v}t1M x-t PPEP=tUU x-u5P2hDhct3+5PM P1h DhcG3P@D?.vPPPEPK¡P8ut:uY=t<=XtPU 2hADhc2PM 1h[Dhc2ã?:Wz;EEEEP8uVE9u@=tPU 2hDhc'2ã?M9::U l5l5PF>t>=u]E"}u]M؉M vEE؃;tJP)PR3u؉+P;H9u]U؉UE}tZ}uT=tM 41hDhc+1PװЍDP?}RU܉U؀>tcMytF5l=tE0U 2hEhc0PװЍDP?UzM9 }U l`=tM t1hChc.0PװЍDP?U:: :PװЍDP}tM؋U ExtP@ 1vUB PWz:z:uP8ueldP8uMM9 u7=tPE 0hDhc./ã?U::u:M lPÍe[^_ÐUjjjuu uÐUjuuuu uÍvUjuuuu umÐUS]E t'P~PS5hFhcP.S5hFhc6.]ÍvUu ujUS]SٗtujhGv]ÍvUSE] tSPA vS苗tujhGe]ÍvUU:t< vB:u5l,‹E 1ÐUVSE] HJ9wA;tR3襘 vRt15Hօt H)É1e[^ÍvUWVS]u=Ht88%(G15HUt H)lj=4HuMHE= sE UU15Hхt H)EEE4 8U9r6%(G;4u!A9rh,P0ujhG=dt+hGS`ujhG0D<FPS7't0hG= uF %f=@u1=duF %f=} tLPu]EP)PS(Љƒt9u;}vE8Gt;Uu=pt9sEPWSue[^_ÉUWVSu] xEURSV+ctl= ucMA %f=@uQ=dt5` V蓗t$0SEPS111ۃURju18u =05nvE=hu =lt =hu:@ D)P1}uP5@LtE}t=hu 1ElT@)D9vM8KtK9vE8Cu5D)9s>SRQǃ=t SVt=t =pX1ɉ; }C;@v;;tEA@EvJ;UvE8Bu; };@v;u;t )ӡ@ D))=xt REPSu18u =05{v@=t@D)‰9}tHDMD5D@)Pǃ=t5DE))llЅEtt5hCG#Ve[^_ÐU WVS}u1[GvjWYƃ8tޅuN= uEE PWtf0W^XE PWSF=uك= u7 t u-ĉE PWTuU B %f=@tSW덍v=E PWV0Ã} v=t9=tt:P5h,GTShlGT؍)9u P5h,GxT=dt5`Ҟ.t*Vt8t0W؍e[^_UWVS] EtJB;CutqӃUDPEPlEURP蔉UE/ VEEPuރEPUR!E >ut=uHt}tEP讆UR蟆Eh[^_ÐUS]t25hGhc5hHhcj}5h@HR5hHQ h IQhJQ hKQhMQ h@QQhTQ SvUS]=pt%S5pjtjh@Tp]ÐU WVS}1=tKv4Wu$(Fv<u1e[^_ÍvU WVS]u 1vvRtva4%@tCύv;ugv}tE4G/vRdtva4%@uCF<\u ;t FC;uF_ve[^_U WVS}}P3EjREPU: ËU PƋE U2VEPUR4ue[^_ÉU,WVSE t+j/Ptj/5@8zudEEEx EEh_TjE PEPh`T詄P $ VMTBЉUUv=lh5lijhTZ=lKh5l-jhT=lt/EP5ljhTvEhT?hT3hT'E5l|qlWv5lTu .5lTu 5lTu jhT=lӃU\sVMQE5lEPE u zlƿTthGPRvcu05l*}t E@9vSUR]E}EC9EuSMQ:EF u!VE@)‰PjEEPlct Vt;}ME|  E{viYl5lxlvp|tdx5lEu he5lEu hA5lTu hjhT j~jhh@Eu u>ƒ =}E=}E=pu p=t^hU5ph URIhUEI h U5IhU(I hUIjr=t j}t}u 5pGvM?v;U}%E UװHE jJ5pJuhV6uURMQ$СU)‰Ѓ~ =t}t t;E}WEU h޿T1t 1҅tR!E;E|hjEhXc誣uj0h1G^=uEPՅU WVShHÃhh? jjS"C, ߉ދC S)‰Ѓ }j S.F y9y uI(AA Q!ЉA Q)ЉEq)Љ9U~q A A{0tgC0@C0@C0@ C0@C0@C0@C4C8ǃ<ED S1e[^_ÐUWVSEEP0UMM Mm]]}Љ}EDtMMDE M]]ExEEEtSU:W tCMЍUE<]:_ sE?EEt]:_ uą!uC S)‰Ѓ}jQj{ q9q uI(AA Q!ЉA Q)ЋY)׉9~Y A AtyGuC S)‰Ѓ }j Q C q9q uI(AA Q!ЉA Q)ЉEY)Љ9U~Y A Awu $XGG@GUPG@ G@GJAHG@]_ G MEU<u M8]Ux}E‹Mx u:u]ЉЃ<0uH M@ MsUMЋ x t̃}WE]<u UH u"EM<*]@ UM@ tCV)‰9C~C[uv \G0p t(VF;B~BFF;F~FFv u1ɍA~PG0p'Dt)1ɍ<vA~)v1ɍ<2A~ꋗDt$1ɍw<1A~v1ɍ_<A~1[^_UWVSEx4u E ;}u"UR<PM Q 1vp<<UJM@EM 9EE EEG)E;MvA0A0хt`A0A0A0хt>A0A0A0хtA0A0;MvIA;Eu79ȃUC9)؋U)ڊ:t9tM4U UUA0E)9fEEA0uEA;Eu99(ȃU:uC9)؋U)ڊ:t9~)UE)9~1e[^_ÉU,WVSUEE;P4>M<ME;uw9t>vMƊU<t;urFNU<ue^M>v}tK E܊ K B:H sv@t:H utP:t]Uz;] w}uE)971UUE+EM;A8~ EA8EEE)FU<uu^Mtc;}tK E܊ K B:H sv@t$:H utP:t ;]w]Uz;] w}KuE)9m}tU U EBUBMAE[^_UVSuU E]~,u2Du)PRV…ttSF4C SPRVSe[^US]1PRSXl]ÐUVSuM U]uu^EF JVf(F(t Qv$ 6FЃFÅuЍCFF FCf(f(e[^ÉU WVSuM U}]uu~EF JV^$N(F(t QS 6FЃFÅuЍCFF FCf(f(e[^_ÐUWVSuFEFV )‰U] \d;}F(t Sv$SFЃDžuЉ~EG;FF@~1MIx FDIyE$URv$F Gv1;M}WFA;M|E9FuF(uUBGF(uRF ЍGFEF f(e[^_UEU v@t9s9r%ÐU WVS]} S&rC(t Rs$RC ЃK(t9s9:r΅t{ {CStlve[^_U WVS]} S&rC(t Rs$RC ЃK(t9s9:r΅t{ {CStlve[^_UE1ɋPt)RuÍvUhch5X0:hcj : 5rUWVS] uu|E( uS{gEuEPIUUEx.ux ‹B%=.ttU+U})19 u89v49v9tSURhƒt[+EEUEPEPk @EURxENEURtuEEP\URhg1e[^_ÐUju=UVS=te1۾vSV a4%t&vS=Ka4؈3C~1=tP `ujhcXe[^ÐUWS=424tK;t?d{HPs5`tjP#v[u4tFv;u7{HPs5`kt jP[u5`ct jPe[_ÐU WVSh xP5h { h@E PURWbt jPE=|u =tE 2P+dEtXM=ttuX=|t}yXf}ЍXE؃U RMQPi] =|t}߸Xf=tt XU}߰Ѝ\jhSURjhM QuVe[^_U WVS5pLXu(hxP5h&vhxP5hy h@E PUR`t jP=|u =tE 2PbEtXM=ttXfXA=|t}Xf}ЍXE؃U RMQPPg] =|t}߸Xf=ttXUfXD}߰Ѝ\jhSURjhM QuVLe[^_U,WVSxEUU Uu9v=`EPE)PV5`Yƃ|E)PEPV\"EuEE;uvU8VtvN;uvE8FuUE;d*EPjjRVh[ u EUsEEPjjURVh!ƋE E)PEPV!EuUU;uvE8FtN;uvU8Vu}|%\hE)PjPVh@?à 8ȣ8)߃=tu=|-vE)9=|t5TvRbP a4%uQ|_tJE)90vRP a4%u <0_~- \@hSD;PVh@@ǃ FU)9t7C%\h)PSRVh@}>áȣ8)߃ uFE9ET1EUU9s E@Ue[^_ÉU WVS}'E 48v9s: tM 9vC9s; u)PR5`t jP9sC9r5`t jPe[^_UWVSxEuU 29*ЉEvEPE)PV5`ƃ}=tt-;uv U8V7;EU8=|;]v3SvRM a4%uh{_tb;EshvRMva4%u<_u4EPOWV5`Ë}tfF;u1:]] 7)PEPRBuڋEN;uv~ ue[^_ÐUMU vABuAÐUWVSu} >u uEEUvRL a4%t.UvRAÃa4]UvRgL a4%t.UvR@ a49t E9u}tFEG&>uE)?t +E1e[^_ÉU WVS}u1<811] ;t$3Wt|ԅuԉ];uމe[^_U}%UVSu]u 1ɋU AJ9r9tȃ[^ÉUWVSEEEu7YUPU@E }}t@CE9s2E8uEPSVTu)]1u}}tQ t EH<0 uE}t8}t,EH0E8uEPSVuM}u}u[EE@PUR[ÃuEPVZ1av]EuVP{^UUEUt*1}tEEPUR/6ƃE}}EPURzB]ހ>E8tCF;t~U8u;tr{tl1ҊE8CuUE8CuEŠE8CuEŠE8CtE8CtE8CtUtCCFCF;o}HE} tUE Ee[^_ÐU WVS=<<hhu_j.hPAƃtGVװPRh'QD7 RD1PVyH=uE D0E|:u{XhY3P~`=)E)9wJӀ<3W<3.u8ChY3P~؀<0u )ʋE)9%FE)Pj.Vƃt15hFPwuǡ|0e[^_ÐUWVShutS1<ƅsjSމH j TSDžXDžTPPSjVk u PxuYVj"jjtװHPRPpp D tPhYhcWYjj hYZǃtPWukju]S;ju EP; jVEP:EPV: j,SW_,tEURPW2{W_8[^_Ð$FreeBSD: src/lib/msun/i387/s_ilogb.S,v 1.7.2.1 2000/07/10 09:16:28 obrien Exp $v uЃ @%@UE]EÐUEU щA uNu~AvH҅5v ~&HɅv~ U=u?EEUB jjEPhjRu ÐU WVSEPju 6}#$Hy8t0Pq8YB%u$PB84$@t $$@xLt@L$@4t 4^$BxtAxt;j*Bp;t@P(1҅t $@ fPD$BtFt=j*B;t@Pϧ1҅t $@ fPF$@(t (u4 $Qt"t(Aǀ$@,t ,uh$@tWtNt u<$@t u" $Q,Aǀ$P fzBu$fzt@ttBfBB$P@t"tYuZ)$Bx8tCx8t=j*Bp8:t@PBv1҅t $@ fPH$BtFt=j*B9t@P1҅t $@ fPJ}t=thhEP5Ee[^_ÉU WVS}=$t\5$1F9}J+~F")‰Љ)‹F vYjPWu F CV9|1e[^_ÐU WVS}=$tl$1C9}Z&~C$)‰Љ)C"‹CZjPW-uC f&Efx~+HE]0҉Ƌ]09tEE9M|E}&h@ut$@xu j$CuVEP&xtOV&Utxj $@xtp&@%ƒ R0&@HPjMQ]SuV05 v&@9EL M]u;u$RvE9U( M]u;t &A9E $B4TEEËBxu?lt6Eu+&<t&@u Dt1% &1fx~!]U9u@vA9} Uu9t&1fx~&Eu9u&@vC9} uU94t&9tB9;h@ut$@xu j@jEP&xt$T&UtǀxU09ht R@$@ps&h@ut$@xu j_@VMQ&xtS&UtxU09ht R@$@479]}vEMuE9]|졀&@9E&BMDE졼$@xu@lt7Eu+&<t&@u Dt1E% &pN;u~#]U;uN;u~M];t;u&h@ut$@xu j>EPUR&xtR&Mt]xVSQEPUR)؍u u PRQb%A&xO;}~UE9uO;}~ ]M9t&pN;u~UE9uN;u~ ]M9t;u&+E9{h@ut$@xu j=uVEP&xtP&MtxE]9 BH9tuBH9uQvˡ$@xt ~u0ۃ`&09ht R(=ɡ&tQ.&PJy B;B| t RQj&x$@DtD&B9x|CjUR9\M];u&St |3&h@ut$@xu j<EPUR&xtHO&Mt]x);VSQEPUR tf^&h@ut$@xu j;SMQ&xtN&utxjEP9}SURMQ]SuVvu}UM;ut tNO9~;]|&h@ut$@xu j:EPUR&xtM&MtUxSRQMQEP[ 9\UUM9}MCEܡ&h@ut$@xu j:URMQ&xtGM&EtM܉xM)١$@t9~$@x|t6t-& Uȉ)U97Y$@t&)9 /v?B$MQCP]SuVEP )PUDP9KMء&h@ut$@xu j8EPUR&xtK&MtE؉xMC)$@t 9=$@xTt&)9v?BMQCP]SuVEP tg]C&h@ut$@xu j7SUR&xtK&Mtxj]S-&U09ht Rq7)P&@;E~ +EuU ]PRQe[^_UWVS$@xu xuxt&lt4<u+h9 jjhPNZ$@xu$@xtQ&U09ht R6$@pz&ǀxǀt$Bx&ǀxǀth@u tBxu j6jj&xt7I&ǀtǀxU09ht R5$@py$@x&ǀxǀt1fxj&h@ut$@xu j65jW&xtfH&tǀxU09ht R4$@pyG&@9]&1fxh@ut$@xu j4jW&xtG&tǀxU09ht R54&1fxBH9tuBH9xuEPz]$@xt }~u0ۃ`&09ht R3ɡ&tQ0&PJy B;B| t RQ&x$@DtDuw&P9x|F&B9G&B9R&h@ut$@xu j2jj&xtE&ǀtǀx&1fx~Nt&]EЉE1fx~&MA(]F]C9|GUB9|e[^_U WVS}u $Bh9 VVBWP?v$@xt ~u0ۃ`&09ht R1ɡ&tQ.&PJy B;B| t RQ&x$@DtDeuN@Av$@x|&p|&uv$@xt ~u0ۃ`&09ht R0ɡ&tQ.&PJy B;B| t RQ&x$@DtDet$@tCtN$@ t v$@s$@xt ~u0ۃ`&09ht R/ɡ&tQ1v&PJy B;B| t RQ&x$@DtDAs$@tsNe[^_ÉUVSu$Bt'h9 VVB(TPr$19}$@pTrC9|e[^ÉUurqU WVS] uM}x$B99M&h@u tBxu j-jEP&xtA&UtǀxU09ht R-h9 j$@>}$BxX9M&h@u tBxu j-jS&xtI@&tǀxU09ht R,h9 j$@pX$B99M&h@u tBxu j`,jEP&xt?&UtǀxU09ht R,h9 EPjP$@$B9M&h@u tBxu j+jS&xt>&tǀxU09ht RV+h9 URjR$@PP}o$B99M&h@u tBxu j*jEP&xt=&UtǀxU09ht R|*1;}h9 j$@nG;}|$BxX9M&h@u tBxu j)jS&xt+=&tǀxU09ht R)1;}}7vh9 j$@pXmG;}|v&l<$@x1;}])&h@ut$@xu j)jS&xt1<&tǀx1fx&BH9tu!BH9xuEPv]$@xt ~u0ۃ`&09ht RW(ɡ&tQ1v&PJy B;B| t RQ &x$@DtDl&P9x|pF&@9G;}l1e[^_ÉU WVS]uM}$B9u 9&h@u tBxu j('jE P&xtU:&U tǀxU09ht R&h9 j$@O}$B9&h@u tBxu jg&jE P&xt9&U tǀxU09ht R&h9 j$@v$B9u 9&h@u tBxu j%jE P&xt8&U tǀxU09ht RT%h9 EPjP$@$B9&h@u tBxu j$jU R&xt8&U tǀxU09ht R$h9 EPjP$@JPh$B9u 9&h@u tBxu j $jU R&xt97&U tǀxU09ht R#1;}h9 j$@gG;}|$B9&h@u tBxu j9#jE P&xtf6&U tǀxU09ht R"1;}}7vh9 j$@gG;}| &l<$@x1;}] &h@ut$@xu j9"jS&xti5&tǀx1fx&BH9tu!BH9xuEPPv]$@xt ~u0ۃ`&09ht R!ɡ&tQ1v&PJy B;B| t RQ&x$@DtDIe&P9x|F&@9G;}l1e[^_ÉU WVSu] }$@uxXt$@uu *v&h@ut$@xu jN jS&xt~3&tǀxU09ht R u$$BxXth9 jBpX6v$Bt.h9 VjVB=EPc-v19}$h9 j$@pXcC9|ޡ&h@ut$@xu j@jW&xtp2&tǀxU09ht Ru.$Bth9 jBck$Bt*h9 VjVB%DPb/19}'h9 j$@bC9|1e[^_ÐUWVS} p& $@xt ȋ@% ‰UET$@xux } u|19}v&h@ut$@xu jjV&xt0&tǀxjj F9|EPURjEPU RWà $@x Lu u$@tT&E9tt H9tu:$Bt(tEh9 jBah9 jURE P$@p 3BP`}t%h9 j$@`v&ǀxǀtUREPU RPRWà h9 jEPj$@p AP_`&ǀxǀt&&RURE)@PE PWv$@xux 9U9U-E9E$Bxtu]&h@u tBxu jKjS&xt{.&tǀxj u$@x1{]&h@ut$@xu jjS&xt-&tǀxjj F9{UREPjURE PPà ~$@x 5} tT&E 9tt H9tu:$Bt(tEh9 jB)^h9 jURE P$@p =?P]}t#h9 j$@]&ǀxǀtUREPU RPRPà h9 jEPj$@p >Pg]&ǀxǀtu2&RtURE PUDPPÃt8EPEPE PW5t&7` URE PW1ve[^_ÍvU&ǀhx&@&lu"$@te\$@t `$@t%\$@t\$@t[$@t[$P\t3`t*@xt \$@`Px[ÉUÍvU&ht j &ltt<ukƀ<h9 jjjU:&ƀ<j&BHPxt)&PJtǀx jj ÐU\WVS=&t+&dujFË9uQuVjVP jVB]SVjLj jSǃu'VjV jVj茈 ]SdjS ujSjEPjHE]ȍEPE uVSjj迌P赋 jVjч a;P2jEPjڇe[^_ÉU VSu=F]EPEEjSVU |&ty=&t=&xt2@@P\t&ƀ&ǀ9 S<=&t&ǀdujU|&tƀuÐU$S]EPjS胆u(}t u}uju S]1]ÐUSE=uhȥh=tjhȥjh Sj+   Sj Sj  Sju ]ÐU WVSE&&p&e&B t&B$x&B(p&08P؍e[^_ÐUS]t!3s S]US]|&=|&t=9|&u|&(vt9u狃s Gs$F s(Fs,H s0:,t,44t4ttsc{t0{t*sBtF|8 usS;&u<t&x&p&&]ÐU1ÐU1ÐUÉUÍvUÍvU WVSu]E fEhjW&&|&|&jVL&$PfXfXUfPǀtǀxǀ|ǀǀǀfǀ\ǀdpǀphYg& %Ƃ<&ƀ=&ǀ@ǀDǀTǀXt ǀ\| ǀ` ǀd ǀh ǀlǀtǀxǀ|$@ fx~B¡&oLсH$B f@BǀH=&P󥡀&ƀS&ƀR&ǀǀǀjjEPPUDx&jjEPP3Dt&_& x&J$t&B ǂp4 At&@1=x}ۡ8};j&@)PuVSCHVQ@=jjEPSqCJEPQBС&fX&f)X G8t 6jjEP&@$PB‰p&t&P(GG1e[^_ÍvUUu13=<s U P@ 1ÐUUu1vu }PU=&u ,&ǀdPhGU WVS++++++++-|+~_`+d:x'|#o<>v^###--<>*!f$@ltlN$@Htw1ۋHЍx9sZ $vAHS;>gEgˉ=wuU%1tЉEE\;*u uEI;.uCC;>t==wuU%1tЉEE]EC;>`]&u g &ۀE]C;E}fUf fUm]Eme[^ÍvUSu uk@Bt&Ișȋ]ÉU$Bx t$&@HPjBp "POAÐU$@xptpp-A&ǂxǂtptpǂpP;ÍvUW &=$~_Й & ǀj$@p4¡&j$@p0¡& j$@pH¡&j$@p8¡& j$@pD¡&j$@p,¡& j$@pL_¡&j$@p|=¡&  j$@¡&ǀ$Bt#jB¡& &$PB(uB<jjj&, P¡&jj$@PP¡& jj$@P¡&jj$@P¡& jj$@ZP¡&jj$@p *P¡& jj$@PK¡&j$@p¡& j$@p¡&j$@4_¡& j$@pT:¡&j$@¡& jj$@P¡&jj$@P¡& jj$@Pv¡&jjj $@jPA¡& jjj:P¡&jj$@p P¡& jj$@Pǡ&;~&9~Љ&$@xtxH1&$@x0tx0H1 &$@xHtxHH1$$Bt@xpt:BppNt$Pǂ@ǀ}Uj&@HPjj@ &pt j4$@t9j J9UlWVS] EDžDž}tU9]qDž@B$Bt<}t%MQBPEPO &9]U)ډ$BtR&9}?}t(SBIPEP &$@x,&;_}tM&$@Džu@,ǰHtЍPv1ҋ=w@t7։K~.RVK Dž@B{v+]$BtR&9}?}t(PBPURW &$@xL&;}t]&$@Džu@LǰHtЍPv1ҋ=w@t7։K~.RV\K Dž@B@B!}t}ЋUDEM9MDž@B$Bx t9}t"]SBp )PEP &U9UM)щ$BtL&9}9}t"QBPEPB &$@xDDžƅz~NuE&@$P(MI]%=wuU%1tƅ1;}c &A$P(][U0;hvF;}.&C$H(URU0;htƅϰʉЋD1;}<=&UR4G$@(Uڋ0C;|؋&&$@@DǰHЍP=wAt8։K~/RVK Dž@B9}tPEPmM+M$BtL&9}9}t"QBPEP" &$Bx8ƅ&RDžR8װHЍP=wAt8։K~/RVXK Dž@B;}}tPMQ@Bu @B[^_ÐUWVSu};uu 9} u1b&P9|әM׋ &A9E ] CؙA9C)‰)$Bth9 jB^0+ `cxXcXchXcj mK} ~l$Bxth9 jBp0< `cy `c;pc|XcXcvhXcj E +&@H9~ơ&@H9E~EDžDž@BW]S&tcPP"&} u~'@9})yډ+E yЃI} t;jW]SE PVjƒ @Bt;}DžtT$@xtFjWURjVjƒ @Bt%&;}Dž$@x0tGjW]Sjjj5ƒ @Bt%&;}Dž$@xHtPjWEPj&@HPjƒ @Bt%&;}Dž} ~&1ۋ$B8tgxua~]Bx8tTjWUR&@HPFPjMƒ @Bt'&;}DžHW$gjW]SE PVP +$@pSjWURjV&S$@p0S^jWEPjj& Sv$@pHS"jWURj&BHP$Ssƅ} ~$@pPy$@p8S\jWEP&@HPFP߰ЍDP0@Bth9 jP+1[^_U=&t&@vÐU=&t&Dv1UEtT:%uHztBBNw5$hB*$BB<wB9~vCB:u);@v-@@P5DD- ~ 1ɍU܉UEUԋBUA9}9| K ]ܡ`@Iy v>%t F=D]؉]EEE1EE%G>Xw,$iGiAGE`AEY}uFL=wuU%1t*}t \PEȍTPЉUȊAGE9t }iE9}؋UЉΊ]z$tnF>th>%uF>?u@v>;u~?H؀>euӅu1F1 v>t2F>t,>%uF>?u@v>;u߅~H؀>t F>i=ujjFu1ve[^_US]{t SG{t S=]UWVS} ]}E@8Et{U9Z0u 9z4|f|b}tMATS}tMA@980}t UBT8W}tMA@9 ~kEPUZ0z41]/MI(Mv]E@(EUMً]GF}tMA@9||1e[^_ÐUUE uB1ÐUWVSEx8ǃ8G8EEGuoW(UMI4\2|FG4@MQ( ET0G0fytA9~fYfytA9}fQEG9E~88q[^_UWVS}Ex8P8URE]CEUB4]{(@ f||[E@]C(4DS0)L)х}1ۋUB9~f~tF9~f^f~tF9}fNE]C9Eqe[^_ÐUS] CC0PC4Ps8[8t{8u֋]ÐU WVS}t'UB PBPB@PB@Pƃu 1 vMAfFfAfFAfFAfFA fF AHfFHA $fF AFAFAFAFAFA F A$F$AFAFF0F4F8A,fF,A.fF.Q M1FuPV(MA(MQ44V(MA(DfDV(A(DfDGF9~e[^_ÐUVSu&1҅9qu&vQ#F u01Fu(V([<t4CF9~ڃv(߬V֬;5t&u t&;5p&u p&;5x&ux&ʋ @e[^ÐU WVSu]|w|s}|m} |g}u&@E)u} u&@E )] U ڋ &A9*UA9jSVE PEPƃ u1Vw1;]}hjE P2@F([ F(<tĉ[ E 9s   F(9rC;]|e[^_ÍvUWVSM]}}} |{|wUU }G@9eG@9Y} uE@E EH)E u UJC)}G tVUB PBEPQM Qƅu1Wv}~4^0UBFBF1;} }-]v ][(URU^(EG;} |܋MN8e[^_UUB M)PBM)Puu RÉUE19uȉÐUWVS}uEeWt\M QtIjj!>Et3jLj >Ãtj W=C(uS舩1gfCfHfCM IfKEfCMfK &BfCHfs CC }uB9u B9E KCCCCCC C$CCC0C4C8fC,HfC.fCfC@fCDfCBfCF19}"u NC(IfDC(ftA9|}uGUU &A9u3K }uA9u }uK E&R9uK &MY؍e[^_ÐU=$tu$@(Plt1U=$tuj$@(PRt v1U$,P}t "$@0t@ǀ1ÉU$XP5u $`\1ÐU=$t]$XP0=&t9=p&tp&x t jZ&x u jp1vÐU=$tI=&t-j]&x tjpN$,PÐUh5ÍvUhQÐUVSu] hl٧uqV聐&ӉP tV$$ ~ &xu-S蹤ƒt&PS%PRV-e[^ÐU WVS}E t55&tu$@x t_R1v[^_ÉUVSuU t&t FS[^ÍvUS]C=w &C1v[UUE t<u B$ B$1ÐUUE uB1ÐUUtE B$ÉUUE uB PÍvUSM ˋ&Ét%$@t#u$@tq1]ÉUVS]&pw_9u t' t9evu]$@xPt/pP?$@x@tp@($@x4u 5v$@p4&pte[^ÍvUU&P1ÉU WVSu] u1<C 9u,13VusVte[^_ÐU&p,uÐUSEÄt $@dt du+$@`t`t&x4u&@41]ÐU1҃=$tE$@uux|t%t$@xTu tÐU1҃=$t6$@u t$@xXu tUVS1۸=tKv<2w'P$2@4&,PC<ue[^ÐU WVS]EfEu >=$f;tj;[{t8Cu ;빐j j4CtÉ`j j4É߃uG$_j j|4Ãu%$t9;Su#CFuEfC e[^_ÐUS]$@xtsS_5$غh )$~$P$ЃK=$9 u 1]ÉU=&t &@XcP葉ÍvUM=&tV&t4MjEP=&t &@Xc@PEv=&t &@XcJy B;B| t  vRQ^1ÉUh9 juÉU WVS]}tu =$uEuE$@;Xt;uEE$BxuHB fx t>=&t&u'5$¡$@ @ 9|E1=wuU%1=wuU%1ttPCѐ4;.uOC=wuU%1t t0C=wuU%1uۀ;*uu C=$;;$tP]C;Suj$׃j<׃ g1ɉ=wuU%1tLPCѐ ;.uOC=wuU%1t LC=wuU%1u۰;*uM C;*t;/t~1}u }ut!gfff)P;t Cyv~*}u}tgfff)Pb$9 1e[^_ÐU,WVSu} EfEUfUNEE)9|9E)EvF([URMQ4U4K;]}])9}9)E1Fu$[EvF(MM BF9~C;]|΅]E)99E)EvF([URMQ4U4PC;]~])9~6)E1Fu![ F(}HfCEP1e[^_ÐU塀&f^u &f\uefǀ\f^u fǀ^&f^&^f;\u fǂ^&^f`Jv&f\u fǀ\&f\&\f;^u fǂ^&\8U1UMU t A9}A(Rf|%ÉUSEt*1@u"X(HRf|t  B9~1[ÉU WVSuM ]}t| |F9~kʍ9}`F9XىMN(Ru fD fD^(R t FfD fD B;U}F9~1[^_US];t&uCa+vS'u{t x&@aC]ÍvU,WVS}t E@ t UR fUMYx&QPQPQ(E` PfUfEfXHf]Mf;Hx&f;XEE@R(<E@MQ(Efxty@EE9E~EURfUu‰;ELUދ;t,fu fwfwf;w}fw f;w~fwfEFM;M~MfAfAfEfEUEf;PUMf;J,Ext @x&@Uzu"x&RMffQHfQ fQfPx&MAB1e[^_ÐUMMb)‰U)Ѝ))ȉ)эEPjP]u1ÐUSE$$t6$$@t $؋]ÉUS]t*S)zSȏ;$u $1]ÐUS];u >|.19lu lAw9lu닂l[ÐUSE|/19lu lAw9lu닚l[U$XPe$P?ƒ=$t $ÐU WVS]3{C @tf;s}c C @u f;sf;{~ bvS_Eƍ@S(fztf9z~fzCfBNj C9w U9vS1e[^_ÐUE@ÐUEM P u@t0 %v@0t0 Љt0  ЉÉUWVSuE @u#ۃS+vEx^M V uFt0 "F0t0 Љt0  Љ@V(fzu fZfZB9}fZB9~fZ CF9~BN @ff;F.~$F.fFfF~jV"fFDvf^8vFEE t*  E=$$)E~u F.9Et F9EE 0EM F;E}ӉV uFt0 #F0t0 Љt0  Љ@V(fzu fZfZvB9}fZB9~fZr$@(PotY4EPhht@$@(P} 8u 8tʃ;E>E;~>($@ fx~f8~@$@ ;~> P $Q fBQ f$@ fx| @$ $e[^ÍvUEPEPn=&t&ptuupÐUVSu] j/Vgt1tSPV$tSV3uE1f{tvC<}BC9|1f{ tCX&Rh pwZI;H(StQ1v%Rz(Dž;J(}00Ix(;A(|ӃPRfy(t3˃0B(H@4QUH(uӃRQTxtpmz tr umytq[m  %1ҋfxt#A<uBA9|1ҋfxt(vA f }t}tN}txvEF"EVUN"M^$F$ȉEFEV"UF$E^&]N"MEF&EF Eq^"F$F&19sCF4U Rnxu#F"V$9wF"9ȉMG9rEv1}E9sfE PF4 xuE|?}+UU}t}t )}t!E,E'EvG9r}4}t_ }t}fF"fFFPv$\F^K;]VDK;]w~fF$fFFPv [F ^K;]vRV DZfZK;]w ;uv=tj5 &3suI{hs;"t7u!ss3h~= ;u5 &u=P&tHV5 &EPt+=L&v5 &h~Q=u%5 &h~%=79J"u=~؋= &u"=%%P!PjDuO~؋= &u4=%%Pe!PjS! uxuDžgvBt!t !t 5 &Ph ;Sv6At4 tUt?JSuF/vPMA fPSuFPMAvKuV &fJ&=%u'AExPR5 &$ƒRq3SuF _s3h}~:Is3h`~j:5uhGR:,=%u:P;Ot PU2P90} =%uxƅj+M17t ƅ;1ۋu;^(}/j+[E,46uƅCE;X(|ӃPUR MQ ]Sa21[^_UMU u tu 9$uGyuAǍv:$uGzuBǍv9u :u1:u ABKv)‰UWVSE UBu((t(0‹MA]Cu%,t,0‹CUBxu[B fxD~6@DPhhSXSV0‹MAP h70‹]CPUBx8B fxH~7@HPhhSWS/‹MAP8 Lv]Cx%uh/‹CP8#EP4t4t 4B8MQz,0t0t 0B,i]Cx)t[C fxF~6@FPhhSVS&/‹MAP, h/‹]CP,EP@x&0t0t 0B,nUBx)tbB fxF~:@FPhhSCVS.‹MA !vh_.‹]CUBeBx)ubB fxF~<@FPhhSUS.‹MA h-‹]CUBxxtZtQtHhpS.ƅw߰Ҹ)PUBa]Cxt~xtxx,trx,tlhpS.ƅw߰Ҹ)PUBp,SJƅx S,‹MA]Cx+tx'u UB@MAuaA fxJ~9@JPhhS.TSm,‹]C hK,‹MA]S fzuCx*ufBUBxuh,‹MAP]Cx*C fxt!fxt@Ph2UBtPht'MA1Ph2 9]CuhP+‹MA]C f@UB88h*8ÃjiMA8l/ƅ t ym\>tS6Igu~uSh@1)~!h6Ãhvǃ tuhg2vSMA<u6ha1GMQ<tH4C4fW]C4/P6vh 1 hS]C;t+;$u{t;uAC;uPw)W]C h*jÃ}t4EP4u% t 4UBǀ MAxAuh(‹]CUB<uh(‹MA<]Cuh(‹CUB@t @ MADt D]CHt HUBLt LMAPt P]CTt TUBXt XuhMA\t \uP]C`t `u8UBdt du MAhhsUBHt&HSE߰Ѝ\UB@t@xulCB@CMADtDxumCADCUBHtHxukCBHCMALtLxujCALCUBPtPxutCBPCMATtTxuuCATCUBXtXxuvCBXCMA\t\xuwCA\CUB`t`xuqCB`CMAdtdxuxCAdCUBht3nCBhSC߰Ѝ\9t`P$‹MAHh ,7]CHu'xdt!th`$‹CH[^_ÍvU WVSuFttHt&HSB߰Ѝ\Vt8tlCtCVtxtqCt@CVtxtkCt@CVtxtxCt@CVtxtjCt@CVtxtmCt@CVtxtwCt@CVtxtuCt@CVtxtvCt@CVtx ttCt@ CVtx tnCt@ C9t1P"‹FHh)Fǀt[^_ÉU WVSGt"t "t D  41L1ۃ>tŐEP4^u"jT 9zuB9u C<u냍ve[^_UVS]1Ɋt$<|t Awt<|u[^ÉUWVSMtnv9tf] AC;t:t19t0vU:t:tB:t :uu1A9uӅt ;u Au1[^_ÐUWS=%u{h΂>Ãte߰Ѓ =wK߰Ѓ P;%uhӂ(Sh5%hH%e[_UlWVSE=$t+$h@h'$@7 t  ǐc ƃ t t t\uG t t tƃ=!:u :u ƃ.u)=Q&u Evƃ.t t tvVL+va4%ub.u =Q&uTPh#u:V#Phh & !P{v != i=&%&X&&%<,u%!,\u t t tƉCƃ t5uhU&v:u:,t%!:=%uH%!:UhhPhc%v=%uvK; t; t;,tCj|h u"Ãu Ѝ3h $j|h ƃ t>uhc$u Ѝ 9s]vR(va4%@;/Ph!C9r & /vV( a4%u=%u _u;uCƃuC:t='#,t=3@t2y!9t h@`$ & 1nvO!9tVz Ph h:#  & &v1ƉvVj' a4%t D/GNv]jEPSpǃ9]uh h"E8u !9th" & =&rvh Sz!9th@" & &) V;PhЄ" }uÉ؍e[^_ÉUWVSuEEE_^}%É߃uhv"w)vW% a4%uWPhK! ?u'F=L&h%!}s\[É߃u!h!PGЃEEÉ߃uh!CЃv3wuU%1tSh@d U\Љ]E}~}uEECjwh$ ~ yvqv iv av Yv\Qv^Iv,Av:9vWPhF v u =%tFu}E}X~}uhiEIÉ!9t#tE H9t=%t ke[^_ÍvUE$h@ÍvUS]9tu[ÍvUUE $@LDH%t X&\&ÉUWS=DЍXtEDvR" a4%@uD vs1e[_ÉUWS=Lu3D8D8 X&\&=DtD85L%5Lhh H tX&\&HDt = #tuvvDD8 t8 tD߰ЍPv| u| uD DDD;H \&De[_ÉUUD;Huhq DDÐU=Lt5L=DtHD)‰1U=LtL@ f1=DtD8%ÐUSM1ۀ9tAA9u캧|A)Ѝ)))É[ÐU WVS}u Wt0f{ }1%C @W3Pu҉؍e[^_U WVS} ]ލL9s.9{u3EPPu L9r1e[^_ÐU}t,ÍvU帠}tÐU=uhZ.=u hÐU WVS])֋} );v5PR/uhvE PS?1߰ЍDe[^_ÍvU=~hU=u%=uh& ÍvUVSM<\t <^tiwvA<3Q<0}<%I<$}EuA\[v=wuU%1t5ЍAF̊vY vӁvR- a4%tZ,tU'tP\tK:tFh5`h`P`'vh5 cv8fÍf0`h`Qm vyfӍЍffэЍf(0 `h`Pf˺ ȉf1fЋ0`h`R`}h`Pe[^UVSu] =tu u95ubhh5- h5 sv=tv5rDvh50`h`Ps=t h5v=th5Me[^ÐU WVS}] Eu}Y=wuU%12]v=wuU%1u;*t ;.C͐;%C}`%h`PCNO$`%h`P=WhHv=aWh $v==Whvh2vj5h55q j5hDj5hNfj5hW5  S ÃhZ5 SÃh_5 <;=t;+t;-t;*t ;/+{pt {c{;=tj5{pu6jCP;t FCP<ƃ$hd"hghj hm5Ev=t/=u$=u vvj5Swà hdEj5SKà hpFj5|huvSÃj5Q hx5=j5h}^;3t#;2j5h4j5hj5h51 v h5ov`%h`PKWPPt Ph6%C`h`R;}h5R]v=wuU%1u ;*t;.u(`h`RC뮉h5`h`Pe[^_ÉUS1ۍEPEPh &uuTE=wuU%1t1E=wuU%1t E:Eu؋]ÉU`VSu] wavSva4%t6:t\u`\h`Vƈ`h`B؃9uSg PEPI% ShTEP.EPVrƉe[^ÍvUVS] uhZuFSP VPe[^UK;/K=wuU%v1uڀ;.tՀ;*tЀ;\u#~^t~,uF`h`>$uO~.t>*t >/t>>uFǍvN>%u"~%uh]EPl>%u}`h`IEPEPh`Vu!j;V& ƃuuEPEPEPh|VtTEPEPhVuj;VƃuuEP7EPEPhVIu-j;Vƃuu}W>E؃ vVtƃhEPQEPhVtEPhVuPj+Vt>phd}WE؃}tEEuEPvjhNVhuhjhV@u!E}hEPljhVuE}wh4FN7$`%h`EP`%h`}WE؃=wuU%1tF`h`EP뻃Ph>d1hvhEPjhuZF>1u E>2u/}us}umhEPJEEMv>2~E1bvh2}WE؃%v`h`EPE؃E>tF>t ;u1}ue[^_ÐUS]fC,fC'fC fC"fC$fC&{uj,C{ ujNC {uhxC1f{tvCBC9|1f{tvC fPBC9|1f{ tCBC 9|]ÉU WVShj\ÃtߋuEPS؍e[^_ÍvUWSUװ׍;=wRP=e[_ÉU WVSu-|1f~ tF~N <u #F t&Q(1IA~vI&4[^_ÉU,WVS]} &DU)؅}H)R &RP#u)9t&E&U)؉EEP(v1UJA~IU􋂌N2~S3cE>FS(EC(C(C,S:E4vE>e[^_UUB(;B$u1)J(A;B$ry tvH;B$r8 uR()‰HÍvUS]S;C,]ÐU WVS]} t C<C,;C0r ${<un{4t80$C( $0$jSjSC(C(C8S;D v{4tJ1;s<}$v0$C( $F;s<|ߋ0$s]ÉUÉUuU1ÐUS]Eǃ C,u/hs$SC$S,)‰C<Sd<uESPS02}u1]ÉUUǂ B,B<)ȉ|R%ǂÍvU WVSuEdž@dž F,}džSvu/hv$5F$V,)‰ jjЃtX1ۅV>;cjjЃtX1G;~-vGjjЃtX1ۅt>V$F,)PRSRuF$V,)‰Ѐ<tSV=tE}tVG%e[^_ÍvU WVSuEdž@dž F,jjЃtX1ۅV=nvV$F,)PRSQuF$V,)‰Ѐ<tSV<t}jjЃtXv1G;}u}uVh<u EV %e[^_ÐUS]S=S(: uJ;S$r%: u K<{<~'vJ;S$r: uK<{<{<~ )vJ;S$r: uBI~ ;S,s: uS(]ÐUS]SS(;S,s#: u K<{<~%B;S,s: uK<{<{<~ vBI~ ;S,s: uS(]ÐUVS]C$C$C,C(jSC( C(C(:C(C( C(S- VS 0C$C$C,C(VS$t[^ÐUWShÃ1E @C ECu߼CcSJ SgS SSk S79S: S&S]ECǃ1e[_ÍvUS]t|SySu h`<vuE8uh<s\1uPWEPVqe[^_ÐUVS]M u< u5;\u X<u;Xu\<t VS e[^ÉUEU :uh<p[tRP1UVS]u u>t1"jVS(Vh =s{[e[^U WVS] }u:u@{ t&WEPUt 15[ эvC{tC{t[믐e[^_ÐU WVSu} :t<~tF[{tC:u{uPCsG?~ tv lF Ftt,"t#u~tvA'vEF}t  }t *t!UFGE0+F3v~ uPNF UREPWv 1e[^_ÐU WVS}M 1:t,ڃ{tCRztoB:uzt`֋^A9u t*/v{ tFQC Pu1{ u+uCCFCSv1e[^_ÉUS]tk{ ts C sCtt+!t#u{tsvS]ÉUS]jx@@@ @]ÐU WVS}u ]U>uRSW1xv:uZPRƒ{ tF[ B붐~u>D"DsCPW1{t [se[^_ÍvU WVSu} ]~>C"Dh@=vxWhv=vbW~uuPSƒ u.D"DwGPV5vBPw V@t SwV*1e[^_UVSu] MEtmt t.XuS=u=RP1Pvt :t8;Bu2S5,v[V+vh=S5,vvRlva4%t^C>u ?$ @>^t>\u\Cv> tYvR a4%t2vR֮ a4%@u$\C$0C$0C$0CF> ?t tGCE e[^_ÉU WVS]hXhl\ǃd,ǃh.ǃl- hD8ƉthlƉx [ǃ|[S1e[^_ÐUS]XǃX\訽ǃ\ǃdǃhǃl toǃtxWǃx]UVSE\vS a4%t3C~ɍe[^ÉU WVS}\X1ۀ>/tC<3/u~01ۀ8/tC</u~puƈ]E3t8 t1"t($Ej3PW PEPWvC~E0e[^_ÉUWVS]\XElMhǃp`S1҃M 2:M B~SjSuN SAe[^_ÐUWVSu\XEddžp`VJ1҃:E"B~VEVEEE jj(VPEPV:jVM V/Ae[^_ÍvUWVUE ƿ=u R"%ƿ=t Ro1e^_ÉUVSu];t{uXh=PSct9t?E v9At 9u#1Ph=v*O SVV[^U WVS}u M]Ȉf؈f<1"u;9h=PPPh=wNt:ti19BuW9tc2h=PPKPh=PP,Ph=w#N? :uv2h=PPPh=wM[^_ÍvUVSuh=vM11ۃ\:tCPQRVكC~؍CPQ\Vch=vgM11ۃ X:tCPQRV2كC~؍CPQXVh >vM h=V>h&>vL h=V=e[^ÉU,WVS}Dž}u v\DžDžDžMQv:-B$>vXvDžDžzDžnWWKt;s3h:>wK ;uBPU2hB>wKFM#E<uW|u3U4FPyÃuM1h`>EFtXtSW;v{u<uSW"E<u3tSW;vSRWt$wvgM4PvuE0h>vt'RQWPSW-:%vPRWPSWE4WMuU42h>wIt'QPW8PSW9kv{t2RQWPSW`1SQW v۶v1[^_ÍvU WVSu}|} t }tu PxNsx[Pt3st|xt:tu߀>t F>uN9us~ tu;t C;uK9s{ t]E8u ?;uv 9vNK:tFuC]u]܉u]؋U:tjE;}s^vU:uNu;MsE9sFA;Ms ;us:tE+E܉)9}҉)9~]܉M؋UUuC;]r?tiEuU9sZE:uL;Ms;}s:uvAC;Ms ;]s:tE+E)9}҉+E9~ }܉]؉uMF;urE+E UUEEU)UԋE+E)EԋE+E؉EЋE+E)EЋUBPuE}~EEEUU܉U؃}~ EEUUU+UE)9} EEUUE@PuE}}UUUEE܉E؃}} UUEEU+UE)9~ UUEEE+EUUUEE܉E؋U)UԋE+E)EԋE+E؉EЋE+E)EЃuURME9Et9}}+E EԋU;BH+EPRE9EteURWEPURWEpHE+E PU REP0])+]SUԍ4:VEPwSVEEP])SWURQSWEP_}u+u VURCE9EtP]SURBSEpHVU RP0])SWEPSWUR ;E)PWEPE+E U+U)PURN E}E+E EPEPU9Ut2EPEPE+EPUREP26E+EPUREPE+E U+U)PUR 9}u+u])9}+EPEPU9Uth)]ԅ~3SWEPURWEpHE+E PU REP0])+]SUԍ4:VEP\SVEEv])SWUR9SWEPG }|qE+EPUR3E9Et<}~UREPUR"E+E+EPEEPEPE+EPUREPe[^_ÐUVSMU u1 BAC9s:u9s  AC9r[^UWVSEPHU@$EvEF u1 ut}vFuovS׏ a4%tF;u~>6vS蟏 a4%u ;u~+uG;u|1GEEU;B(HWURVEP :'e[^_ÉUVSu] S&VFFFF;FH|$FF j &j &e[^ÐUVSuF(X t;F,tV+vS藎 a4%t&t @?j^V/vvSG a4%tSVMvj\V0PV 0PV؃0PV %e[^ÉUMAA1;QL}AB;QL|ǁ ÐUVSuFPtKjV1ۃ; %vSVvHV. C; ~ރjV_' VMj $ j $e[^ÍvUS]hǃǃƃǃ1]ÍvUS]̜ǃ]ÐUWVS}] SW_tAjSuVfu&jjjWVd ؃V^@1ۉ؍e[^_UEu vUWS]CD<1pu`;X%C(+C$=~ ǃ|+s$He[_ÉU,WVS]C(E/UEEU} C,D;C0 u3/:.*EEC, C,/u/ S,FC,>uS,/C,p9sS,FC,9rC,SEPS tjSn%XE`'wr$@vE S,EC, EdvETv41E<t= <t<vEvSOvF9C(DC(h js,PAƃ,C( S,C(C(C,9s(s C(8 t~SEC(C,S4TvPh@胁$9vE/h/SEE C,K,C,;C$v8 uC,}HE]N;v>[t>]uE}[}tg;} ub=/?uIt ǃ ǃSU<u SEuC,C$vC(uH@C(.*C(;C$r!;C,wW@PSE<uVSDu jSλ jSiE}t(uC,vC$C(W@PS0}uASE9tS#<US(/?/:WSE<u=/?u }:uE}t }uZ}uTE/U쉓E9t S<u /vUS(}u Sc}u }Ee[^_U WVS}ƅ.ƅ*G$G$G,G(E jW G( G(G(G(} u/v?WPWNp uG$G$G,G(8.8*hPS3z.@*hSPz.* 2.F*FhPyE GDG$G,G(} ujWӸ<t&jWe<uWq8t&WOG, G,G,W[^_ÍvU WVSu} }u/^(;^$rKvWSu K;^$s/v^(1*^(vWSuC;t;^0re[^_ÍvUMU QDA$A,t t+vjQa%jQ襷%ÐUVS]u S(MIt9uJ;S$v9us;S$r u9t:9u}tBS(@uS)1C(She[^UVS]u S(MIt9uB;S,s9us;S,r ;9u}tJS(@uS1C(Se[^U0VSu]SVSW EPSj!t tDR5/%j5/ <u5/I$v5/V5/(1Ƀ=/t#;5/t/vA<t;4u/4V蚚jEPj! Vj$e[^ÐU0VSu]SќjSF jS8jS- jSjS jSjS jSEPSjr  j$U1҃/=/tB jS0jS% jSjS  jSjS jSEPSjj1ۃ /=/t5vhF 4輘ƒF t C/@FS e[^ÍvU WVSuHF@P 1ۃ;^}@PC;^|FExF@Pć1ۃ;^}@P謇C;^|FEx e[^_U WVS}wGt+>tv3Z;uVFw G t'>t3";uVe[^_ÉU WVS}E ;G;GL+w~R~%W\z|tB|8thp` VVVr|r19}j NC9|GW\tP8tE؃zhtBh8u.hp` PPPG\~8P@vG\xht4@h8t,1ۉ9}"ލvhp` jG\phC9|E Ge[^_ÐU WVS}E ;GGH@9E } uj [Gvu +wFv*W\zt!B8thp` E PPPr~3W\t'8thp` VVVvGPtEG%U 9t09}u j 9|E %GWE )POGRWڃ~;O\t/8t$hp` RRR6P&bGPt؋U M 9 &;E ~j G^1ۉ9}ރj C9|E Ge[^_U WVS}u ]~ GH@9PF GKue[^_ÉUVSu] FP;^HV\zxtBBx8t:ztB8u'hp` SSSF\px5PvV\z tB 8thp` jr F\xt*@8t"rhp` jF\psV\z$tB$8thp` jr$e[^ÐU WVS}u ]\GPR;_HIW\tS8tHz4tB48u5hp` SSSG\4PSVWAW\z8tB88twz(tqB(8tihp` jr8_PF KuW\z<tB<8thp` jr<hp` jG\p(jbW\z4tB48thp` jr4EPF5 GW\z<tB<8thp` jr< Kue[^_ÉU WVS}u GPt'W\z tB 8thp` jr 19}j C9|we[^_ÍvUS]S\zt!B8thp` C`prgeS\z0tGB08t?zt9B8t1hp` C`pr0/hp` C`pC\pj j ]ÍvUMQ\zttBt8thp` jrt4Q\ztB8thp` jr vjU<WVSu SŒjS7 PSjuhDRƃt>uDUzd1Vrd7,ǃuhDEpuVhDUr4h EMqUB`@PB`@@ MQ`BB0=0jSEPU;uhD.‹MA`hFD.‹MA`P hVD.‹MA`P h-D.‹MA`P hkD/‹MA`Ph~D.‹MA`P0 =0t*V3N/PSEP ;u܋UB`x@PMA`x@EP`BMALBAHQPPEPV URjPjT MQy1[^_ÍvUWVS]} uC`@C`@EPhht@s ftEfxt@f}tEEPhht@s -tEfxt@f}tE1ɋS`B;uB;tȍe[^_ÐUS]M UC`~P v@PC`H@SS*]ÐUE@h?E@@@ @$B@@@@ DE@$@(@,@0IE@4@8 @<@@OE@D$@H @L@PTE@T%@X @\UWVSu^hsCEPh1V茴s CEPh1Vw st<>u%EUt DPS]S>Ov<>"uISWEPTEU| u D>EUt DPS]S蠰E} e[^_U51u JÍvU51bÉU WVS}hXEw hqEw  G`pphEw EGP@tEPhEw EGPtEPhEw 0_\=0tR;t$8th=P3cEP6vhEwL  >uwj H1[^_U WVSExxp@E0;t18&U3Fu/EUBPtFP51Mq u8FuUB`Ex tFR봋u=Fu EhBFp uMпGFtLFuUB`p51r'MRFuUB`plj0;t4M135u-0uV\;uPE0#t :uPM1h`F31;tLv;%u>CMw$GvG$tPhFEpC;utn t vEU:t(8t!PhFMqhp` jVEE8t8u!Rh GUr:1ۃM1ƒEu>t(8t! PhFEphp` jRSR"P<vtWh`GMqEu>t8uh GEpuU2ÃEM9t8uuLh G7E0ƒEM9t.8t'uPhFuv(vhp` RRSP!P=1[^_U WVS]EPs vl 󥍃l lPp4t%=%}RPPERE 0:t9:t} E}~ERE 0:t :t} E}~ҋ! ! ! ! 9PP1e[^_ÉUWVEǀƀxl1-󥍸 2fPe^_ÉUÍvUS]Suu Su]UEU H HJHJHJHJHJHJHJ HJ HJ HJ HJHJHJHJH"JH J@!BÉUUE JHJHJHJHJHJHJH JH JH JH JHJHJHJHJHJ"HJ @B!ÉU,WVS]9EUEfEEfE\M䋻XpulE싓hUvdMEE2=2EEUMEBUEE:Eu } MQEPSUM M EPQSUup0M }t=EPWSѤUM :EPWS趤Up@0: E E86e[^_ÉUWVS]Hw1Ps "r%=%P􍳘V ;t!VrVr !;tt(;t ! ;xt(;t ! ;lt(;t ! ;pt(;t ! ptǃCPRPP1ɃR: uR A1:t1ɾRE U9#u}9}:9t#t A~ȃjS99PP1Ƀ RE Uv#u }9:t#t UA~ƒul Pjs eotǃ1e[^_ÍvUS]u1.lPjs otǃ1]ÉU WVS]u1 󥋃! ! ! !  Pjs Hntǃ1e[^_ÍvUS]t1.Pjs mtǃ1]ÉUC $KC 4C (SCC C c${ wcC $KK$C K$뼉{ C $,KC$tc$0SwC UCU1C Vvc${ wVC $@KP3<t*S 5C\CC  C SC SB9CrCC)ƃVPSlj+Kt!1;S} C  B;S|KKs{SB9CB CPs VC ve[^_UW=H6u^1@a@z~A@Z~0@9~H6_ÉUEL6L6ÍvUS]:] u12`E bhbh`<1…u E )‰Ћ]ÉUlWVSEEE EԋURUEEEEhePES)E E]MY aaaAAu~u@>tj 6Qvj OUM9(]C u6u؉uċE9EI((vEEE}t EUЊEEr%$DMvE@9Et#MuQu]S)%u‹M)@;FӋu~(FF=vFUr2PM'9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]E&u9utEuPVuh($U‹M)@];CӋu~'FF=vFUr2OM&9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT] E%MME#}uu .&u#EEvEEE}t EMЊE}*tf]u}+tX}?tRzv}\mu9uEEE}t EMЊE}+t }?0]]E}+t E€}?t ‹u9uN}$U‹M)ȃ];CvӋu~2%FF=vFUr2MM%9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR}tE@]EP}tuF.9t v.uo}tiE9Esa}tEME}t]C 9t 3v u+u@u E+E؃PEPj $EE+E؃PURj#EM‹])ÉӋu~#FF=vFUr28LM|#9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]S+EPuV}tPN#EE}Z"U‹M)ȃ];CӋu~"FF=vFUr20KMt"9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]SjuVjY"Eq!E؉EȋU‹M)@];CvӋu~!FF=vFUr2@JM!9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]E Eu9uU‹M)ȃ"];CvӋu~ FF=vFUr2TIM 9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ";AR]؉]ȋu‰)@;FӋu~FF=vFUr2HM9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;ATME؋E8^uE8^uE]]܋u‹M)@;FvӋu~FF=vFUr2GM9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT] E؋}1]؀{uutKE9Eu GEEE}t EUЊEEtT}\uNM9MBEEE}t E]ЊEEЊMu2wv}]u E@9EI}t}-uHE8]e}-u6E;Er Ex[t"E;ErEx[ux^tE8]uE8-uAx]t;u9(E萃EPURMQ]SEP Ez}[pE8:du9EEE9EUvM9MEEE}tE]ЊE}:t&}]t u9ut}tEM E뫍vEU}:E8]пLELEME MEMEMEME"ME(ME.ME4M߹E:MEL߹MML:Mtv.Mtc"MtP(Mt=Mt* MtM2E9E6EU9U1ې}t,vS1 a4%}t.vS1 a4%}t.vS1 a4%}t.vS_1 a4%}t&wuU%1T}t.vS0 a4% }t.vS0 a4%}t.vS0 a4%}t.vSc0 a4% }t*vS/0 a4%@uT}t*vS/ a4%u$}t8wvU$%1tكM CEr]tEHM}uEu؀N NECvEEЊMM v]؀{tC|uuNt F|tUBEM Nv] x:vu#f}E%=E9Eu EEEEكU$OU MAEE;Eu-EPu?EN]ۉ]EUMċu+ EM}t E+@DDEUu؋]+3t EUMLUME+D‹])É؃u;FӋExP҉Pv @vMq1>u\9tBE)؋ЉE؃}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)Ѓ;CXuE؊EU؈E؋MEEEE]؉]E@u }u}U‹M)@];CvӋu~RFF=vFUr2<M$9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]E؃EЋu؍DPEPj }uUMEU] 4Ήuă|t LMMEEU] t Ήuȋ|ELȊU(ʈ‹])É؃u;FvӋExP҉Pv @vMq1T;u9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)Ѓ;CNuE؉U؈E؊E(ȋM؈EvE]%u‹M)ȃ;FӋu~FF=vFUr2L:M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]S+EăPuVjnEE}tE+EPEPj U؉UM‹])ÉӋu~FF=vFUr2<9M9tBE)؋ЉE؃}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;A\EE]؉]u %= E;Eu E9E ]MIU9Uu]  EEE}tEuЊ0EE=wuU%v1t.}}EEEDPЉEU9Ut대},E9EtnEEE}tEUЊEE=wuU%v1t"}1ۍE\PЋu9ut 뙐} ]}|UM9]Huu7}\E9EYEEE}tEUЊEv}}t] A}u!u  E؉EȅU‹M)ȃ];CӋu~ FF=vFUr2\6M 9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]S+EPuVj EME ~EU‹M)Eu;F׋Ex P҉Pv @vMq1X5u 9tLE)ЉE؋E)ЉEă}t E)ЉE}t E)UEȃ}t E)ME̋uE)E;FNEPUR~ +Eȃ v+EȃPMQj E uVEPjURjw E  KSE+E؃PMQj EuVS+EPEPj3 E0vMU9n ȊEE}tEMЊE䐋]u9uEx\cqN6bE؉EȋU‹M)@];CӋu~ FF=vFUr23M 9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]E N6vu؉uȋU‰)@];CvӋu~ FF=vFUr22M 9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]EN6u‹M)@;FvӋu~" FF=vFUr21M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]EN6u‹M)@;FvӋu~>FF=vFUr20M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]EN6u‹M)@;FvӋu~ZFF=vFUr2/M,9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]E:N6u‹M)@;FvӋu~vFF=vFUr2/MH9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]EVN6u‹M)@;FvӋu~FF=vFUr2 .Md9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT] ErN6u‹M)@;FvӋu~FF=vFUr2<-M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT] Eu@0EЈEE;EPuuuEU؉UȋM‹])ÉӋu~FF=vFUr2(,Ml9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]E؊EU؈EmM}}t E]ЊE}uD0;Eur>tmE8*te8^t`Ut8\ux+tMx?tGvE8+t:8?t5MtE8{tE8\x{]؉]ȋu‰)ȃ;FvӋu~FF=vFUr2*M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]E؋uE؋EHE̋U‹M)@];CӋu~"FF=vFUr2)M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]u؈E؋EU9U}tE+EPMQj n}uUuF(]u+3s1@v 6. & e[^_ÍvUMU E BBÍvUS]M EUAAQQ[ÐUS] UJ9t IJ9uuSu]ÉUS] UJ9t IJ9uuuSuw]ÉUS]U ;Uvz\1:(u uu:|uf|t[ÍvUVSuU:\ÍB1;E s1 t :)t-t t9)tf} :|tvtt 9|u[^ÉUS]MIxU9\uIy1[UWVSU;E u vHMMQEP<~1ҋEt 1ۉSUR MQS}tËUuƃ}tËMvE8}t&ËM%)ˆӉ%)C<1e[^_ÉU,WVSE@EUUMQUEEeEE1҉߉@EH`U9Uu:} M9Mu(}GU $gGEMUEUME$hPv}OUBM}74E|}FM}F$)ljsENyDU2vMF~}74E}FM}F$)ljrENy1<uUF~1<tMF~1}>F~E@ @u G bUBSM1Aƍ|}8?t ?*EE0@ƋUtu}UE9tMM1AƃEE;EskU;UuCk69EwKE$)ĉPuS&]t}}UEu4EvEH}tUEEKEMAƒEu/EE8EE$vE}}E9E}UBM $bB1e[^_ÐUEU Mt`H EBEB`BBÉUEPuuuPu jjuU,WVSu] E@EURUMMM39} ;E~])}t8 u~ }t'E@uP]u yr};uUBE];u}3;E| E))M;u| E+EU }t5;]~W} 8BE<uCK;]~= }9BM<t';]~"B}<8uK;]~ BM<tE)A}t;u| +E}8U }t%M%E8tJ|;uu}t }GtGE(PU$RVMQ}WEPU RMQY tt~KFCNe[^_ÍvUEPuuPu jjuÉUWVSU$EEЋMAE̋Y]ȋqFuEEEEEEEEEEEEEeEEy$)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe}}}}}}}~}t}EE9EE}9}sIEM]u}M $$$E]9]r}u } tu u}}E EE EEMMM;UU U]]uuUU܋})}܃}~E9EU UU؋MMv]]]؋u)u؋}܉}ԍvE9E<U9U}}tM9M w E E9v]9]0Ѓ}tt u9uwp}9}dEE؉EEU9UDM]u}UEM9Mr}tX]]؋u܉uԋ} 9r E9wUUEM9Ms)v]u}UME]9]rڃ} uFFuUE@s} PbGPQGE`H\vUBuHE@M 9s=Pq] CPsC{u >t*F}8VE9Eu M+M E+EEEM Mv]uMUuEMU}EMUuEC;]vċUEM EUE]EUEuu4EUE}؉MUuEMU}EMUuEC;]vċUEM EUE]EUEuu4UEBEEMЉM]9sIȀ8uEu9us6E8t}9}s&U:uBEBE}uJMU+UE+ED@9sjE+Ep]čD[69EE$)ĉPuS&]}}M+UDv9r]E9w>MUuEMU}EMUuEC;]vċUEM EUE]EUEuu4EUE}؉MUuEMU}EMUuEC;]vċUEM EUE]EUEEUEEU+UE+ED@9ssE+Ep}čD69Ew9E$)ĉPuS]t EEM+UDv9r]U9w>MUuEMU}EMUuEC;]vċUEM EUE]EUEEUEEUBEBE}~&MEM]Ј ECEv}uFFUBEBEtMMJEB+vEWvu]FEE}}}UEBEEMUEB}t] 9] u9u}}9}EH;Eu U UJEH9u MA v]CЋu9uu}EH9Eu MA]%9O}tu 9u }9}}E9EEH;Eu U UJEH9u MA v]CЋu9uu}EH9Eu MA]%9cu9uu}EH9Eu UBM%}t] 9]C u9u4}*EH;Eu } UJEH9u UB vMAv}t] 9]uu9u}EH;Eu } UJEH9u UB vMAL]9]uuEH9Eu }GUEM9M9]9]uu9u}}؉u9tE9Eu UvEH9Eu MA]EU9vM  @;Evr]9]uu9utt}}؉u9tE9Eu UvEH9Eu MA]t1EU9wvM  @;EvE;v v}MUEtEMEUEMEEMEEM9r=MUE]MUEuMUE}I;Msă}nE9Es^MЊ<w <s < t I<uD]C]M@EE]]tE8 E8u 9u,}9} EE}h[^_ÉU WVS} uEU9E<<EE@E)EE@ÃEE| tE3E| u'VE؃Pu}tl]E8tEX@ÃVEPuIt8]*UE"VWEPt 9}1e[^_UVSE] uE9sBE8tVSEP:u 1&vEE@ƒEU9]re[^ÉU WVS}uEEw<$PQEVu EP>u $$uq1wE@ExMREE@EuăEE@EMEu 뙉E둉Ee[^_ÉUWVSM}u] tCF8::tIu1[^_ÉUE``HP5L6u u9P6UWS]u=u Q1}=uCht#h{uL1 h5L6߰HPS蒰P6e[_UWUװHjPjPRh}ÐUEÐUVSE u]t7PhIRhcؖSVhcř hcj oSVhEPye[^ÉU WVSE }]tJPhIRhcoSWhc\ Ή0PhNRhc;JuSWhVK舉0PhTR)PVoRe[^_ÍvU WVS}u jVÃu!20?PVhYR7W؍e[^_ÉUlWVS]u ǃ ǃǃǃ0ǃǃǃ$t'H=vhuRiEthRv}uERjEPEPo} EPvEPV} EPE%f= Ruǹ ujPo uR tEPhR3S3nEPhR7o }JhRvjjVo}VhR3SDvSW|)}thCPEPS1e[^_ÍvU WVS]h4[ƃt*1҉ Suu uV$h謆0PSg1e[^_ÐU WVS]h4ƃu*t b0oPShRhcΒ1&1҉ juu uVe[^_US]|W | =|#0t S~t$t$S1]ÍvUWVSEu }V 1>te8t^EEEE8_uEEPjj膌tCCfCECG ;t8u)ЉЉ)e[^_ÍvU WVS}E {jE 1RPE Éփu.u)H8tE PhRjEP!WEPE Ã}hSjEP9shSE0P]hRjEhSE0PuEPE PEPÃL9vpjE1RPEuuA8hSVEÃXt ] )m+Ee[^_U WVS} ނjE 1RP Éփuu讂8t E PhRjVEPu Ã}hSjWZ,;]sh$S7Wvh@S7We[^_ÐUS]0t&08t 0t0c]ÉU,WVS]jSyǃuhSv0ESEEPS5t hS`jEPE@PSt hS9hShVuS =u71hT3Se[^_ÍvU WVS]} |hTv08u E8v}"%?ЋM@) %j1RP-uu h5TFjEPu Et-E%U)%hGT3SWhXTjS{1e[^_ÐUuu uÐUlWVSEEu EE}ttjdÃu1HC C$C(CDCHC CCC@C8C<jjjCLCPCX}PlCT JURsTC\9mt\>ruC\r>wt>auC\w< w ЉE+>fu E>hu E UEFu{\{\wuGj8hmTEPjjjURSƃ h@CHC u5{vh@CDj8hmTjSƃ uN{DtHC@}}}EPEPtEPURC@{@uS{\wu2jjjjjjjj5656hsTs@C` SCs@l+CC`؍e[^_Uju uVU VSu|!VhT]SWVu S&1e[^ÍvUS]t{\wtD{u.CHC s@h@jP=@tC8C@uu S]US]{<tT{uCa|s@h@jsDCuC<C@@ @tC8뵐CDK]U WVSu1ۉVw;6t+tFt FFX~%CvV1ÃV&ǃ utF81ۉVCvt4VÃVà rVutVtutvVtut1ېVcCv1~<tF8e[^_ÉUVS]1u {PtsP{t&{\wu SW{\ruS ƃ{@t!s@tKz8t{8}s8{DtsD{HtsH{TtsTkt S[e[^ÉUWVSE }Et\rt 8t8u 8u1vG8~EG EGjXtn_;_v_t"S7w ]UW )_)_tw@wjEPj)GW)UEGGuG<EuF<u@xw@h@jwDGuG<G@@ @%GDjWi G8u~G +EPURwLlGLG EW ;GLt G8EWW> 8u?_wW_wjjj GL 8u<u G +EPURwLGLE+Ge[^_ÍvUjEPuuUÍvU WVS] u߅t19vN~jSEPuC< u9u1e[^_ÉU WVS} u]t{\wtrC8Sv;sv{tB{u'CHC s@h@jPZ=@uC@jS"C8tVWsLCL+Ce[^_ÍvUWSEPu S跁߰H~PSu1[_UE EjEPuuUÐUWU װHPRu}ÍvU WVS1]t{\wt C8vC?vE PSC8u uC81{u{8u{8w2@+st"s@VjsHƁ9uCHC C@t1{8tC8e[^_ÍvUS]u S"us@1{8tC8]U WVS] Eu~8~8~\wuku+^~DuJh@ FD1)@?؃PvDEPtb)ÅԋFu^|H~Xt*FFDjSv@耸|$^^u;^sMQk} T+^tI~Hu?h@NFH*@?؃PvHEP~)ÅԋFe[^_ÐUS]t{\rt^C8C<CCDjjj@CL{`tSjs`s@苷s@1]ÉUjju ÐUU1t z\ruB<ÐU WVS}] 1vW%PF~e[^_ÍvUVSuVÃVà VÃVuF8É؍e[^UVSuu@{\wu1jV3usLs@.ss@ V@e[^ÐU WVSU ]u6C8u TT:tst>u+C846{PtsP{Tʉ)PCPsTPD hTsPVsPCPe[^_ÐU帠TÉUWVSM] }u 1уT2Љ3 C2Љ3 C2Љ3 C2Љ3 C2Љ3 C2Љ3 C2Љ3 C2Љ3 CdtTv2Љ3 COu[^_ÐUEtxu <@@@P1Ƀz t jP@pd1US]t {t{$u 2vCxtSpc,ss(C$C1]UVS]u Et 81u}8t u C{ uC C({$uC$jjs(C ЉCC@C@ } ދC@ FvSYvCpPC1҃x uRS‹CPtSN1Se[^ÍvUuu juU WVS]{z;q1} uE EC8 L$ Yv{E ECKCPtC CXSB;Bv CXC{iE EKC8sNB))9t CXR uC C{E ESKCBC{E ESKCBC{E ESKCBC{`SKCBSBC0C CXC@uEPSCpEuC C@}uE E}E ESBPSrECx t C{E ESKCBC {tVE ESKCBC {t+E ESKCBC {uE`vE ESKCBSB;Bt CXC@C  e[^_ÍvU WVSu} ]]t~tF8t cEPWj;F0t CF0FHtKE)ǃSWFp.'F1e[^_ÍvU WVS}tu G8 t G@_u vGPt7w2:DYuBv9t1 v)ЉAKtvՉ+G_GPu"_wW_wG1e[^_ÍvUUtzt BxuBp>&Uuujjjju uÍvU WVS]}E Et6:u}$8t vtsC{ uC C({$uC$} uE } EߋEHw(}u"~} |}  }|}~ Xvhjs(C Љƃu 0vsEF~(F$HF,MNHFDHFLU % ZVPjv$s(C ЉF0jv$s(C ЉF8 jvDs(C ЉFu~u{ut6F3~3C E{ {*S(UeEeC|Hv E{dtM BEыE))ƒCqRS{dt%F0PSzF0%PSh F0{tV~u~u ;}u{u~t6F$v~u{lu{C|@WSYЉBwCtu ~umdukuS08vjjjS0u$SDC9vЉu 11ɋEЉUЋE;uv1v4E̅u9uw9]r] +}̋M؉ ƋMEЉEMeЋE EЋMeEЋUƉUÉ;Mwu;]vN1ɉu܉MU܋M}t؉EԉڅtJU؋UԋM؉Љ[^_ÐUSM] EU9|9s19w[UWVSE}u u1Z@M v9tAuu 12p@M A9uu1@ u։[^_ÍvUhu ukÐUWVSu} Cv8tAuF)É[^_ÐUE Mʁ`t[! tI tgu@t,jt@ t.Tt4tvc6vb.v-&vlvsvpvwv?@tr-@}wv-@ʁ@@t' t3vt@t-vxvSvs@ tr-@tw-@ʁt' t3vtt-vxvSvs@tr-@tw-@ʁt' t3vtt-vxvTvt@ @ÐU|WVS}u :vE]EP見EEЉEPSjy }WSjg]So jSuVSjf Ãt~uWjEPjjWj jVj&jEPh3lh6lh9l0jujjVSQÃu b8tjEPjjEPj jEPjtEx[^_ÐUlWVS] 1jhAl}AlfhuSScƃj/SNt7x9uClH9v8/t@؃P#p߀?EPWtupE%f=u;F ~8>)hSWPE%f=@uWElWPhS2 1;/u {tf߰ҍЍD@=vi?]uhClSePSe􋅜P} .􋅜Pi2􋅜P~􋅜P<1[^_UVSuQbÃt=j=SYt"j@PSƃS{vS{e[^ÐU WVS]} u=u H8u[9H}3HH8-u!Hxt,HH8-uHH`l$HH:tPVcu_=-u H8uH=Ht)>:t$=?t55halhc?x:tH8u{sH8uZH;HDH`l?>:u:=Ht55hlhck%vHH`lHe[^_ÐU WVS} ut5E8SEPU҃u~E<Nu1e[^_ÐU u)y~(het&A QED A1Ð$FreeBSD: src/lib/libc/i386/string/swab.S,v 1.5 1999/08/27 23:59:35 peter Exp $VWt$ |$L$tfffIutCffffffffffffffffffffffffIu_^Ð$FreeBSD: src/lib/libc/i386/sys/reboot.S,v 1.5 1999/08/27 23:59:43 peter Exp $锃7̀rϐ$FreeBSD: src/lib/libc/i386/sys/pipe.S,v 1.8 1999/08/27 23:59:42 peter Exp $6*̀rL$QÐ$FreeBSD: src/lib/libc/i386/sys/fork.S,v 1.8 1999/08/27 23:59:39 peter Exp $Ƃ̀rtÐUÐU WVS}u]3U :PWSufmP#‹M 99t )1e[^_ÉULWVSE8K vU:% 11E]z $mvM uV}WE xw$=t M AD|imP ]SuV} w$=t M AD`imP V ]SuV}  w@Gt=t иP=tPАvimPe EPURM y w$=t ] CvimP uV}WhkmE HlQ)RsURMQ] S=t CuV}WE Phpm+URMQhkm] s PvuV}WhymE p vURMQ] S=t uV}WE P=t KURMQhkm] sp1vuV}WhkmE H*)؍@)Ɖ)ڍR9u P}WEPh}mU B@PMQ]Shymu vv}WEPhymU J*)؍@)Ɖ)ڍR9u PN}WEPhkmU rp1vMQ]Shkmu F@PN}WEPhmgURMQ] { ~=t =t PuV}WE PhmURMQ] ShmkuV}WhkmE 0REԋu P;Phm]S} EPURSMQ]Su Vhm}WEPhmOURMQhkm] Cދ^)ù$Iэ )PMQ]Shmu FuPsCQ})ω$I)ЍH+vU ZlJMċruu?Qщ)Ѝ9u)Ѝ9u nmEM)$I)))ȍH$I))Љ)‰Љ)lj}9E9MKuCQщ)Ѝ9u)Ѝ9u EnEmu>Vu}WEPhkmQ5U:gu @UE;Pu@tf]M;Ys{ u@uMEu;FPvRN a4%rUz_e]M;YVvRjN a4%u>_UE;Pu@ti]M;Y; u@uMEu;FvRMva4%U:_]M;YSvRM a4%uKu~_tBPEU@MP%Eu%=uEu$E9EuU9UEiMM@u%=X w+=HDw=8tG&=PI=pw=hv=xyEP|u | EUJT)‰UE)9E MAUy NjMUP @M9tuP @EM9uUUE@AuVEPE@PURMQuV  %UMD]CUuTUE@EMAUu;tCMAUuVMQ%])É@PuVREP UE@M{MA%U\uVSQEPURMQ> <u@%=CKP%Ë%=uK뛍vEHUTEUEu+F UDEPURE@PMQuVEPMQ]ut1}uNE‹DT EUE+F uD1D1 MQuVE@PEPURMQu uVM]L\ 넸oe[^_ÍvUWVSE EEU;BtHMƋMVhVEPQU2>ƉuE }EEM;AtU;uuMME1ۃ u U@uuMAuEUX,} u M@u}u'E@u}uEUX0t(~&VMQVEPURM1mƃ Kہ}tAҁvRLHva4%uI_tD}t;UvRH a4%u}_uEҁvRG a4%u_uL}t<}t:UvRG a4%u }_tEE{w VEPVURMQE0!ƃ Ur4M9Mt,URMQPEPURM1EUEPMr1vE@e[^_UWVSE@0EU UEM;QtBEƋMVhVEPQU2iE }EEM;AtUE1ۃ u M@uuE@uEUX,} u M@u}u'E@u}uEUX0t'~%VMQVEPURM1ƃ Kہ}tAҁvREva4%uI_tD}t;UvRGE a4%u}_uEҁvRD a4%u_uL}t<}t:UvRD a4%u }_tEE{w VEPVURMQE0Yƃ UsMM;ut5E9Et-URMQPEPURM1EvEe[^_ÐU WVS]E EƋM}9vUBM%=Pwx=(qw/=== v=8w=0<v=@q=Hfi=xw;=`Hw=Xs>=h)=p!= w=p==t]=tn9EE}t }EE~Ev}Eyv}oEav}ZEL%}O}4E"A"E! Éс‰! ÄM)MƋM! É!с! É!сUBMT%=t'EH%NjE%=u!=v! ÉсUʋ}G%=t!! EE9E[^_U\WVSEȉEċUJ AMr$uBtE}tU EUM HM"vu uЉDEM9Ms vu~<~Dt}~Htwv<}GLT0UOD_H]}\8D;<u;]s2KJ:u9u:t )}9}ËU;]r9tnv]E9sSMQ<:uE);AL|މ׋ILt/C;]s'uV<:uE);FL|މ׋EHLu;]MUĉ urBB} z EBMJuFPFN}ĉG$uY }vEp$UrOMq$O H]s$N.uċV$V(F y׉~,F AЉF0F kAЉF4F qjP\REx@؋U+B@;EsEEMA]SuV}WEpPƃ tփ}u UzTMăyu#@P@PM]ĉC}ċ;XPw.UB@@ @C;XPvҋMyTu!]Cu}WEPVsS\UzX~8MăyuBX@PvL]ĉC}X~ Eăx7jURMQV]sSUà !j}WEPVUrR*à uwM;qv!}WEPFPqQAƃ uuJUċJAM]SuV}WEPUR ƃ }=MyT0}t#]ċC S)‹}W)ƉGG }vs;]siuċ;XPw.N}TTTTT T -vUDMDD C;]r]ă{tsKuă~tvK}w$K1e[^_ÉUWVSE E];]]U@%=Xtw =Ht^v=xtRvM@u%E7U‹@MJu%Eu%=uEU@%=PwU=(w==8w=0tlv=@=H=xi=`xw=Xt+j=h=p&MEDEvGMQSPuVEP{ ǃ URMQuVWEP] 9uC]]KSURWMQuV8 tSEPWURV }vEvGMQSPuVEP ǃ URMQuVWEP 9uC]]KuuuƃSURWVMQ t9u݅uuS]SPVuVEvGURSPMQuVW ǃ EPURMQWV< ;EučsuU@%\)CKMuP%Ë%=uKSEPWURMQ 9uS]SWuVEP} \U@%JE]+C D/vU@%JE]+C DD ];]hEe[^_ÐU,WVSU EU1EU9fM@u%=0w2=w =tZ= =(tf=w=`v= =E9EUE8vM9MEu%JE9E|U"AEP^]M;Yu A4Eu;F8x .@MU;Ju Bu];s> @UE;Pu@tf]M;Ys{ u@uMEu;FPvR5 a4%rUz_e]M;YVvRr5 a4%u>_UE;Pu@ti]M;Y; u@uMEu;FvR4va4%U:_]M;YSvR4 a4%uKu~_tBPEU@MP%Eu%=uEu$E9EuU9UEiMM@u%=X w+=HDw=8tG&=PI=pw=hv=xyEP|u | EUJT)‰UE)9E MAUy NjMUP @M9tuP @EM9uUUE@AuVEPE@PURMQuV  %UMD]CUuTUE@EMAUu;tCMAUuVMQ%])É@PuVREP UE@M{MA%U\uVSQEPURMQ> <u@%=CKP%Ë%=uK뛍vEHUTEUEu+F UDEPURE@PMQuVEPMQ]ut1}uNE‹DT EUE+F uD1D1 MQuVE@PEPURMQu uVM]L\ 넸oe[^_ÍvU,WVSEX(P,U@0EU UEE;PtRUUpjSVDEShSURPE0ËU0pSEPDEUUEUE;PtEUދ}HuEE11} u U@u}uE@u Up,} u U@u}u%E@uuNjUp0t'~%vSWSEPURE0à NށtB}UvR/va4%uG}_tA}t8UvR. a4%u}_u}t{UvR. a4%u}_uIt<}t8UvRR. a4%u }_t{wSWSUREPU2à E<ubU9UtZUpSEPUBUpEPS@B SUREPUREPU2?E UEPE<u1E@e[^_U,WVSEX(P4U@0EU UEE;PtRUUpjS*AEShSURPE0E0}EEU;BtUE1 u U@uuE@uEUp,} u U@u}u'E@u}uEUp0t(~&SEPSUREPU2à Nہ}tAҁvR,va4%uI_tD}t;UvR+ a4%u}_uEҁvR+ a4%u_uL}t<}t:UvRJ+ a4%u }_tEE{w SEPSUREPU2à E<tUUUދ}Ht]U9UtUpSEP1?UpEPS? SUREPUREPU2E zEe[^_ÐU WVS]E EU9uFu%=Pwx=(ew/=== v=8w=08zv=@=HZ\=xw;=`<w=Xk1=hq=pf=w=l==tY=tb9EE}t]}NE~E}~#}nE_}YUT Jv%ƋUr}+E>8"FE vD ׁ)4 M)}MD %vT D %v<uFuT%=tSEp%NjE%=u,vD ׁEUr%=tD EAU9U[^_ÉU WVSE} u]UH 8eu9EuA(t1y w%uRSVWQvRSVWQe[^_ÐU:-u9B;Cs1z]t+;Csz-u E-SE vEEM:MuEN fEfF=QtCE:Ev j S ]E9ËN ffFC9~qEPEP:~j Sl SEP(EPSËN ffFC~e[^_ÐU WVSu EEU;Bs:vRDva4%t M;ArƋE8+}Iv;t"WUR3腚u<uڅujMQx v{ C$+}(J=(Jt'WEP3u<t;uڃtjV 1CUe[^_ÉUS]vS, va4%t*vSyva4YvS  a4%t*vSrva4Ë]U WVS]3{E UUSEE]ES3{e[^_ÍvU WVSu] Fx8@tMӁvR  a4%t"S9tSVY'vPhV<;u FP4;@4e[^_U WVS]3{EECE^E@ @]@S3{e[^_ÍvU WVS]u }CE{~u}~B}u BM$lwE))CvVC)@PhxS-EPjFPSY C)PhSC)PVS jhSjCHPSo jhVC)@PhxSC)PhSM C)PVS"jhS* jCHPSjhS E@PFPS‹EHPj_vVC)@PhHSC)PhPSJvMQVSN‹EHPEPVS6‹MQGPRS vjS e[^_ÐUUzuE BHBH1ÐUWVS}GP U@ WJME;GGGMMzuPPGp‹GPGxuEP‹GPNURGp~‹GP1҃;U})GpЅ}BEAB;U|׋Wzt"ztMQjE)BP)vEj WWEZE}EBE}$M)CfCCC ؍e[^_ÐU WVSu UBP PUx19sˋF ff)FC9rE9u UBH [^_ÉUWVSu FfEUBP HʉU@E9Ef9Cu`9t\1;}sP"CЋ"F%9u0vG;}s'ҋ"Cȋ"F%9t;}t;]r;]sVURދUB+pe[^_UVSEu @H19svŠ"FtB9r1[^ÐUWVSE} @H119s7Š0"GtCB9r[^_U WVS] s}C{ u Pss C { uj ua!vEPC HPYSC De[^_ÉUÍvUÍvUVSuV Jȅ}B] 1ҋF9}v<t  vBF9|1[^ÉUWVSEP Z؅}B} u1ɋEP9}v:t1AEP9|[^_ÍvU WVSEU z8xuiv<>uUVE P)tAU R4UE @4>^'<;uSVU R@tE;C~F~e[^_ÍvU WVSu~]+] t;FPVBV EFЋM MQRPu^e[^_US]{u5C;C|C@@PSSC M M C]ÉU WVSu}~u^uu VF ]N 9<|FH9<|C ~كF)PN RDPuF Ue[^_UEM xuP % EÉUVS]u 9s}/Ps uj STC se[^ÍvUVS]u CFCPs NFuj SC Fe[^UWVSEx E1ҋME ;H }"Hv| tEBE ;P |11ҋM A@Y;%=Xwk= )w.=w===0ew=( v=H=xtiw/=hw=`^=pzL=w=t}3v=tn$uCEF=MQRSƒ%;%=`t'=t =L%=`t=uE ;pL~'MMpL~ P@vE P@M ;qL~ EEqL~ Q@vM Q@~v~oBlE ;pL~ MMpL~ P@vE P@~~B1}t0)M ;qL~EEqL~Q@M Q@1%=E xLu @@kvU BL@P M AE H(3vU J<]RL~;%=uAJe[^_U WVSu} u X11%v%=pw@=0w==(=XtY=h=w=xt4=t!==9~1EPRV.ƒ2%4%=`t'=t =%=`t=u}Bv%=`t =9~׋U :e[^_UVSEu xuUh FDtAFDvVDFLA~1;^L}F< VDFL)HC;^L|e[^U WVSEu xFLPH ǃuFHvFLP! FH1;^L}VHFL)HC;^L|FLX|? ;NL}3V<:t(VHFL)H;~ ;NL} F<:uIKy19vVHFL);~C9~;NL})VHFL);~A9;NL|;NL|WP e[^_UWVSE} 11xt1K_Ht Pt A9~I%=uɅtO([^_ÐUU }uBw   1UVS]s C)C} t1jVcF؍e[^ÉU WVS}E xu`ÃwY{tSuSЉDCjCDPu CCU v1e[^_ÉUWVS} E xu3Ãw,{w&u)SЉD v1[^_ÐUE xu@ux.w @ÐUM E xu*Bu"z.wB~9| D1UM E xuRBuJz.wDB|99|5ȅ}ATȅ}A$)t 1ÐUjjuuu uޜUjuuuuE PuÉU|WVSu ] }1EuEEShwjPYPEPPu64à tPS4Phwhc HQ0^Phwhc辜!xt?x=w'hph`M`h視DžvP蔏8#t ~tv8#uhwhc(vU0bPhxhc› 2􋵬V趕PjQWvvP諘 D􋍤Q1̎80u 賎8=u-(BPR ~rj"jjj.hvvu hhxhc迚6jvv j"jjj.hvv) hh*xhcs)0Pu6h8xhcH g1􋅬P<v}u(jh@xQDžvPjFjV誖hwjPV PPQSЃ9t.跌0Ph`xhc$ VI9}G~)hxhc􋵠V  hS茘։ 4 jjjSW赕0~uW貋8t)袋0Phxhc hxhc􋵠VP`PPƃat t#vbb1ۃuVX 􋍠QA }6ϊ0Ph yhc<Dž cE0=vh yhc}PMQV }PMQV  }PMQV jPV  t,0Pu6hLyhcX svt?jSP2 uFjSj  u+v􋍬Q -Pvtu6 􋅤P 􋍬Q轏 ,x[^_UjuÍvUWS] }1҉ ]tt8E]E8E]̸̸EBEBEB E胈/TvjjEP;ǃ|7fEPW萩t%UW h[_U,WVSu}1EEEPEPhZyu,tKvu}+1>]܅t&VEPM QssA tʋ[uۃu@+e[^_ÍvUjuuu EPÐU|WVSDž}t}tDž DžDž} uh\yh^y1ۅtFPEPEPEPEPS uS%1JvS%)=(Mu } DžEP;ǃwSGhoyS ƃw茎h\ySà Vp1EPP} xy]E%f=t yFvEPCP}y$}tE;Gt yvEty5S$x[^_ÉU1ɋEPtt HvH@PuuuQUjjuuE PuÍvUWVS}DžtDžp|P誂t Dž|xPEPURE PaÃuVv1Qh3PƅS j Sku0OyW^! u; ;#]vR(va4%t*vRra4C; t; t; t;u; t; uAC; t; tހ> t,> t'> t">tvC; t; t; t ;u<+t <-tUuDžp@u|jPPO~UREPb@u'|jPPOtJkEPURPE Pdt&GUREPPU R@p<+t <-tY~uDžtv~@u&|EPjFP%OtvFPURzvp~~@u#|EPjFPNtTFPURu6jvpt>E>tPEPЉtpt tWhPX[^_ÐU WVS} uSWV=uuߋMu&\vPhVWeƃu191^;tEP3EPu߿V[^_U WVS}} u}E`MEU`MP€R E}~؋E 8E4@M>Ã}tt;u5@MÃt;uhzÃt;tj/StzjS]Pƃ}EE4@MÃt;ujS]PƃE}~;v}t*jE P]Pƃj/E Pǃu=EjE P]P=ƃE}~E/u vG/tv+u ~VE P]PƄ3E} ?/u E E 8/tG?t?/uE 8u}+vU`P€RE}~؃}tEP&EU`MP`REP uA;]}0v`P€RYS C;]|1vE}~ e[^_ÉUShMh@v`MPhM0t=hzh@n`MPh@V C~ vC~@]U WVSE`ME=@udhzÃtD3u;߰Ѓ+=S@uv@zEPVEu E}u.V)1uEP }u&V=1|urEP"q}u&VQ1|uFEP6E}t }t}u:V=1uuEP" VEPv1e[^_ÉUlWVS}t7uztuzu1s=@ua5@ShzS9 EPS)1PS˂u%f=@t[^_$FreeBSD: src/lib/libc/i386/gen/setjmp.S,v 1.17.2.1 2000/05/16 20:43:21 jasone Exp $vL$APjjs L$T$QYai qyy1ËT$jBPj? T$D$JZbj rzju@L$ÐUjuu u^UjjujHÐU WVS]}u FЃ FFv$tz-tu_tp'tk+tf!ta(t\)tW,tR"tM;tH/tC?t>:t9@t4&t/=t*+t%%CVzzPjSAvV a4%u<u t/u t"u t t/Fv u"C\E@9\0 $z\Cn\Cr\Cb\Ca\Cv\Ct\Cf\Cs\C0CE<0C0v tt"\C0C$0C$0Z@u\C}MCv V^ a4%t^Cu?@-CC؍e[^_ÉU WVSM] }CPWPQTu)e[^_ÉU WVSMu ]}MvvFPWRQKwtjWPQ+Ee[^_ÐUVSutPV |"EPV:~uE%f= t 1jjjjht{à DžllBfDžl EBddBj\PRSC Ѓu*`hEN\qSCи@NSCЃEPV H[^ÐUpVSu h{ÃuXqSO@Nb;Fu>B@PhENBPEPh@N } u;EuF;EtSƒuS1e[^ÐU WVShDžu1`u1ې[#LOЅt;9v,A[HOPOu BA:u[LO!Cve[^_U WVS} t E }t UUEE8?1vHOPW u8POt}LOU v} tpvLOU _vHOW u4POt} t/LOE "}tvLOU  FFu "h|EPDǃ 1e[^_USj +Ãuh|jOvCCjPuh|j؋]ÐUS]SB9Cu/BCP3ouh|jӴvKE C]ÐUVSutA>t3} t 1;^sv4OC;^r6<V0e[^ÐU WVSu} 1;^s$W4 uC;^r1e[^_U$S]}hB]UBEPRt1'q8t E}t@]ÐUWVSE NjU3u"CVh؀jCP"1t+10Cj0CPCt{tC1e[^_ÐU0VSj+E PtEE ۀ vEU :rt:wuE xuEPf}1j EuuuEހEEEE|ƃt t1umub UR_rE 8ruhu9]{t1jsps }t_jjpN}tIExt@jp|p.}tjuepu udtvC@Pu5`EPhpj:mU :ruRu<ÃuCE PuÃu$UZrdd؍e[^ÐUWVSEEd]t 9Cuu `vP}jjWs/rƃu @e8t߃}u dUStEe[^_ÐUVSjjuLÃ|u SƃS-e[^U WVS}u 1CwVW PЃte[^_U|WVS]EPSl|}u}v}~GdAvjjSjjujE uҍv` tXtPf=tAf=t2f= t#f=tuЉPn\^~%= t)=t"f= tf=N%= t%=tf= tf=uMV%= t(=tf= t %CV%= t+=tf= t  v %vN%= t%=tf= tf=uJV%= t)=tf= t v%@V%= t'=tf= t D v v 1҉Ӌ~ȉuƉuuE] CCfCCE ;tp8ugvEtUFuO]  ;tA8t:PEEPmuڋFCFCFfCFCM} uuЋURYkEx[^_ÍvUU1Ɂ:ELFu B%=ufzu zȉU@WVS11DžhDždDž`DžXjjjEP-utGj4̿SUR4u*SRtlPMQPh} vÉP1RPEPjjPRjV u6XTt\hD|Dd6T1ft"vT|tB9|1RPEPjjdRj pXDž`U BBfBB` :t8uօ)j1RPMQ`)h\X\8?tm] \8_u@PWt3Wu.PTR\QS``~ ;t8u\~ `eht;`~2h@v@VP]SX9 ]XtdPXRgTtPQTPgu]`8[^_ÉUSM] CAC=tt,!=u vC $<uQ@C;E|A/CUƒzu Bt z$AC <wI[ÐU WVS} uMuFuFF EFF]t?9sGAt?\uAu\I@f9sAuf9sAuf|VP?VP [^_ÐU WVSu} f>{u,f~}u%f~u0E4vEPWVS0tj{Sb ÃuكWVe[^_ÍvUWVSM] 9tf9u1qf>tUf>[u.f>]tf>tf>]tf>uf>uvf>{uGvf>}utOf>uuf>uEPPU19[t ,tQ{t;}t:كf;]tf;tvf;]tf;uf;urnvGhtO`tf;,tU9sf9rFfN ffuEPPUK96E1[^_U WVSuf>~E@ EU |B^9s&f~tf~/tA9s f;tf;/uE 8uM0auhuEm.tQ~u'ePAvU RXu9HU ffA9s9u9sffufE e[^_ÍvUWVSE PhSURƋE ߃?*v[!uf>tj]FPuf[!f[!uf!شff>-u^]tf-شf]uNjU J f]8E H f?)U J 9tf*tf*fffE PPunE 9u,@ u‹B %=uE PUR%8vE @ u*ht j‹+PBBP1[^_UUE 02ÉUEf8tu PPP v1UlWVSu M}Evf9fWEPEPxt 1G tLf~/tEE%f=@t,f=u1WEPEPuE%f=@u f/fFGWEPtf9t+f9/t%f:}Eff:tf:/uۃ}u)މf9/#vff9/t WRQVEPe[^_UWVS}E fPUWURƃuHt:SEPU0SGЅuG t v1DžDžG @Wzvz.u Ef8.uh] fBf ffBfuUREPU R\u E f"vWURSEPuV҉ƒpG @tVG vVc[^_ÉU WVS} GtPw P7Åu u"~GH|vIy_UEf8t fu+EPƃtVEP>G4G1ue[^_ÐUWVS}] ;]L=?tX=*t=[tQ ;]tvEPSWt fu1fuvEfUftf;!ЉUtytvf;-u]=QtfM:UwBCf9v05uVPèCPV讨Evf;UuEf]uE9E(f9f?%e[^_U WVS}t;G_7Ntv;t 3swe[^_ÍvUSU] f:ufPR C @uPPC ЋÐU WVSu }SuG @uVSXvVPG$Ѝ[^_ÐU WVSu }Su\G @uVSXvVPG(Ѝ[^_ÐUUM v9tfu1UMU vBuÐUEEEEjjEPjjEP^ =(Pt5(Pu(PtVjjEP5(PjEP |U%,P5(P(P1UWV=(Puu1_4P;,Ps@5(P 4P=tɃ=0Pu5(P(Pe^_U WVSu=(Pu t{1C;,PsCV[(PPu;,Ps[5(P =0Pu5(P(P;,Pr1ve[^_ÍvU WVSu=(Pu tw1;,PsD(P9p$tC;,Ps/[9t$u;,Ps[5(P =0Pu5(P(P;,Pr1ve[^_ÍvUS]=(Ptu5(P(P0P4P]U=(Pt5(PK(P4PÐUÉUuOT1҃u‰ÐU,WVS}u EEEEjjEPEPjEP }s1rEE$1;]}Mv]jjEPVjEP } L8-t(vFPW'tC;]|Ke[^_ÐUWVS=Lu qt^=t ` PE2j]EPhP考]E@P~ u1 8+t8-uu=HPuhhmW  װHPhR` hs8 e[^_ÍvU,WVSu=Lu ZtE1Ѝx~ 1vW]EPVs]EGxPtà u3=HPu=HPthPVh Ãt 8+t8-u1ۃ=Tu91t e[^_ÉU0VSu=Luu1E3uj]EPEP谁]܍E@Pà uD=HPu=HPt)Vh^j]S]haSh à t 8+t8-u1ۃ=Tub1t e[^US]Pt j@!T]UjÉUP=LtLP@L=@Pt"@PP@@PDPHPÍvUSTztnjjjjSEL t #=uShju/1]ÉUVSLjURuP@ Ѓu3uE;v/P5~u 1v FCu$FCujVh(KjVh,K jVh0K4FCu8FCu<FCu@FCujVhDZKjhHV~e[^ÍvU(E4EEMAHPLjEPQRB Ѓu{EHPRu7=uhDuG5T =@PujjhXjj@PÐUWSUEPEPװHPRh5wA u]uuh%Eu] hEPgthEPOu1e[_ÉU WVSuE ]}8+8-SPh蚡EhEPà N(hEPÃF(u9u-hS1t6tF^N(hEPlÃZF(uSFN(hEP5Ã#F(uS}F N(hEPÃF( u^N( hEPÃF(uSRFN(hEPÃF)uSRF$N)hEP\ÃtNF(@u^N(@hEP5Ãt'~(|^N(hEPÃu1)F)u^ N)j v Åte[^_US]EPhSEu ,t#uEPhSEu1]ÐULWVSu ]=uh(@=uShShȁhP PPHPVP5= ti=ShȁhS PPHPVS5M=0<=4j:sDžƅ5jWPyCS u9ƅ2jWPxS M 8+t8-f.= 7 x@5VjPN uS PnÃC 8VC 0BtC C 8u=DPЍE @PV=DPhЍHB@Pjh8PRP@ Ѓ9% 8-x@5VjP2 uS PRÃC 8VC 0&tC C 8uDPЍA @PVlDPЍHB@Pjh8PRP@Ѓ:誵17:5uÃq؍[^_UWVSP=uh;=u=uR=t5EPEPhhV5;ǃ uX>EPEPhh5SV5 =ǃ S蓴t1vj:uÃtiE=DPt;EǰЍUHB@Pjh8PRP@ Ѓu:!:5uuEPTuuuٳe[^_ULWVSE8+Cǰuh 5aEx@=PPPP@ 8t{=DPt@EǰЍUHB@Pjh8PRP@ Ѓu PP@ 뜐hPPP@ 0h áPP@ LPPP1v=LPuEPLPEPEPEPu=ct5ge[^_ÐUpWS]߰t=\Pt5`PSGEPhف?} 68tE Euhhف*dPu=EvEPh5dPiQ5dPy }+u=t%=t=dPtw5dP%gvSt,߰P+`PSP蠯 =dPt5dP\PXPe[_ÐU=XPu1:XPPEXPPE XPP EXPXPÉUVS5TPt/6sus j S^uTP=`Pt5`P6`P5\PtSv6{ts{ts{ ts ߫Sӫu\Pe[^ÐU WVS]} ЍpCPZucC;,t;tPZtVE PW#u)9u 'C;,tPrZuEE9r1e[^_ÍvUSM] UE8~1mt)tVt't>JЅuPSh ShЅuPhQnhQ^]U,WVSu}}EP=Dž1hd0~PP߰HPStP5-ǃ u5EPǃmu&PEPuE PSDYEP} t"tE PuXttVu5}t"tEPtu 0PPPX1[^_ÉUWVSuTPtsVuuVÃt{t nCC EV8ME8(jҦÃjS<\P\PE h"EP5EE]h$EPƃtfF> t> th&Vot)H~4XS'UMSPVg EUE}f#h)EPsƃVx u}t*EE8 t8,t8 t}t E81e[^_ÍvU,WVSv==uh,PP}HPURh-5r* t/=fEPh6hPU 謥+uv;#C; t; tC; t; t ; t;u)C; t; t; ;j)@FPB VPWeB߰ЍpDž| uN|\u NDž DžDP苣~/PRPeRM VPSdtN5dPhWvtЍp DžB TPTPURpTu C=5dPhP)v5dPn1[^_ÐUS] =jjj7|*=~*S557} 1_=t5譢@P蓡tS55F7|9vE]ÐU=u#jh1}11=tUS]=uu S1}11;t؋]U=$u t=<uMjjju1M(8+uÃtSF] u11 D uCH5DD9u0PV ZDtHL@H;,ut91릀;t ; t; ut9D4e[^_UWS] =TuhT/ EPEP߰HPSu5T u]j u(t}w=uuhr~Eu7 Su(1e[_ÍvUWVS}=TuhTf=<uV=t5˘EPEPhhh<5T[ƃ u\<BEPEPhh5Sh<5T ƃ SOt<1v}vu 돍vuuh )} Eu j S蔀Eth W.e[^_ÐU WVSjhk]Ã; j EPS|ƒuE8txu~Evy*v@Sh{d9~jhrdځ%hUdjڃڃWRhĂjhXXЋUHE e[^_ÐUEEUBjjEPhjR.t тÐUWVS] tW j(讔ƃ1 EF ^$EF$tN$UR8=vMQ"PVjhقV=EYf@2EEE8vU:HP2VfC2USK@KF$PSV fC4 fufC4}t EC]C}u]UZ]EEM9`}t}~EPURV EjhقV9t?MHf@4 F$ujjhڂ+F}N$?wEPyURœ v跓V諓1e[^_ÐU WVSu] C&fC$GP{@Wv j/W+ƒ t09uzt&BװЍxPRC@P[ f{&FCCC,F e[^_UVSu>t9f{2|$vڋCuCÃRf{2}߃SҒ~tvf ~tv誒v蜒F$uGv't 1ۃv_tV[ VC1e[^ÉU WVS}?G%7V8fF8ujVW fF4UvusF4ffwejVW fF4f"G$jjhڂF }*FfF4N6vf~4tG$@tBF,;G t:F6tv =tw GfF4vtbG%tg%w Gt=jVW tRqFN6wt=F@Fvu*jWQGuG%1wGvPjf~2u,G$uws%VWf~8tf~8uXjVWfF4fu9G$u3jjhڂ*F }{FfF4N6fF8OFP$@|/uT F@$/BF&@PF@PRpP耏f~2u"VmvV$Gf~2uG$wQ$hvF6tFG$u0v 5$tv 0vv ՘+vF6u"G$uh܂#t O%~tfF47e[^_UUwE fP81vÉU WVS}] tt7G%f~4 u Ff~4twu O%f~2uF8/tG$tSW\GMvjjhڂƃ|.SW0GV" uVdGv1e[^_ÉUE$F Phڏu> EPhݏu>~uܿ u X !}tuܿ u X j:huU2t X EPhu@tU؉( EPhu@1҃tUԉ0 EPhur@1҃tUЉ, EPhuK@1҃tỦ4 EPhu=~hPuf *EPhu?1҃tUf EPhu?u, 0 Eģ8 EPh u?u8 4 E< EPh u\?tUfH EPhu1?tUfJ EPhu?1҃tUfL EPhu>1҃tUfN EPhu>1҃tUP EPhu>1҃tUT EPhuh> tU EPh!u>> tU $fE&E'fE)E*fE,E-fE/E0fE2EE` ÔEaEEEEEEEPEPu=u EEPEPud=ECEPEPuH=1҃tUSt,EPEPu!=uE1sC C EPEPu<tUS u0EPEPu^:~hPuC EEE}hfEf 3fE5E \E0EEEPEPuS<1҃tUE}4~ WEV WEVuq h[^_ÐU WVSu] ߃;t3Vt2;u=wuU%1u1) vVSe[^_ÐUt vB:uCtBIu[^ÐUWVSE} ÍpvCvA8t uv)[^_ÐUWVSu >=uFHEEPUR6lƒt5}=װH;EFBu`1;t vG;u ;`u-PRjÃ` @P4hÃtlPS5`)` `D}UB:t:=u+EUDPgU` u4E`BMEt:=u=BFBu1e[^_US]E`BuEPSjuЋ]ÐUj ju3Ð$FreeBSD: src/lib/libc/i386/string/strrchr.S,v 1.5 1999/08/27 23:59:35 peter Exp $ST$L$ 18uBu[Ð$FreeBSD: src/lib/libc/i386/string/rindex.S,v 1.5 1999/08/27 23:59:32 peter Exp $ST$L$ 18uBu[ÐUEA a4% %ÉUUv RA a4%%ÉUUv R@ a4% %ÉUUv R@ a40%ÍvUUv R^@ a4%@%ÉUUv R&@ a4%%ÉUUv R? a4%%ÉUE=wvU$%v1UEÐUUv R3 a4ÐUUv R薦 a4ÐUWVSE@(@,L u PUL C; t; tj$+NEuMQO *v1jEPS‹E;]t]uEPC; t; tjEPSƣ‹E;]t]u URDvC; t; tFwjEPS|‹EP ;]t}uMQJNu?NOWEP #v L u uNUEL MǁP $ aa1e[^_ÐUWVS]1} tCaL }%tu 1ɉ΋ ;M v}tEa@0Pv|$~Iv CI}tEaL P ! [^_ÉU WVSM] }aL #r !M;ru`aL p9ur7tJv E CJvaL ;pu 09usZѐaL ;pup9ur"aL ;pPp 9urCJv ECJt[^_ÐUE@(@,Paa1ÐUWVS]}1} t_]w;M vta@0Ix CIyt[^_ÍvUSUM E]f}v.Qt ttA t 1[ÐUWVSE Džl}tEDžTu~vuf"vEH7DžTTPIEUTH=DQ1ۃ=DQu9]EPWVEEpPSj # ЉH+EPMQWƃu$jpPj }!x8Nt n8u DQ=DQu DQE8/`ǰЋUDH9sr`H``HHH9`r4``/H)PEPQ @RIE"HI`H@DžPPRG@PD.@@EPh YU\MXDždvEP@P]Uh9\u 9X;Dr?PɉPQ@P@rljPD.G.G@Q[l7EPl0F/GDžLh9Uu+vlQkƃ9uvlPjƃ~.u~ t؋F%=.tɃF@PWFPEP@R t(Lu RLEvh9Me9]\F`+Udt @9| 9}~TX`+E\vu DžuC:CDžc;tC<:u+){:t :+)9)Nj)Í)‰)‰Su4w tEPGHvÉNj‰+PSP RPR 5=Cj=hPƒtEPF+HU 9v8+PuO KUu011VFЋ vW j<본[^_UWVSuEEǰHE]}UBUCHGjSWVF Ѓtt ( E8tE UBE8%e[^_ÐUVSu M;u9|t 9:t9u1,CA8tI9t9:u vA<|u뻍v[^UVSu] SVSe[^U=, t5, b, 4 ( 0 1ÍvUWVS=4 uE 4 =, u&h4 0 , =$ t=( u( 5$ ;P5, ƃur=, ti5, b, @ @l4 4 8u 1h4 0T , P&vDu0 %vR)va4%@u>:t>#t =0 t|\u0 v|\u0  v0 1CB:t ::t:\utn:CP5, 3ƃu6=, t-5, `, @ @tDpt(|t:tAB:t :|t::ujjPjE PPEPÍC wC[^_U WVSj=u uÃu sjd6ǃu KEd;?u BC$v;\C;:;<w$1tCIt ;/~;7~ZC2w?$@v 8v 0v (v vv:vCCBMu()FdPWǃEd>;:t;t;^C;:t ;B)K}t)PWfDžE8؍e[^_ÐU WVSj=u uÃu jdV5uܾ mvd.vCBOu")΃FdPQtǿd;:t;uB)Kt)PQtE؍e[^_ÉUSj#u uY…um:0uB:xt:XuB  1 vB< w  <w<w 9|ƋE1]ÉUVSu >:tF>:u^FPuU^e[^ÐUEt 8  v8 cUE< ÍvUS]EPu B0S:US]uu #0SvUEPuu uUVSu]=8 u jW5hG58 Gt(uS58 *hL58  u PhO58  =< tV< ЃV=UEPu uUVSu] =8 u j5hG58 tuS58 bhS58 P=< tV< ЃV==UE Pu蓻0@ÉUu ut0!ÍvUEPu uÉUS] =8 u j5hG58 t(uS58 zhL58 k uPhO58 I]UE PuÐUS]=8 u j5hG58 tu S58 hS58 ]ÐULWVSE DžDžDžDžDž vS!va4%@tb@MvR  a4%@t]KExPV_롐%u+Dž1x$XMyQV U9 Jv뜍v딍v뉃넍vy\CЉaDž`DžDžȹDžvDžȹ`[QvDSP>  1 DžȹDžtEUBftE]C}t EMAXWvEMA=NvSK a4%tDž`Dž ExPHT ueUvR a4%@t2MIy~븃EPSe럍vW$<u DžtY1vUZ;s&)RSt؅])K EPRjEMqu DžtM1ۍvU(t,CJtzڃRRtʅR`hEMqE(t3MIFtyӃQvRt9)؉Åvu Džte1ۍvUvR a4%@uCMItyQQtnE]sUvRS a4%@u-MIFtyQXQt)v Dž]CՃM$PuDžt?yvE`Q?ZU`Q~vݐ ~jѐ@t_%vtO9uEDžFMIy~v]S$Pu  }'9URFPv^xtXuNMQS|u{SjPщщƒu<tE]Cf1utE]CHvE]C)苕v DžMCՃ:w$?:@tg-vtW%=uAF]K{~vEPtNu q}mt39ÍvMQNP9wvNetEtEPSNURSuXjPtEMA8%tE]CEUB)苍(t[^_ÐU WVSE 8E ^uEU :E vEhEPUR*u E H+EEEUE E -t) t]E HvU ]t"=Qt9|WS}-E =QtGEU9|81VWb}SVQ EUF~̉:E v!e[^_U WVSE@U9B0uEh$ƅtvEp0@4ƒ@7OyU21KEx4?URp0&ƃt#7WVS)Ep0UP41ve[^_ÍvUVSu] =Du{=Hdt S腻C u2C tOC t"Su9c CCK {0tCC;C4|+St=Hdt S-o CLvc ߃{t;Cv@9u C)CC<C8C@C0C4SBCBC=Hdt S蹺e[^UVS]u 9sHr1"VsD$t CDsH1e[^UWVS}WIwj 7ƃtF)ËU O )_7_ECPPWO+EUWDP7R']WII uVwj 7kƃu_롐F+EÃSWu)EGDUR7P$'E)G7U GD E 1e[^_ÐUE@(0@,$aa1ÐUSM] UtQ9vvt/ tvtCtAvA%=uhtA$ACA%=u@A%=u0tA$ A$? ŠA$? ‰tA a@0[ÉUSMU E]tKv2t $ $? B$? Bt vtjvt<v#t$ $? Bt t&vtt tB t[ÐUVSu] 9u1'@ B hB h@ u)؍e[^ÐUt)}u#}WEPEPV u>t}t;t+}u%}WEPEPS ];t}t}t-}t'E;EuH}u EU)‰U>t;a>u;t E],>t;uU+Ev>u ;uEEUREPEe[^_ÐU,WVSEEUUEUvRva4%@uƀ}-uEEEvE}+u UUE}t}u'}0u!E8xt8XuURUEE}uE }0uEEEEEURPjjQEUEURPjj EܾEE©v=wuU%1tEnUvR_  a4%]ځvS+  a4%tCCEE;E}y}|;}wu;uw;uu;}uE;E~ E0vEEӋEËEEΉƃUUEU€}}3"v}tރ߃} tE}tEHU e[^_ÐU,WVSEEUUEUvR va4%@uƀ}-uEEEvE}+u UUE}t}u'}0u!E8xt8XuURUEE}uE }0uEEEE5|=}t 5t=xEURPWVqE܋EURPWVƉEEEE©&v=wuU%1tEnUvR  a4%]ځvSw  a4%tCCEE;E}|9}wu9uw9uu9}uE;E~ E7vEEeӋEEËEEEM]EUUUEU€}}7|EU}ttxEUV"}t ]U]} tE}tEHU EUe[^_ÐUVSu] SVtihCPV?$tPCPVKtuhE}EUURÃuhjGqE>t}u؍e[^_ÐU WVSuE UE@=@tSv߰HPSV$u%߰HU C UC#;u U$Ue[^_ÉUuuhjGÉU WVS] 违0װHPRjjhȘj ډװHPSjjhȘj V^ƒӉ߰HPRj jh˘jEPU WVSuE EVURte>;}vE8uVuubUt tQu VËE uh͘hc1avVjS19s(}t"jSURU҉E]F9suߋE8uU 2E Ee[^_ÉU WVS}] 19s'vjSEPU҃u1]F9rܸe[^_ÐU WVSuu u1=HdtEP{Ex}@u}LSE0WE)ރP8 t$=Hdt EP;E)1u } tUt]E PVS_ ރ>u}~u~u ~ >ub~u9Ft(>uF~u@~u:~ t49F t# EE U1Iv=,u1ۿ$Rv<8tURURU RV8ЃuC~1e[^_ÉUu3ÐU,WVSEE}u1E8t8ЍPMYt*;t%8tǰE;u܃UMTEH MeXtvEuEE‹ETRgEuE 1*uU:t*M12Vƃ vUEEMAUZtKE;t?8t/MAU4E3VKƃ;u‹UBMBtUBMAB A qZtAEtE;t.UBM4EEp 3V u;uҋUBMEe[^_ÍvU(UE MEAQu A  A EAEEEuQUWVS}u E w} u EgE쉅$UuU $EB1Dž(vE (uEXtV Q;tLU v1F9} 43tzu9u  G ;u((~EUB U ;B t$@@ !vUB$BUB $B l$P1Dž(vE (uEXE (uE@ $;B u5;lF;u;tz,lT 8ǂ,ǂ0fǂ4jhD9 PyF;uv((lu$P*$UR E P$[^_UVS]u tP{uHjt/@@@ @VSP 1e[^ÐUM쐋U :~*}<}ЋE}EЉ}F9|EE9E|E[^_ÍvUVSu1ۋF*=*t:*t @8t:u#uAt 8tA8uAut;u1v[^ÉUhh/ …u EÐU|WVSE URu 1vDžM;􍅬Pǃ􍅬PURQiuDž9uEPS?u E􍅬PZÃutt$t?QWLtE!U QWE PtUM TPWu E 2vRWjtME U싅EEBE Bu B  B JEDžMQRƒEPRRr QhP􋅘P$x[^_ÍvUlWVSEPu1C1􍅬P=ƒ}uEPR]vEPREP#u}M 􍅬Pƒt{]UEC1 EFWƒuEECE C CEDžEPSÃ&PhPe􋅠P;#؍[^_ÉUU 1uu juWt uPÐU1}u#ju uWt uPÐU<WVSEUEE } t(}tv}Džl DžxUBЉUB%Dž Dž փ ;1tU'PRVPURBà P҃t;vU}t}uHӁ~UE)EDž  UBDž` ` BDžDžw;kvRPVREPà R҃ލF ;VǃV VÃ3;vUK3t ~v}t } RhPVREP#à P҃;ӁN);"PRE} hWVPUR%à W;;nbPR);}7 t"n^RP~lRPVREP!à REEERE0kumU;Z ueu+E)=,ro r_SPV謵)ރ;tUvu~;s t{E8u?};B:URPUUEU E1[^_ÉULWVSDžDžDžDžE (uaDž}?t?.uG?uDž;}v.ЉEP ǃ<hPvjW ~v~uU}uUUR]SvURPP t*URSURPP 6_Dž9hWvjjUR ~p~uU}uUUR]SvURPW t*EPSURPP 6fUu=(| }o)bDžDžd=dAhWvj0UR ~p~uU}uUUR]SvURPW t*EPSURPP 6`y8=Ut t2*u#!vu )u8t u )@hWvjjUR7 ~p~uU}uUUR]SvURPWy t*EPS-URPP 6fu-tU=vtU& Et U1[^_ÐUU t>t Gt>EE@E EE@EE@uPuXÉU,WVS}uUf=(u }`M}1EEEU U1E|}9}3:؃A.A%A.AFO;u |ԡKOAcv fÍf0A v]fӍfЍ(ˆfЍЍf0AfӍЍf(€0A.AFO;u /SSBABAB A hPj jPBƃ TEP]Sj PVP` t9UUM MEUDžMQS1[^_ÍvU(u |}t (ÉU%(G ÐU WVS}u =R5R5 />>Åt9{utVs @ uك= u;>RR؍e[^_ÐU WVS} ]uf(u u `<(tSWEPh`跶hPjjjSWEPjÃ0%(t hzs`uEPSP,Ã}'(t h1`Fu Ffuw(t!F%PFPhFw-$Й`"`` `v؍[^_ÍvUWVSEEEEE(u6 u `vr`1E8t 8.uG@8u1;Ev x.؅u3URt URURURU RPE9r5EPUREPU RjEPY C`UEu=(|)1۾d=dvEPUREPU R6EP p8=`t t%"uEUBuEC)uC>ty}u/u )@u"EPUREPU RjEPL=}tU`'v}t`}t `e[^_ÍvUWVS]u (uu `(t%EPEPuPShݲ uF߰ЍpTNx <.uVSSZvR߰҉ЍD=~`5VSh$PeuuEPEPP[^_ÉU WVS])vh*ph6PAǃUjWYE!vRva4%@uF>ù>SP[FvR' a4%@uҀ>^~t4vRva4%@uC;u 0hVh ,W  ,.vWhP臷Wc 1[^_ÐUU h%PRuÐUWVSu}}t}w} mv=Hdt VzEV~0tF@9F0tv0F0FF^ }v\}taEPEPV Ãu E }} uZWE uDE;}t}WlE } u f^ FFCFFZˀ;}t}uf^ E F~t tF؉Fv~ vFL=Hdt VqyEe[^_ÐUlWVS}$u((uOu `8(t EPURE PURh@:  GG}f``fE$gG($gGg_ }Em} }tz}neEPEPVSU R D)ƃSEP薷SEP腷 UfB} }EPEPVSUR訵 ÃSj ,SEP SjSjUfB E 9|vCSEPȶSEP跶 Sj莶SEP蕶 }tEPURS]UfB )e[^_UWVSDžDžDžDž= u  =$u $(u (f=`u f`415f20jh0h ,% ohc.ƃhVhf5dhDž=t|=|sa= tXv> t> uDž%vt0DžDžF>t%=|s > uF>t> t > t> uhohq踰 ;#|jhRV t  8 t  u F> t> t> > hVhhhSƃ tDžjhQU+ t  v t  u F> t> t>J> AhVhj hƃ t5dhDž=t[=|sE> t> uDžvt0DžF>t=|rF>t > t> uDžvj hPvT t   t  u F> t> t>> >t8vRhva4%@FC;uȍ1DžDžj5hj S,PPSV ]zMzw" rrP) 1 󫋕zw#0rrP.0DDD jhPR; t  % XF> t> t>B> 9>;01vRva4%@u(F>t"Ph`Wu >;t>}PW^͈Ph`F/vRva4%@uF>t >;t>}PW躻tՌ"􋝌Qǂ:PWj ǂ     F/vRva4%@uF>t >;t>}‹&t/u+Wq,ƒ SWj(t|*1vy ٸCGv IvjhRNOu) t  uhPQhPwD~ ,%􋍠Q"=uChS u(j.SƃtFPhudhMft )$hƃthĚV (1h[^_U WVS}u (*VSh?vC; t; tjhSMuRCP:*$% (Ph DvjhSLMu5(uVWh 葠 (hAzBjhKSMu ) !j hQSLu )@C;t; t; u;e[^_ÍvUE|)%=tÉUjEPeh‹E3E1%ÐUEv@RÍvUVS]s{tsSu׍e[^UU:t.Ej EPRԹ}tE8u v1U|WVSUE}EEE]ECCC CCCC}u} u ,}u zzzzt EBtttEv߉{tZ{ tTEܛ=ܛ|DSE;u-xt'xt!CM;AuC ;AtE 7EE8}% =t=Iv= u {tcv{t {t{uB}{uCE PS Eߍu}Eܛ=ܛ.vߍuE8CU;tBt :CM;AtAt yC U;BtBt z{uMC{uExt@C{ uUztBC }uEPM QSEPE PURSE}}tMytE@EtxuEU:}7u}u E3KCtEPf  vEܛ=ܛߍuCU;C;BtBt zC M;AtAtstyui{uExt@C{ uUztBC EPM QEPSE}tUztMIMtyuEE81}tE}u}t EU1$E}t uMEx[^_ÐUVSu1ۋF=t:t @8t:u#uAt 8tA8uAut;u1v[^ÉUWVS$01ۃh&h.:vƿ(t9ƿ.t&ƿ4tƿ9uRUvƿ?tƿCuRlƿHu RCPz7&PhP诟P|RvC~[^_U WVS1EEUREPt 1v=$0u61ۿRv<:tSEPE PEP:Љƃu6]t#vjURSƃu[uᐋEU1C~}t ue[^_ÍvU,WVSu} EE]jjv]}T8t1vP_WVuكvttpPVoCt#vpPVSCu %jWszÃu EUb}t u؍e[^_ÐU#thPV3ÃthSV3ÃtDžCt;kv; t; uCCvރuhSS2ÃtCVU R2t;u}uEPEPjPt0UtQSR[uы[^_U,WVS} E]h&hVƃu QCtt[t{uEPWVu҃V)}tUE1ve[^_ÍvUt8tF8u 1EEF89~ulWƒtZFM4REPCu ELUt6sRBE؃u,[t{uE܋FM܃<uUE1}t ucE؍e[^_UWVSDžDž(uu `-v] sfC{hPjjjs sEPjƒ0WPRPƒ|Fu FfuFF%S^uaw4$dv`"`` `v`[^_ÍvUWVSE @EEEE(uu `@`1E8t 8.uG@8u1;Ev x.؅u'URtU RPSE9r(E PjUR5`EEu=(|)1۾d=dtzvU R6EP?8=`t t%"uEUBuEC)uC>tt}u#u )@uE PjURH9}t E`$}t`}t `e[^_ÍvUWVS]u (uu `uH߰ЍpwVt!N<.uVSS=ZvR߰҉ЍD=v`*VSh|PuP[^_ÐUE EUB EjjEPujRt1ÐU WVS}ƅuKvV;~tWstՃ{uV=1e[^_ÉU WVS}u \ÅtJ؃;t/v98u PvBAuS)8uԃS=1e[^_ÉULWVSEEEEEEEEEEEjjEPjjEPB }1vuE؃uԲẼRP赲E{jjEPEPjEP UUUԋM؉M9 vEЉEȀxxEĉB MUʋE܉D]ȃ`U#BtQ߃u5{u/SMM܍CRPQ=CE܋M̋EE܃?t H \uEU;RuFRP覱ÃtqRPMQS˶EP{] UEЋM9ME<U܍:PGÃu":+nv: ^vMQPEPr]1;u}%MMMDЋMDF;u|ދUMD}tEP诱}tUR蚱}t MQ腱Ee[^_ÉUugÐU WVS}=RE R5 Wv6Wt&^;t:3Wt ;u} t!E Pv t ƅu= uRRe[^_ÐU WS5RR%PhhPRR =RuhR6PP߰HPSh5RY4 tFu;PP߰HPSh5R4 t19hhu' ~[_ÍvU WS=RuhR55R5RhhSRR PP߰HPSh5R,3 u9hhu@ 藮1[_UVS=RuhR4t1=RuW=Rt5R8EPEPh@0hRh5R4ƃ uSRWvREPEPh@0hR5@0Sh5R56ƃ S軭tR10uuhhu! u{e[^ÍvU=RuhhR5RxE  ÍvU=Rt5RR ÐUVS=Rth`0Rt `0=Ruhh~Rt!5Rhh`0Yƃu1e>+u[j<tJ=Rth`0'=Rth`0 h`0P>#nhğV"ÃS5d4hǟV!ƃ/F> t> thʟV!ÃCV%l4p44h4ƃhǟS~!ÃtBCt<;t7; t/; t*5svhǟSB!ÃtCud4e[^ÐUj juÐUWVSuEFӁvR蕚 a4%@uҀ-u E+uF}t}u0u>xt>Xu ^E}uE 0uEE}tEE1uEU1EÉ©=wuU%1tnӁvR谙va4%ۉځvS|va4%tCC;E}=}| ;}wu;E~ EE}NJF€&}}}tG1" v}t߃} tE}tFU e[^_ÐUSMaD H }'B+v1;}; | ;J~@;|[ÐU WVS}1=Rt4RWu RvF#tǃhTVUÃthWV;ÃtCh?Vjʁ~Uvh?Vj褁Q) t$h?h?趀 v???P:?L:H:vC; t; t@:`:D:ƃhWS]ÃtACt;;t6; t.; t):shWS"ÃtCu`@:e[^ÍvU WVS}j"#^;tW3t-;uƅtE 9FuW6ue[^_ÉU WVS} ujÅt9suWEPC0u؍e[^_US(t(u uk~(]ÍvULWVSDžE?UU } t% }t$}Džl DžxUBЉUB%Dž@Dž փ ;VPUR0sà ҃kt;[}t }u?vӁ,?)‰UDž???Dž ? ??DžDž$;vVPUR rà 9҃ލF ;6VsǃVs }uuVs$vV|sÃ3;3t}t }h@hWVREP qà 8W҃!;=Ӂ);P賞?v} hWVREPpà |BWqt2;N;~vP)v;}tOWPEPPjPURhj%3 0wv t#Sv BPtURVPURnà !ott;u?+h@sӁ~gv)Sv5?t%5?h`j% ރ"v;?tu'?ǰ))Љ=`rShޠ?r,ij#hRSV_Y)ރ;t)Wh zu~;s Pt&~}uPh ?=?uM};iaURG?)) tPPh?v`? `1[^_ÐUEtu??v??Puu u-ÍvUWVS]u (u茶u `#tt(`9/5??j.S6uS"ƒt=wuU%v1 ڀ;{.h`SVu2hSh@{DDžDDž??@??? ?`$?? ?) tPPRt`?=wuU%1u:.uB:uӀz. =wvU$%v1tj:S}u ;:ڀ;{.h`SVthSh@yDDžDDž??@??? ?`$?? ?`=wvU$%1u ::t:.uB:u΀z.,hVWjS, |%WSPV*``Ph@1[^_ÐU WVS}(u/u`1}uI} uCj hXW@}tj hdW)}uE EE }t }t v/v;E t`1wv}t }t0vPGPGPGPhpP腞 P>%P>$%PhSRÃNy֡C ;vhPj jPƃ } VhvVh1vj PVPÃu1qECE C Ph`EPVR ?`$?}u)) t h`h`vpCC `؍[^_ÐU\WVSEM1E 9E}vЉU1;us:#9t(лvF9s#9uEf4x}u~ Dx9}}G;} |}t\] 9]}TvuNx@Mv6u f; ~& f f< ED]TNyEE 9E|[^_ÉU(u t}t (ÐU%(藱ÐUVSu];s~s~Vu 303)s1e[^ÉUEPu uÉUL WVS]u tShj#ك(Sfu $SBjjhHjR[ǃ  PsSh&W$ PQPh+W# S tWKyꋅ+P= Su St5 Sh2W#St4#Ph5W#= Sth:Wf#h=V@jjhHjPyZà uMW践<%u(~mu"FSRvsP_vSP_FuSjn_SYƅ uVW%W3+ S tT)‰Ћ)‰Dž@DžjPj轚=`ujS P5 S jPW5S`jRW5S`}vStmjjhBƃ|Sj>W u@))‰SDžODžjPVۙ V[^_U=St5SߕS`ÐUVS=Su/jjjSjjP =S=`EjEjhhRu]S}pjjV5S %`uPjhh_SEpjjV5Sd %`u5SߔSx[^ÍvUEUt SE Stu$SSt`ÍvU5ShS`ÉUU(St(SÐU WVS]u EFt7ЍxCu1:EuWVS\uK؍e[^_ÐUWVSE} " Btpv9u Bu@u1[^_ÐU WVS]} vRmƃa44GvRma49u Cu1QvRlmÃa4Wv RBm a4)É؍e[^_ÍvU WVS}]E EvvRlƃa44EEvRl a49tWvRlà a4EPv Rkla4)ÉCtOB1e[^_$FreeBSD: src/lib/libc/i386/string/strncmp.S,v 1.6 1999/08/27 23:59:35 peter Exp $SD$L$ T$@AJt}tm8ui@AJtnt^8uZ@AJt_tO8uK@AJtPt@8u<@AJtAt18u-@AJt2t"8u@AJt#t8u@AJtt8t )[1[$FreeBSD: src/lib/libc/i386/string/index.S,v 1.5 1999/08/27 23:59:30 peter Exp $vSD$L$ 8t@u1[ÐUVSuU ]u CFl vCB3hs] sOSFNpe[^UVSuFltXPjV؃ue[^ÐU WVSEpl1EPjt(E;F|^VWEP3܍vvՐe[^_U WVSu}~pt V~p~=1ɋFltv9P}P@uAVKjFÃu ^ktPE0Cu3-7Cu$j3؄ S̄PjRiCUCS PsEp=E 7sw*EFlC^lFpe[^_ÉU WVS]} uSM[ltOv3Wu;CuPsvn[utC UCBv1e[^_ÉUEtt.tt ʢ1Ң)!Ph#h`聏`ÉUWVSDžDžDžj/u lu ǃ=4StB9=4St:5,t&~`t VIVރu,=4S} t E }t}u 5,6tFPusuu4jt薁ƃjtVmF\FhDžPPv\stu f;FdtM~\WÃ~`tF`PPBЃFhF`WSSߋ ~hG~`t F`PPBF`F\juh>hNhS jSÃjS 8#DžDž jPS͎Nj9tSӊVhjFHPFIFHFLfFJfFXS芊,S{Fh@0~`t F`PPBF`F\jS$ƅDžjjPjhS/à u:== ==hW>)f=vCS@o0S0SDžKRPPhpURhjSЉǃ tECS@Fh uhhctOCS@Fh0S0SBPRcvCS@ЃjFHPjFIfFJFLfFX FhjAuFPc~`50S0SDžF\h hF\PRPjhFHPyF` uhN'Fhvjjv\=uh£|IDžS^Sv\ƅ PSv\kufFd/vF`PPBЃt V} $t ,5,} tU 21h[^_ÉUWVSuE~`tuEPEPv\t}u Ef;Fdt8^\S0ǃF`PPBЃ SWWU F`PPBЃF`F\FhVe[^_UjuÍvU WVS}1,tHCPW诜u,St ,S{ ދue[^_UEU@PyMU2Puj;MM1EPEPt v0SUEj ]SRE@`HE؋URPShXEPhPjEp`ЉÃ0t)hѣEp`v"uC cvu ÃuOEU@PxMU2Pux:MM EPEPuuEPhX|؍e[^_ÉUS]=`auhh`a1^t `a1]ÍvU6.& ÐUS]=`auEPut`ah`a't1h`a']ÐUU hBPRuxt 1U,WVSjEPEEUREP\u!URh|qE 1*}u"URh|qqE vUUtvE@PSmǃuWu.E8 E@P+mÃuSu.E EPh|p5(uSuWUR0ЉƋUE 0WmSm 8vEPh|pU EPh|kpEU e[^_ÐULWVS} ]$1=`buE`bj DlEt"DdP!lƃu0h`hc D`FXjEPUfzu(jEPU REPzf[UfBE@d~,uaMJ LPRAЃuF,F0PLPR abv~YMP PB ЃtA(Dž(@P(Pb(F,E9t WeF,[^_UEM PB,B0AB4AÐUEM @P8@8uRUÍvUSE]HE Ha$ATAH:A$CA(0"A$Q(S ACA AQ SAA CACAC vAXQXHtsAX@ht^QXBSvtFAX@ ;vt.QXB #vEEPS1Z}1]ÉUVSu^{t 3lS^u~tuE0jcvFP^LS@ЉFHFPxt S@ЃhHh|VuuFLPISGTSw G  t V{`t Wk`1e[^_ÐULWVSEXsLS0UE{u E U$CS E}u } u}$tEC$U ẼVsHC0PVB ЃtDFU RV@Ѓt-UP VPBЃtEPVU҃u{$uC$jVVlEPVVuC$Hv}u 18v} u}$uC$v44E܋GEGEEEVuUEPV[u{$tvU9UuC$PEP\{$ukEJ EPRAЃuC$C(#vuVU҃u {$uC$}t8EPVY#mrUP PB ЃC$e[^_ÍvUEM PB$B(AB,AÐUEM @PL@LuRUÍvUEMPE H&$BB BAB BBR QBBABAB A vB0vtvHB0teB@]tRB@Jt>B<6t*B<"EEPQ2}1ÐUVSu^{t 36fSPztCLPBЃS\V\e[^ÉUWVS}u 1nvEB=~=Z SZƃu 1SjVt_uhVwjxPMAQ PT`} PTptpPjjV@PH LjhPhx)‰`l|)ȉC}`C@B`}W)‰XXCO )ȉB} XB@BX\PTP| uTu DžHHt-Hu\E9t V$Z}G$8E9t VYE@$LP(SMQu }7cEtu-G(6G$E+UB(B$E([^_ÉU WVS} u~=VWE0]cÃuUB(B$v)߅ċEe[^_ÐU=hbuhXhbhbUWVSuEÅu 1vVEPVBЃu.Pu h`hS6߰Ѝ\@}E$vu >Phg+U)PS{uƃhSd߰Ѝ\ tVhvuhvuuhScuuhScEƀ ƀEe[^_ÍvUu uPhhcÍvUEv ~ DÍvUuPhhcXÉUVSuÅu 1v tuM5x5<P5TPVhhS[$5+PVhhS5ƃ ƃ؍e[^ÉUu4PhhcxÉUEv1ÐUu uÉUWVSu uMDž|u|PVEP^|jEPYv^u+DžlDžhDžpDž|Et.%Džl)DžhDžpDž|~^|fukDžxxPtPhPlPEPbà jpPhPlPEPà |||VEPÃfu]C8t)jtPhPlPEP E9t"|PVEP}8؍H[^_ÐU VSlbu$j@jÃu 1lb{<ux4 4K PS@C SCC lSujjC(PVfMSVPO C PV@OFV@ЉC:u~/t>/tj.V:t1u %>:uF>/ЉDžװ҉PS-ThǬS: VS:j.V7: t DžtjVdKjVvÃEPSE%f=hPS[ƃSZ RQ Sk} PWG RBGQ0G ?2KA4*r 2 ;GtU ;Jt)É؉)} WG@BG 91E ;p}+Ã􋕄RIFM ;q|1] ;s}0ځM ;A5F;q|1i} L􋅄PC{C;G F] ;s|1} ;w }$LF] ;s |} Ƅ>L1;7}GE L􋕄R+􋍄QC F] ;3|1BM Lt"B z vavB F} ;w|1E ;p}BM LtBzv BF} ;w|1h[^_ÍvUMAtƒЃ v,t -t+u߉ÍvUVS]ut= Ѓ w01҉TP9C Ѓ v;U| E 1[^ÉUS] hjEPut[U)9:uLAj;jEPQ\t(E+E9:u!AjQщU)Ѝ9Eu)Ѝ9Eu@)EE}2;VNE1ۋM ;Y}OPu L*C} ;_}$;8Puߋ8L؉EE1ۋE ;X}SU Pt L+vCM ;Y}$ PtߋL؉E1ۋ} ;_}E PEu UЉUMԉMv}; }9};E \u#1tXu E+EE+EM Lڋ}<8tUvUCE ;X|MًU LǂPǂT}߉`ǂdE@h8EU BBMىLǂPǂTE@} G }t UċMDG }  /] LEPURS")]C}tMQ}WS)E1e[^_US]Sh<tjSh]U=@|5@hbjthbHÉUWShSEÃu =@~Sh@c߰H=%@tSh@UE;u=bbiihh}E?hbSt,;:tjhbSthb:e[_ÍvU WVSE}Eb~t;F}1ҍP<t6B;V|1,;V}E;F|NvB;V};}2LWV3EP6SW CLSG(e[^_UVS]u 5VjS=e[^US]h`jS`]ÍvUVSu ]=DuDh`JSh`Vut C(S vC(e[^ÉUh`ju`ÐUS] Sjuh؋]ÐUh`u uG`U,WVSU1E IuP}썲LL};EuUB};D~E}tW~SA2@93u5u2B93u)E~!I:@9;u 2@93t؋EXIUU E.‰)ЉEU))E )yMQx vEQų )‹uV)))ЉF))EM$I)))ȉF}FEEM)Ћ}Dž}O+]؍؍؍G}GwuQ։U)))4EHyEEHEQmӉU)))))E}}E1ۋMu>QщU)Ѝ9Eu)Ѝ9Eu@M; }ǔu~NF;|MA)EAAu;4}E@}G G U W$[^_ÉUuPU8u EPuaPÉUSEM  9%1[ÐU WVS] M;| 3 Й։)Vue[^_ÉUSUM AZ)É؅u@AZ)É؅u2A Z )É؅u$AZ)É؅uAZ)É؅u)‰[ÐUWVSE}ԋu jMALؙ]u!!jVSqMуu E@UBz0t"Ѓ@9B0tr0/MA0E` ߋ})tPUu(U9zr :)z=HdMQEPPu$URE URPUrMуu"u=Hdt EPSUz0t"Ѓ@9B0tr0.MA0UBBb ߃=Hdt RT1x[^_ÐU WSE] EǰHEUBUE=Hdt SEPSMǃ=Hdt Se[_ÐUVSu] =Hdt SKyC;C|< tSV,ƃ=Hdt Sge[^ÐUVSEPu Tƃt+Åt huu趝} fC 1D7;Es5^SMQW']߃@;}v#}t E(+E e[^_ÍvUShPuu u=à t$uuPtÍvUShSuCtuuuu SÍvUVSu] 9s!@tсt t@9w1([^UEރ:w$ȭv1UE߃]%ÉUUBvB ÍvUWVSEEU9EEU2u%t =thzUE9t.vUPEvǃPFg 9uTKuՋE8u=>uE+E \U:u(2؃? Ћu ש(*vFXEE9E4諩e[^_US] jEPu1C@ ~CCjSEPg]ÉU WVSEu }xu]x uW@@ X;tA)B9} &)63X;ue[^_ÐUEM UttRQ"RQ藨/ÉUWVS}EEuEeShvƒt1괮B=wW}u/E}FE.u7}t1}t+FEGu}~UE v1e[^_ÉU,WVS]ECCC mEE8:uEU::s}}EE7vVW}uVЮWgt e) E܁}Ey:uGEE}u}]XC;EECU܈CEE-.s;uS}W**E0E+}t C;Ev ovECU܈C}t,+u9M)ى)ڋ}::C9~];]u"EU EBEBEB 1e[^_ÐU WVS߾fjSEPj؍e[^_ÐUEPuuEÍvUWVS]1藥jEPSj{8"tM9]tHE4]tM<.u t0GC6v Rx  a4%@u1v1vtt&tIwʁ}wEpvw}w}wEUCw}y}l}_EU ЋU ƃ} tU e[^_USMa< @ }'B+v1;}; | ;J~@;|[ÐUS]jEPX} tEE]ÐUE EUBEjjEPujR=<t1Ð+&v̀rÐUVSuUt$] CAuJtvAJuvJu[^ÐUWVS} u]tVtACtJuutAu)H[^_ÐUxt>Xu ^E}uE 0uE1uEU1EÉ©=wuU%1tnӁvRTva4%ۉځvS va4%tCC;E}=}| ;}wu;E~ EE}NJF€&}}j" }t߃} tE}tFU e[^_Ð$FreeBSD: src/lib/libc/i386/string/strchr.S,v 1.5 1999/08/27 23:59:33 peter Exp $SD$L$ 8t@u1[Ð$FreeBSD: src/lib/libc/i386/string/strcat.S,v 1.5 1999/08/27 23:59:33 peter Exp $W|$T$ W1OtLBAtBBAt8BAt.BAt$BAtBAtBAuX_Ð$FreeBSD: src/lib/libc/i386/string/bcmp.S,v 1.5 1999/08/27 23:59:29 peter Exp $WV|$ t$1L$u L$t@^_ÐUu ut1Uu ut1Uj@u u t v1Uj@u u^ t v1Uj@u u6 t v1UE hPPut 1UE hPPut 1UVSu] SVtACPV,t-CPV tC PV,t1e[^ÍvUVSu] SVt-CPVtCPVt1e[^ÍvUVSu] SVTtCPVht1e[^ÍvUVSu] SVtACPVt-CPVtCPVt1e[^ÍvUVSu] SV\tCPV4t1e[^ÍvUVSu] SVt-CPVtC PVt1e[^ÍvUVSu] SVtCPVDt1e[^ÍvUVSu] SV|tCPVt1e[^ÍvUVSu] SVttuCPVu1e[^UVSu] SVPtCPVt1e[^ÍvUVSu] SVth jCPVt1e[^ÍvUVSu] SV`th jCPVt1e[^ÍvUu ut1UVSu] SVXtCPVt1e[^ÍvUu ut1UVSu] jSV~tjCPVht1e[^ÍvUVSu] SV|t.tu"CPVCPVou1ve[^UVSu] SV,t-CPV,tC PV t1e[^ÍvUu ult1Uu uHt1UVSu] SVtJt"wt :t#2CPVCPVCPVu1ve[^UVSu] SVHtJt"wt :t#2CPV'CPV[CPVu1ve[^U WVS}uE uSt uGjV# ËU uhihc1u_SVatNCPVu t:CPV9t&C PV%tCPVv1e[^ÍvUUE w:$v8 0 ( @PÉUUE tu@PÉUVSu] Ftt"0~u fSv4Sv FCtwt ( t!FCFFC FCF Ce[^ÐUVSu] CCC t{uSuLC);S|SNu+1KB;St C t uS te[^ÐUSE] MUtt!RQS) vRQS}vӈ/1]ÉUWVSU} ]BPBPBPPhuV 9wVWms1e[^_ÍvUlWVS}1EEEUUME<M)ȹ)ȍ M E}~E]EEU<uu Ӿ Ft}t;u~]uE}~t}t;u~]u}t }E]E}t&M9M|E9E}9E:C}t:C}u\}uV}t}uJ}uAEЉ)¸.)PSE P:߰Ѝ\*EU4h̯S ÃE}?}tEEu:CCUЉ);EwRM QqE w1e[^_Ð$FreeBSD: src/lib/libc/i386/string/strcpy.S,v 1.5 1999/08/27 23:59:34 peter Exp $L$T$QtLBAtBBAt8BAt.BAt$BAtBAtBAuXU(UEu EPÉUÉUSM] t$r t5;vEQEPQB#AURQЅt E1]ÐUSM] t$r t5;vEQEPQB#AURQЅt E1]ÐUUM trt"(BQR@BQR 1UUM trt"(BQR@BQR 1USM] t$r t5;vEQEPQB#AURQЅt E1]ÐUSM] t$r t5;vEQEPQB#AURQЅt E1]ÐUVS]u tGrvFEUBCRS@Ѓt^CURS@NCURSЃt6CURSЅt#E1҉Ӊ1ɋE1 Ӊ^1e[^ÍvUVS]u tGrvFEUBCRS@Ѓt^CURS@NCURSЃt6CURSЅt#E1҉Ӊ1ɋE1 Ӊ^1e[^ÍvUSM] t$r t6;vEQEPQB"AURQЅt Ef1]ÐUSM] t$r t6;vEQEPQB"AURQЅt Ef1]ÐUSM] t$r t6;vEQEPQB"AURQЅt Ef1]ÐUSM] t$r t6;vEQEPQB"AURQЅt Ef1]ÐUS] EEPut E1]ÐUS] EEPut E1]ÐUSM] t,r tFKv;%EQEPQB*AURQЅt}%1]ÐUu uÉUVSuM UӃt )؉Ã>u.FRQV@ЃtRtUFShV@F>u/FRQV@ Ѓtt"FSh8UV@ >t1ve[^U WVS}uE VW6;uv?uwt rFtQgvu[u,VËE uhϯhc)VSWvtSE 1e[^_ÉUE hPPu-ÍvU WVSu} ]WVLt{t9t{u}u1$jEPVCvjURVUҍe[^_ÐU WVSuE t u߰HEEPV;E9Ew|UBt rBtNhtZu,RËE uhhc苉5EuSV\ SOE v1e[^_ÉUju u UhEfEfEEEEEEPu EP‹EUE@(@,Haa1ÐUEU} uta@0 tH ÉUM U}ttEtA vtÐUE9vMQSU҃ MQWU҃‹E} v؉E}uMMMEJv}&u]MNvu]MvCAN}}}E HEEEEmueE}uME}&u]vNvu]CANEE};}URWMуs|uqE}uEMMEH}&u]MNvu]MvCANU)UM)M;}EPURMуa;}wl}uMD}&uMvNvuMCANE}E)E}UUUE EE9E EEEЉ}ev}u+U Jv+E}%uvNvuCAN+};}vW+EPMуEEU9UiE EEEU+U+E9~Ѕ~E)ƒ}$]щNvƋ]ѐCANU+UE+E+E9vЅ~CU)ƒ}!ыNvƉщCAN+E;EvMQUR1uPMQE+E;EvU)‰U1uE e[^_UjuÍvUWVSEPEPx| E%f=@ttvjUR[DžEPS{E%f=@tsjjjP<Ij .et DžU tBPS{%1ZDž1Dž1IRPةc)؋NjPSWRsƃ~)눉M ] tV􋅘PjURY u+"r􋅌P}􋕜RnC Džv1;sDu:ft3WG)É9׃9t˃t F뵐h(9jVRDž1;t_tPCPT t {u E tF<u􋝈SH$vP0P+x x-CPC tBCe BE BR+ B33p􋅜P􋕘Rs p1h[^_U=u5EUBEjjEPhjRetÐUVS]sSa 3Cs SSF Ve[^ÐULWVS}w@o]} QEEuUЉUE EPbEԃu EEЃUREPU REPURE EEԉEEE E~EЉE؃$EċUԉỦ׋E9CvẼ$E̋U؉U+EEЉE܉EE9Et Ẽ$E̋E+EEЉE؋U9UX9EvEPURU҃EEuU܉UEEEuU؉UE}uC E}t/u;uVEPU҃;E]yvEEE;SURU҃;E]E9EEދU҉UE0;]r]+]9vSURU҃;E~ދU29EvqvE)1uE0SEPU҃;E]ދU29Ew/}U2SEPU҃;E]ދE9EwҋuUUE9EuY}t/vUE9ur퐋UEEuzUEG9urUEGMuV}t.UE9ur퐋UEEu"UEG9urUEGMuE9Es U9UE9Es8}tUEE9ErSUEGE9Er>vU9Us3}tUEE9ErUEGE9ErE؋UĉE؃EĀeU9U}ЋEԉEЉ}ԋE EEȉ$U9rE9Eu!E EPUREP~oUЉUԃEPA1e[^_ÍvUWVSEE}w1URMQEPURE $UUU v]MQEPSU)ډ]S]+EM D$UUʉMuU2PVMу ЉU;u{M<1 v};}s"U:PWMу%;EtӃJUM1+EE E}~E0F BKu+uu9rv}U<2;}seW+]SMу%;Et:U+EE E}~ڐ]F BKu+U9r};}r}~ +U]F BKu+U9r;urV+EPU҃~U+EUEEE Eu;ue[^_ÍvUWVSEEEU JUtG}vuvCANu+};}v+]WSU҃͋EEMue[^_Ð$FreeBSD: src/lib/libc/i386/string/strcmp.S,v 1.5 1999/08/27 23:59:33 peter Exp $D$T$@BtX8 uT@BtL8 uH@Bt@8 u<@Bt48 u0@Bt(8 u$@Bt8 u@Bt8 u @Bt8 t)ÐUVS]u EUM;tuQRPVS4ovtg{u5t:wf t4jh Pbk"t:wf qu1fSwI$@c , Kfe[^ÐUu uhÐU WVS}jvÅt85  sGCGC {@e[^_ÍvU WVSuU Ѓ@@vߋt]9SutTC ;FuC;Ft7jCRP6$CFFF;C }VwuSe[^_ÍvU WVS}1@@t!9zuRWӋ݉F~e[^_ÐUVS]C;C| CuUC{u!CuCPss 3C~'CK ufytASJs)։9~1AC9tyuCuȍe[^ÍvU WVS]#d0dSAd8tuc4c0t} Bt U E M1e[^_ÐU WVS}=u EPu &ƃt5jjWh,Ã|ڃtE9tNc1?tfp Et uH fx@@$@,H@(@ e[^_ÐUE URPjujhUS]SEt K]ÐUUB f t1 RÐUS]=Du<CC C uMC uFb vC t&Sc CCK 6{0t.C@9C0ts0WC0Ct36)KC =~Z_v~tFC4~t F ~tFE~t~t ~uFCMQSu1e[^_ÉUVS]E H{4@}P%)SDAK C$jP @PSO t QVS0S(uC,K@C<Й{@P(;C~CPS e[^ÉU WVS}E4jW-t ,YEtN04_uу?Wt}u XE1;}*8<0t40C;|܃tW}u1GXUe[^_ÐUSE} tX?tX4t+jjS,uӃSuǃ01]ÉU WVS}4aGj h ЉG@SW0 jjjV)ut6hSVt=t"9WO.W,Bv1ۍ8<2t"jjXP42WK uC~1[^_ÉUSEX}uuu jS Vǃ,]ÐUSEUXt$tnVǃ,GvuFVǃ,vuu uPSl]ÍvUSEX}vUǃ,/tju jS"Uǃ,]ÐU,WVSEp URUM MjjRQPmPEP&EuUUXMMIEXUE9U.vf{v5)9EuuMy׋MHsEf{uAjEPPUR&EX MEEp f{URMQEPURMQTE EEEPURTfju%PMQl%E~XEEUr E9E} w/} r)URMQEPURHD E`;Ub,v} r,} t} vMavEXUf|SwjMQRPEPCTUDSMAMECDK)‹MQEPURMQh=uEPURMQEP\CtXUbSMQEPUR$=t02vMaE` Ub1e[^_ÍvU WVSEUpt*t%t ORdž,$|udž$dž(dž 1 u^$ Cdž(;^(w#jjSV#ƒt zf?t͉$;^(~dž$A x(f|GuA=C=A>CEA?A@EUBA@BAABABEAC1ҍyD]vECDDCDECDFEDGVfEEQEQB~[^_ÐUWVSu1Lhhxt#x=x~ttth Džt|uDž|xb}uEb}uNLECDž|xbDžlDžhLUDžtEbDžx}t }h$à 1ǃEǃ|Eǃj$訾Ɖso1 󫋅L9t ^F(F@<F F F7FWF0)}tWE  tt uU RMQ*/-vE  jj0oEPJORE EjEPw'}b1u  EddBEBEBEdEE``BEBEBE`EE\\BEBEBE\EEXXBEBEBEXEETTBEBEBETEEPPBEBEBEPE}b1}U=EE_xE EEdxu0Ex=w Džxxv Džxhu  ǃǃ xlt*xI#ltlBl!‰lx9lsllO1Nj1tffw fǃWjI uSh#h 3SJStRM t!@E@t!}}"[vCvCOt7{tstS18[^_ÐU WVS}jj7RJƃt jV?C81CEP7uIƃt|EP7^IÃte}u_CCfCfCC jVjV7K jS7K1e[^_ÍvU0VS1BJuh蝻Ã؅uPhhVB ]S EPSjIV à t VNjEPjmI؍[^ÐUtt  1USEX{tjs3JC u vwA]ÐU WVSEX{tjs3\JC}t+A}EPu S<ƃu[}uj63J@jPujjVSr?ǃ !@tj63ICe[^_ÐU|WVSEU } uRUӋEUBBCBCECCEUBCBCBCECCEUBCBC BC EC C EUBC BC BCECCfEECECCfEECECCfEC 1f;u.CEUUEEU܉U}֍ EfEEDSEDSU EUBBABAEAEUBBABAEAt?AE܋UBBABAE܈AE؊GGAGAE؈AfFf;uCQC @1f;u4CEUЉUẺEUȉU}ĉ֍ EfE֊E׈DSEֈDSU EЋUBBABAEЈAE̋UBBABAËAAtDEȋE@E@AE@AEȈAEĊGGAGAEĈAtDEUBBABAEAEUBBABAEAfFf;ux[^_ÉU|WVSEU } uRCfEC 1f;u0CEUUMMEE}ƋUB EUBBABAEAEUBBABAEAt?AEUBBABAEAEGGAGAEA֋MQfEEDSEDSfFf;uCQC @1f;u4CEUUMMEE}܉ƋUB EUBBABAEAEUBBABAEAAtDEE@E@AE@AEAE܊GGAGAE܈AtDE؍U؊BBABAE؈AEԍUԊBBABAEԈA֋MQfEҊEӈDSE҈DSfFf;uE̍ŮBBCBCËCCEȍUȊBCBCBCEȈCCEčUĊBCBC BC EĈC C EUBC BC BCECCfEECECCfEECECx[^_U$SMEUBBABAEAYAEUBABCBCECYAEUBABCBCECY A EUBA BCBCECYAEUBABCBCECYAEUBABCBCEC[U WVS}w~tjv60BFjW6B~tv8F Ft%dždžt%dždžV輯W賯 S蛹1҅tЍe[^_ÉUSEX{tjs3AC} t7C t11 tS"t3DAu ]U VSujj6w>ÃtZEb1EEEE %EjEPS;jS6?@1ve[^鷹v\̀rÐUdSMU Ӆt S}EfEfEMMUUPuEP2F…tEЋ]ÐUu jEPutUÐUjjEPuvtUÉUS]jjjSN1҅tډЋ]ÍvUS]jjjS&1҅tډЋ]ÍvUuÐUlWVSu} t}t5;tC;u+]]K9rA;Xuotfgfff)Ѝ)щʀ0K;Xu>u33ONI)AGAAK;Xtȍ{} u }tMvK9vC;/uEPVB=/ E%f=@t4} tJhh VWU |AˍvaÍv48tN}thVP=tӍvEPVo<tG48%X;tK;]tF;Zu aCv=wuU%1^;zM1e[^_ÐUWVS}jEP+=?EjjhBà |jtEPSSE|Džxw 0_ˈwxw|GG02G 0xx~X[^_U=u+1v@=~hÍvUWVS}u =u 1ۍvȈEؙE:C~[^_ÉUS=u       É[ÐUM19s v@9rÐUVSu1ۋM Itۍ1Fs%))É[^ÍvUSM] 1i1}t6  t-EPVE PW ÃujV70UB ËU ZFV)ЍS9s,EPSEPURE PVWD -LFf9Es E)RDFPP+fFMҍVF)fFfJ^U BUBËCU r2S+E XUr2S+G($ <uG;uEf9GrfGuZ~u,UFH9uALJUf"~u"f}uLJfLJjV7/} uUBP0W! 1e[^_U WVS]} j3 -ƃuǃvsfC E@ G$VN)ʃ9u?~u}S AH9unCPWS%ƒ|WtfC C f0Cxu;f{ u4CPWS%ƒfǃЋECǃjV3=.1e[^_ÐUVSEuX{tjs3 .C t$t tu SdsFFt vj63j+EtE@uCPEPSjFPujSƋUBuuRSt2-%Pu3-#u e[^UWVS}jE 07,EPEPWc 0U;EjV7{,EHvj37:*ƃSFH9jV7-,EG,9t1ۅumrYUFP\0f@jV7+jS7)ƃ t2fEmsjV7+jUR7f)ƃ u9v[Cf]UfPBU;FEU;jV7+EPEPW s0AjV7*EGuWEP) jWE0p(vESG9_SG9u0'vCPWE PEPƃtwf{uECfKftSE PEP+tGtLjWE0'}k1HvjWE0'.jWE0'WEP$e[^_ÍvU WVSVj6E0%ÃvfuESB<GtG PUR!ƃDCu];u fCUfCC SEPSURk"v7 C؃)RPP!fsUCuWEPEPEPQ]ScWEPEPEPVEP ƅ)ECFf9Es'%U)PЍDFPЍDFPfFEUԋB tgw t vfMVF)fFfJEB0WMQSVUԋCMVF)fFfJEB0}u M܋vEЉUԋE܊H CEЅuU܋PE܃ PSMA%q ]S f}tEDF0vEPTPEP U؋CMVF)fFfJEB0MQ UԋC vf}tEDF0vEPTPMACMVF)fFfJEB0UBC ov}M 9u9] }uuQS]vuuE PUR t}jMQ]3jEP3 E,U9tv1ۅvjuM1|ju]3j1ejEPU2QjMQ]3> juE0)juU2 MqƲe[^_ÐU WVSEPEPƃu 1qvMfFUfF] CFFC F {u:]] C9u#KfFEfU]3E蛇ǃujVU221v] GCGfGUfGC G {t?js2ÃuW"1pCjSU2u]SVWE PURà EWU R9u] W轇U EE0؍e[^_ÉUWVS}EPW?ƃtEPW)Ãu1jEEFCCFfCfFfCfFU B C F uuSVRW‹E0EЍe[^_ÉU WVS] }UfCfCC4G tGvW{FCfCfCC4E@ tBEP8UFfCc K jSE01e[^_ÍvU WVSu UMfFfFF0CF tuUBNj F)fFfFF0C7G PSGtbw MQ uKiEP‹ F)fFfFF0QRSkUC vfFf N jVM11e[^_UuPAwv36xF3C P66G GC }Ct.EPUREP PEPuM} u E!@tzC@U;Bv>:u PvC@PE0xuPUC@Bs PU2lCUBUUvCUB É1e[^_UVSuEfxuyuA u v1A t@QB@uv@QB@tX P UEt6PPEPSV t vEEPu Ѝe[^ÉUWVSu} W;VvVr:t)‰ACsGv)Ɖ[^_ÉUWVS}E P;WvWE r:tCAFsGU ;Bs@[^_ÐUWVS} ]ujWEPjGPEPE U;Es;>uuWtu65u |vEUEU> ߋFEjuE0ƃt];]v]SFPWjVU2|E)؉E u1e[^_ÍvUWVSE UMEUx MM]EPEPÃu ECCC fCfCu9vVURCP@}tMAjQE0 U)]jSM11e[^_ÍvUVSu] jSEPjSEP ju6ƒu \vB tjR6 Bvju6ƒt)]BERV9]w1e[^$NetBSD: bcopy.S,v 1.6 1996/11/12 00:50:06 jtc Exp $vVW|$ t$L$)9rL$D$ _^ONL$D$ _^ÐUMU BB jR1ÉUVS]u t9j3ƒtB  V3e[^ÐUlWVS} uEPWuE%f=tF1dh(jÃt[1ҐDDD B~E 1RPEЋURP؉e[^_USEU M] $[ÍvUS]uh`hcsSgu1YQE AAHTQ9RuJH YCA 9u CHKA]ÍvU WVSU E;r-1v^CUvE PUR8ÃCHUL9 u CA CB9KtSK9IuYvXE9Cu C UB SC B E9C _S CBUSBC 9u UBXEXK URÃE U1jWVz99EsyU;t{OE CCE HULK9IuYvXECUBC 9u UBXEXtss$UЋCe[^_ÍvUE `UP1ÐUS]C9Xu @ C P@ B 9X u @vP @BQm 9uSm1]ÍvUVSu9t"vCtSV(t"[9u1҅tЍe[^ÍvUVSu; 9CCtSVCHL9 u CA CB9Kt;S9su C F vSC B 9s tS CBBvC8Ɖ[9iPkÅtCC1e[^ÍvU WVS} tE pp$ ЃU B1jVSw9u39u/E pv;u U b1e[^_ÍvUM AU‹9t 9Ht9u1Ðvv_̀rÐUVSu uVjÃt VS]؍e[^$FreeBSD: src/lib/libc/i386/string/bzero.S,v 1.5 1999/08/27 23:59:30 peter Exp $vWS|$ L$1~ڃ)Ӊك[_ÐUEPu uÐUS] {tSu&CC C1]ÉUlWVS}G $fEGfEGEċG,EԍEEEEEuu uVDÃ|VTtE@tO @؍[^_ÉUVSMEU] t txv w K0 }K%)щʀ0gfffK)Ѝ)щʀ0u=K$0u}t(<0t$K0Kȃu lv[^ÉU WVS]u MEUυwRURPQS t#vwu wOjj VS'0v(Ojj VS'0jj VS'É֍vOjj VST0jj VSÉ։ uOvO$0 u}t0?0t+O0%O؃ u jve[^_ÉULWVS=HdtEPOUB tzu5MQNt"=Hdt EP-vUB f uDfz|==Hdt RMQE PURUDžM Dž$DžEuuEEDž  t%%t t%u⋝+ tLS ^]E}~EPMQuDžDžDžDžƅX$ıuƅ 뵍v1ۋ ƒЃ w\B BЃ v⋅ 8$$u)0$$PQE Pj$t$EUR AAv$t$EMIvƅ+z*1ۋ ƒЃ w!v\B BЃ v⋅ 8$uw$u)0$$PQE P$t$ vEUZ A5$t$EMY[DžL1ۋ&\BЋ ȃЃ vԉDž 1ۉ\BЋ ȃЃ vԃ$uC$0$$PRM QpxV@Jt 4&P $t$EMA>  tw$t*$H!EUBRt $uIf@t2$t$/EMI9$t$EMI} ƅ-  u Džu Džt@$t$(ݝVE Miݝ>$t$ݝEE@ݝt+ܝEuƅ-Dž  tDž   PRPPQP gt Gu=~9~Egue DžgeAQEP>  Vfu;~&u tW|9K@; |Njt%" + Guƅ-i tI$t$vEUBHtE$t$vEMAv@tE$t$vEMAf2$t$EUBv t[$t.$HvEUBRt9$t$EMI@tF$t!$[EEPAv$t$EE@$t$EMIDž߀Džx$t$ EMI u Dž |>Pj Rt+ ; Ѝx tZ$t-$HEUBRt9$t$EMI@tF$t!$[EEPAv$t$EE@ Dž Dž t[$t.$HvEUBRt9$t$EMI@tF$t!$[EEPAv$t$EE@t& t t tƅ|M  tK u twQPR PQR =vu t1QPR PR + x1g P Pƅ9}tt9}+~EaFEE}~EPMQua^]E}~EPEPbutFEEtcƅ0ff FEE}~EPMQUu%=+~~~CaFEE}~EPEPpua^]E}~EPUR2u)~EaFEE}~EPMQ_ua^]E}~EPEP!uu ~}fe݅D@; |!uFEFEE}~EPMQsu K~DaFEE}~EPEP#ua^]E}EPURiFEE}~EPMQ'uۅ~FvaFEE}~EPEPSua^]E}~EPURu  F EY;   F EE}~EPMQ!u )Å~FvaFEE}~EPEPGua^]E}~EPUR u±FEHv FEE}~EPMQu ±FEE}~EPURXu  )‰V )E $  @.FEE}~EPEP:u݅E@t?  JVEH EE}EPMQ K~CaFEE}~EPEPua^]E}~IEPUR) FEE}~EPEP/uUNME}~EPEPsu+~u~DaFEE}~EPMQua^]E}~EPEPu]}tEPMQu4Euy}tEPEPuEUB @t Dž=HdtMQ$t09$t$L[^_ÍvU,WVSEEUUEEE@M EE%uE1MEBX$(1ҋu TPFЃ v>$];]|EPEPS:EC;]~]]jEE*1ҋuvTPFЃ v>$u=];]|EPEPSEC;]~]]Fuv;]|EPEPSEC;]]BЃ MEBЃ v1ɉLBЋEEBЃ v$@t og;]|EPEPSEv t%;]|EPEPSE t(;]|EPEPSEv@t(;]|EPEPSZEWv;]|EPEPS2E/vt(;]|EPEPSEv;]|EPEPSE v t(;]|EPEPSE vt(;]|EPEPSzE wv@t(;]|EPEPSJEGv;]|EPEPS"Ev t%;]|EPEPSE t(;]|EPEPSEv@;]|EPEPSEv;]|EPEPSfEcv;]|EPEPS>E;v t%;]|EPEPS E t(;]|EPEPSEv@;]|EPEPSEv t$;]|EPEPSzE zt$;]|EPEPSNEN@t$;]|EPEPS"E";]|EPEPSEC;]&]}~UPEMU;M~Ewj$UE U NvUE U :vUE U &vUE U vUE U A;M~}tE9Et uEe[^_ÍvU WVSu }Eۃ?uSD7PEPI SVV)PjRHIe[^_ÉUWVS]M}u fu vetEuC]EuE]-vEPEPWSRu ugtGuEtK fu90uEE@t@ED@uU E0E9UrE$U)ʉȍe[^_ÉU<WVS}] Ew}G-wv+F ~AIgfff)Ѝ)Ӊڀ0à I09sAF9r 0F0F)[^_UWVS}E xG tuW*U U MrEG tavEEUrEtvPMQwG,ЉÃj])ދU B)؉BuNvG *M MEpEtG %Bf=BuB9ws=W)ӍOOPRGÉ_G t(9s~SEP7F)_xv;Gv-9v)SURPFW - }Dv_9r!SMQwG,ЉÃTSEP7F)_])ދU B)؉BEEuEM MEpEt}u1Vj UR!ƒt EH)‰UNMEU9vG_Ë;Gv'9~#SURPEW, uw>_9|SMQwG,ЉÃ~TӃSEP7E)_)]uW+u"E])ދU B)؉B1 O @e[^_ÐUEPEURPEU RP,EUÐUjEURPEU RPx,ÐUU1Bf%=uBu}tUE1ҋ@%=u }ЉÐUVSuu V@Ãu t V@؍e[^Ð$FreeBSD: src/lib/libc/i386/string/memchr.S,v 1.8 1999/08/27 23:59:31 peter Exp $W|$D$ L$uG_Ð1_Ð$NetBSD: bcopy.S,v 1.6 1996/11/12 00:50:06 jtc Exp $vVWt$ |$L$)9rL$_^ONL$_^ÐUVSu @t $vP=‰rZBB Ѝe[^US]tK@[ÍvU WVSuFE^1M ME ЉUȉG;}|ɅtRM;N|7F@PËFK V PRQPB VLލFMU UBVe[^_ÐU WVS]} M98)1Ҹ~ B9R‹EBB  ~$ PCj RƒF9|C! vPCj RƒF;u|Ѝe[^_UU1uuuu|@@u ÉUMt+t1htUvF1fuuuuu@u vUS]j(X@]ÐU]Eu@ E @]EvE @UUu]؍]C%E=ukE]CuuME]C%=|v)}u }iUBE MAPo}@wL]È@s;E@}fUf fUm]EmEEUu]؃uuME]EX9]uE}fMf fMm]UmUEm]u}u @t*EHE"PEEXEEPUR MQW Ep@EUBM PRQu/ EPEPuugEjE }|11ủuMىE1}|}+u؉}ЋE؉UJ} 3 6+EǍ09~;U~UЅ~)))UЅ~7QMQEEPUR@à MQ]~WEPE}~URMQE~VEPaE}~URMQEEEPURsNjw G MQWƒ -u}uE@؃URMQ EPUR W} tEM E}th[^_U,WVSE @EU9B} 1v] ]MEÉ]u<0 A1EEE]E%E] EE%)ЋU E)EUfFf]9]v?u#uvM9v?tEUB] SEP`EEEu] ]]E%] E%)ЋU E)EUfFf]9]vuE}ԋuEE}tl}$}tU3U96+EE,v]K9|) )]]1EĉEȅ} )EUUUjE~}~EE9~}ȋU)U))U}~h}tL~4VEPCEURPkà UR]])t#SuVvEPUREjE}~uVPE}2}u%E@u@tEEEE}t+uVJ4U U)E vuFuȃet +EȉEȃ}~EEEE}EUUU}~uVEPE}~URuVE}tREPURq};Mjj uVE}tjj EPkEUUă}]}~W}|+jjuV:EPEP ؋U҉U؍vu1EEv} ~WEPEUU}tGr@EuFM PRQs jEPnEEgvjj URlEu9uujj VQEE+jj EP4Ejj UR!E EȃuVEP`0ẼURuVà EPURǃ uWVWu}uEu}9tw~E̊E~|uZ}uTEuN~"}uhÃHO;F> $`@d@dv-@dDdDd   z nbVJ>2&5h 5CE}>= t&EEEj EP=t =t  jjjhjhj% uh@?j =@du @d%@d jM(تe[^_ÉU WVSE]1 v t29Yruy9tABQMvyA)Y uSǃtV + 9s5 B9r=t PhW }t=(u E( EPPe[^_ÉUWVSEwEHEuU<jhEGMEU9~-}WÃuEP1]MfCfK MfC fC}{CE1vS E)w;u} {v F;u|;[uD1}~<{ME쐉!fK fKU)UF}ՋE +Mu1}K{u9t1u Ft1fK u}A)K =tCPhCP1 Ce[^_UVSu=t/ v9s1$w V VÃ=tt VjS ؍e[^U WVS}=t + wh` v;vhv;u[thǷ;t= 9u 9E ;v{@Ht hn%J MƃM#t h2p= u-9u s(9E wuwh1KvE P4Ãt1} t"t;u sV M QWS W ؍e[^_UWVS},=تuh`=M +  wh`; vhEuh.vthzxEthǷ][|u 2B2<t =tVhUR=DdtjVMQ}=(uj((UPx p=u@}M9K s;tE9C s;u9{v(SPCPjU9S u<S KK;ts;PugE@ C EHKUtOXE9{u sMK4;u(X(hE#;u{C;@dvpC ;$uejs 9$uP@dS‰S CRoC $s +5F9w B9v}AUR0}K CHEthMSM#th=tCPhEP DfC S f{ u2:t%8tʃ:t 9t @;CrOC f;CuE9t9uC +s9t SVe[^_ÐU VSu=Hdth0d,ܪ=ܪt/h ܪ=Hdt 0d1=تu6=t u1VÃ= tEu]j EP  ܪ=Hdt 0d=tu hX؍e[^ÍvUS]=Hdth0d ,ܪ=ܪth ܪPvS[= t]EEj EP ܪ=Hdt 0d]ÉUWVS]} =Hdth0ds ,ܪ=ܪth ܪ1t=تu h`1ۃ=تu=tuSq1u WO WSƃ= t]}uj EP  ܪ=Hdt 0d=tu he[^_ÐUWVSEE}tu=`uj+`UX]vC;t;=u+]]=`/v]utNt9t CA8tuA<=tu1[^_ÍvU WVS}tw=`ul+`E X]vC;t;=u+]]=`/v]utNt9t CA8tuA<=tu1[^_ÐU$S=LtLЃ]S jS jSjj舑P~ jj;jSj趌 jYPOj$FreeBSD: src/lib/libc/i386/string/memset.S,v 1.5 1999/08/27 23:59:32 peter Exp $WS|$ D$L$W~$ĉ Љڃ)ӉكX[_$NetBSD: bcopy.S,v 1.6 1996/11/12 00:50:06 jtc Exp $vVW|$ t$L$)9rL$D$ _^ONL$D$ _^Ð$FreeBSD: src/lib/libc/i386/sys/brk.S,v 1.7 1999/08/27 23:59:38 peter Exp $D$9Ldv LdD$̀rD$Pd)UEU RPjuuuu ujh:US]uu CP| șCPSTfc ȋ]ÍvUS]C tjjjCPfc uu CPD]ÍvUS]uE URPCPiuu fc vK CPST]ÐUE@PU WVSEdt1v_wNxvf{ tSU EXNy?uҋEe[^_ÐUu ht,@uÐUPu hu蝄 x]ÉUEdÍvUEdÍvUU1t0  UWVSuuEFt}1ۋE;,vS0ҋu09u5A;Fu-yuy u yuytXq}tCC;,|;v1C;,}+S&0ҋ09u݃ytA;FuEEe[^_ÐUWVS] UBOvhRSEPUR | ÍC;Ev XvS ƃS ;u u&;Eu!EPRcu Ou1[^_UWVS] UB;] wME ;EwBUBuUBUB%9t1vOhRSE PUR |ÍC;E wSƃS URURPVP8 cO[^_ÉU\WVSEU(u  } t (u t(hhXchXcu u- Dž(u } ~ DžDžDžDž<1K{}!t0hhc vDž[ Dž;,8 􋕸R8t 3xu Džx%s M =dto11ۍvPURMQE PEPPdЃ w$􋕴RI C)~􋍴QO t(tKj"jjhh@P uh@@Ph@hXc3$Dž=d|A=dt*At@9d=d| @djjP{d}7qq0hhhcvqR5d^{}7qq0hshcrudPE P袾EEEEE EjEP5d:‹E  9t7pp0h~hcvufDžPV5d1Ã~)ffuɅ]ppp0hhcF 6Dž MQU9~4(thhXcu|DžMf ff wA(tPhhXc"|Dž(vu vf)ft PV5dÃͅ!Bt2(thhXcSuDžG(u%!=!uhhXcu(u  t5hhXcthXc;E~EPMQ t(tu )u=dtJ11ۃPEPURu udЃ $ĻC)t􋅴P;,; $c􋅴Pu(uNg=?g<v/g[^_ÍvU=d|65dWddddÐU WVS}u hV3su #GtSPhVs uNx   Vj e[^_ÐU, WVS]E#=tEx #=(f ,f1PVE PEP/tpe8te0Ph8+ Kx  Sj u1t(tWE PRPhSq } uMPRPPPtPhS}q0jhPjjPEP }"d0Ph7S0q&SP\Sj ɭ F|[^_ÐUhXcuUu huÐULWVSu(u:|EPu u,}$c0 PhKVnp@]#(f ,fE#hf lfU}MމMMMMMă=t ut R4 e4dh`Vo =t t)NyF;F|;Vj;=t IhVoE# f $fthVkoE#0f 4fthVDoE#8f [^_ÉUuhu uSÐU WVS]EPSEPEPu \ƅ|&߰ЍPt|.tB;E|1fEe[^_UVShVhu ujà tuV1[^U WVS]} u{t)sWLu t {uׅte[^_ÍvUSEU ]xt;ut@, xuRhht]USEU ]xt;ut@, xuRhht]Ujuh0ÉU<} ujuPÉUjuh̼ÉUE w(towtXt[t_tb=tuw@t^=t_=tiw =tXn=t]cvqiaYQIA91)! Ph*h)ÉUS]j(hS/}Sh2h]ÉUVS]fо f1fʃf1f<dQ)QRh5h(x(e[^UWVSu11ۋ=wuU%1tTPAѐ9.u]A=wuU%1t8A=wuU%1t\A1;drdG;\s14d ~ Љ%[^_UWVS1EEEEv=wuU%1t|PCѐvRva4%@tCύv=wuU%1=wuU%1tETPЉUCˍvvRdva4%@tCύv=wuU%1J=wuU%1tETPЉUCˍv;.C=wuU%1t~EC=wuU%1tFUBEC=wuU%1tUTЉUCvR$va4%@tщvRva4%@tCύv2wt$@)U4)U4)U4<+u)U)‹E)Ѝ)v12w"$ vU E  U CvR a4%@tӉvRؾva4%@tCύvEe[^_ÐU,WVSE1EEEEEEEEǰH}ǃEPEPÃEPEPƒ EEu+}u}u ]Uv}u}u]U1E8-u EEE8+uEvE=wuU%1tUtBōvE8.uyEE=wuU%1tOEEEE=wuU%1tEUTЉUEU]؁ÀvEvR a4%@u 9}sEȋEvR豼 a4%@t9}5E9}'EP#EEvRY a4%@u 9}sEȋEvR! a4%@t9}E9}EPEEvRɻ a4%@u 9}sEȋEvR葻 a4%@t 9}sE9}sEP EE UPUPUPEU BEBEBEBEBEB EB EB B B BZe[^_ÍvUP= EH"A$ }$6u4u0u jE4PE0PU,RE PE PUR` vE4PE0PPu ]ƃu E4PE0PjhRGE4PE0PRlE4PE0PE,PE PU REP E4PE0PjhR{E4PE0PU,RE PE PUR PE4PE0PjhT1DžU )ЃRÃE E4PE0PjhXP Sh^]S{ƃE4PE0PVS E4PE0PPjVJ  E4PE0Pj hbm Džu kÃE E4PE0PjhX0 u4u0Sƃ E4PE0PV*E4PE0PRjV  E4PE0Pj hl* Džu 躘ÃE E4PE0PjhX u4u0S3ƃc E4PE0PVyE4PE0PPjV * E4PE0Pjhwy Džu ÃE E4PE0PjhX< u4u0Sƃ E4PE0PVE4PE0PRjV7 y E4PE0Pj hZ Džu XÃE E4PE0PjhX u4u0Sƃ E4PE0PVE4PE0Pjh< E4PE0PPjVg  E4PE0Pj h }$b u {E Ph]Sƃ E4PE0PVSK E4PE0PU,RE PE PUR^ }$ u E Ph]Sƃ E4PE0PVSI E4PE0PE,PE PU REP  E4PE0PjhR E4PE0PU,RE PE PUR d vE4PE0PPu ƃD  u 9U  }4]0vWSPu [ ƃ u 9U  WSjhR<9E r Su U$RE4PE0P߰HPSwv}$N u4u0u j覽E4PE0P}0HPk  Su E4PE0P߰HPSv}$u ÃE u ړE  PShhSpƃE4PE0PVS E4PE0PRu ƃSu E4PE0PjhR ZE4PE0PPu ƃ6u E4PE0PjhR| E4PE0PRu F ƃu E4PE0PjhR0 E4PE0PE,PE PU REP }$ju 胒ƃE u rÃE  u ^E PSVh4Sƃ0E4PE0PVS )E4PE0PU,RE PE PUR< vE4PE0PE,PE PU REP E4PE0PjhR% E4PE0PU,RE PE PUR }$^u4u0u j趺E4PE0P}0HP{ E  E Ph]SƃE4PE0PVS E DžDž9U E4}0UE E v}|u+PWjh Dž RhP%ƃRWVP Ui9E NE4PE0Pjh}$u E E E E E PRQh]S{ƃ0E4PE0PVS hP+E Pu r ƃ]~,E4PE0PjhbDž DžR19U4E0RPHPR`PR)؃0~0P+P*09|v}$zu 蓎ƃE E E E 8E u 舎E  PSVPh]Sƃ E4PE0PVS/EP9u E P Ph]Sƃ0E4PE0PVS=u ׍E PPh]SPƃ0E4PE0PVSu vE Ph]Sƃ E4PE0PVSFE4PE0PU,RE PE PURY hP+E Pu ƃ~.E4PE0PjhBDž vDžR19E4U0PRHPR|^PR)؃0~0P+P|,09|E4PE0PjhkE4PE0PE,PE PU REP |΋+U 1ۉ9}؅}CE ؅}C$)t9SPhWƃ E4PE0PVWGC9| Ph]SƃE4PE0PVSa9E DžU4E0U]hSWË+} ~19}!E PhS"ÃF9|PR+PP?YRPjhRPRj0+@P ]hS{19}[CE u7vR0va4%t E .F9|PR+PP<} 9U mE0+[^_U WVS]} ހ;tAtWS )u )9v&H#C;t;\u C;t퐀;.uC;u)e[^_ÐUWVS]}]EEUEPWjh;] s\3D3;E wPFPhǚtURWjh||5C}u}u3u/}u)u%EPE PjSEP } tvC~euYÀuOvS_ a4%t%vS譇 a4FuE +Eȍe[^_ÍvUWVSE11EEÀ0vSÒ a4%wuU%1ttCGvS_ a4%t'ځvSoà a4Cws$)ƍv4)4)4u11EUE~ }uuE U1vc*e[^_UME t t! EP|P^.E Es!FEFCF 4<F >FhF<FDFjj3,ƒtcB ub J jjR3.t$t! ujSЃtCk%`%t V}t|P虦1%1h[^_ÉUSEX{tjs3.C!u v$]ÐU WVSEX{tjs3-CEHwq$ U 0t]svC(ts$Fd]C(ts$NuP! ujSЃ$vt;vu@@3CPG G1e[^_UWVS}G,EEjUR7A tOE +EfG GVAfEQUAf;ut2E;E w&UƋUBfFf;ut E;E v܋UJfP[]}t!r }t-8DA jDAjjQ7v0}tp7}uSAP SAPjQ7G,9t1ۅtj37,u&01e[^_ÐU WVSuU >B\N)Ãr2PyGfFEf+Xp0PWGfFf>E)fLFf\Fe[^_ÍvUWVSE pUEf|FwU REPv}t UDVUB NjUf+|VEH9trLFˋE XډUUDV)PSEPU5f|VuVfDVfDVVfDVDVfDV;U~DFUfVfDVfDVUfEH8U J1e[^_ÐU}EPPEPURM QEPgUbMaIEH UJ HM؉ˋBEfEEf|svsE؉EUމUs)‰ЉEPuMQ;E u\f+EtHf|sDsU)‰PDsEPEPfsf+DsMfKf|K|sE6DsE؉E sDsU)JREPEPfETsfUރ9Mf) E)fLCf|CE`Ub1e[^_ÍvU\WVSEE܋XURU؉]EMfM;Of;;CfHfw{EPu VEp PURMQuV CEE5URUԋMMuvu؋EE܅kU܋ZMMf|C CEf)Uu)ftSUfTCjuVQEPE܃U܋ZMI fME}tuVEP U܉UЋMI fMοf;;f{uuȍEEĐS؉EMS)uȉNDS؉E SDS)uĉNTSfU΃EpuUR;E u{Mfyv)FuFTQ9wEPVQ6vURMQEuvuԃEPURVHMIuf~v6EEMAUBETF9UwQMQV E@<\tPU\@jؙ]K t1RPEP0ut/URV]Sڍtt;Et: Of}u)f9u#fEP fV]C fFExt~}t:X 19}lMvEAADADEDB9|>fEEEA9uQfEFQEDQB9~1e[^_UWVSu }E@ EUuR_G]]Extj}t:X 19}XMvEAADADEDB9|*19MVfEAVEDVB9~}t$UZG~j1h@jjaEx ED  UB H9EuhE}MQj PEPEDC~[GrUz ЃD  12EE}E}$M)M U4ÉyC؅}C$)M UB ƍ\;Z$|KJ$19}E;XD~ DF9};tU+\@ %1e[^_ÉU WVSuU B f ft‰T@JQ;V$}V$NF H!Í8uQVƒ؅}C؅}C$)!U RVNe[^_ÉU0VSu]SAEPSj* hg*t"hg;jji jEPj 1ue[^ÍvUWVS]fELSfMD{fEM AtS)ft{q1P Ef+pf4{p0Pi Mf EfD{fD{MAM fAM)fLSftCe[^_ÐU WVS]E ;}ms z8M tMjjjU PP847S u78M 4t{1e[^_ÐU,WVSEU z}M@EEEURU"%U9~fUDG)fESMQEEP )]]7FEfwFf7uM)fLWUfTGfwM QEP>E [7}uzf|wtkTwE9~fEDGf+EfEfw]SUREEPx])]fDwMf)LGUfTG vfDwM y}IDGf}ȋU9~fU%;EuUE;PufMDGf+EfE]SMQEEP)]]7FEfwFf7uM)fLWUfTG}t5fwM QEPE u 3U z}fwM IDGf}1e[^_ÍvUWVS}] ]1KEJDAfEKjSEPWÃt VWޅtjK}tfyt'AffwEfyuf|AtELAfMUJ~!EfAfACBviUBEEfUUUW +UfTAW JfTAEHt SW9t VWO81e[^_UWVSE PUMM]]ur}_ )É;Evf|runu}w4}uvE)EjE PUMDQP]S%E tOPUEBu^ );Mfzt;Mu}]{4}t Ee[^_ÐUVS]u jQDPPSt)Afxuۃtfuǃ $jU RDFPS  @f8uL$ǃ :jE PDFPSsƒtUEPEEPRSǃ~:EU 9B u#EPFBPEPqe[^_UVSu]uuju V"Ct1e[^UWVS}E pFW )‰UE @ fE]FffwTtrSqUREPjU RW t:sjE PDFPWtWURURSPWAà ~;EU 9B u$EPFBPEPe[^_UWVS]jEPEPuEP u`uuUR&;EЉUEPEPU fB ft,juB PEP5U BuE @E }tEHXX|CLC3F֋EfSFfCf3f|CfLCEU E BEXHf;vGsLC|CffLCf|CuUR  ..., where is one of: %sgrepexviewvitelnetftpmount_cd9660mount_msdosumountswaponrrestorerestorerebootmountmknodfdiskdmesgdisklabelclrichgrpchownsyncsleeprmdirrmmvmkdirlslnkillexprechodfddcpchrootchmodcat@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/cat/cat.c,v 1.14.2.1 2000/05/16 08:38:49 asmodai Exp $benstuvusage: cat [-benstuv] [-] [file ...] stdout@@؃@@@@@@@@@@@@ 4stdin-r%s%6d buffer@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/chmod/chmod.c,v 1.16.2.2 2000/08/07 07:33:23 ps Exp $HLPRXfgorstuvwxthe -R and -h options may not be specified together.invalid file mode: %s%s: %s%s%s fts_readppppppppppppppppppppp@ppppppppppppp(@4pppppp@pp@@@@d@@č4444444ŎŎusage: chmod [-fv] [-R [-H | -L | -P]] mode file ... @(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/usr.sbin/chroot/chroot.c,v 1.4 1999/08/28 01:15:45 peter Exp $.%sSHELL/bin/sh-iusage: chroot newroot [command] @(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/cp/cp.c,v 1.24 1999/11/28 09:34:21 mharo Exp $HLPRfiprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%sDDDDDDȐDDDDDDDDDDDDDDDDDDDDDDDDDDDD D,DDD8%s: %s%s: directory causes a cycle..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).%s -> %s fts_read|HHH$FreeBSD: src/bin/cp/utils.c,v 1.27 2000/01/23 03:04:49 mharo Exp $%s(y/n [n]) overwrite %s? %snot overwritten readlink: %sunlink: %ssymlink: %smkfifo: %smknod: %sutimes: %schown: %schflags: %s cp [-R [-H | -L | -P]] [-f | -i] [-pv] src1 ... srcN directoryusage: cp [-R [-H | -L | -P]] [-f | -i] [-pv] src target%s %s $FreeBSD: src/bin/dd/args.c,v 1.25.2.1 2000/08/07 08:30:17 ps Exp $MzIzhDzp>z8z@@4z`1z+zP'zȥ$z  z0@@z0@@zPskipseekoseekofobsiseekifibsfilescountconvcbsbsunable to allocate space for the argument "%s"unknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsseek offsets cannot be larger than %qdbs must be between 1 and %dcbs must be between 1 and %dcount cannot be negativefiles must be between 1 and %qdibs must be between 1 and %dobs must be between 1 and %d} }} } }}}} } } }} }}}}unblockucasesyncswabsparseosyncoldibmoldebcdicoldasciinotruncnoerrorlcaseibmebcdicblockascii,unknown conversion %s%s: illegal conversion combination%s%s: illegal numeric value%s: %sاȧ%s: illegal offset$FreeBSD: src/bin/dd/conv.c,v 1.15 1999/09/13 21:47:10 green Exp $%s: short input record$FreeBSD: src/bin/dd/conv_tab.c,v 1.10 1999/09/12 16:51:53 green Exp $    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/dd/dd.c,v 1.27.2.1 2000/08/07 08:30:17 ps Exp $stdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffertruncating %sư>%s: seek error creating sparse file%s: end of device%s: short write on tape device%s: short write on character device$FreeBSD: src/bin/dd/misc.c,v 1.18 1999/08/27 23:14:04 peter Exp $%qu+%qu records in %qu+%qu records out blockblocks%qu odd length swab %s %qu truncated %s %qu bytes transferred in %.6f secs (%.0f bytes/sec) ư>?@$FreeBSD: src/bin/dd/position.c,v 1.17.2.1 2000/08/07 08:30:17 ps Exp $%sskip reached end of input%s: write failure@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/df/df.c,v 1.23.2.1 2000/06/13 03:19:40 jwd Exp $abgHhikmnPt:BLOCKSIZE=512BLOCKSIZE=1gBLOCKSIZE=1kBLOCKSIZE=1monly one -t option may be specified.%s/tmp/df.XXXXXXstrdup failedmkdtemp("%s") failedufs 4LXd?@ 0BBKMGTPE %5.0f%c %5.1f%c$@ SizeFilesystem%-*.*s %-s Used Avail Capacity%-*.*s %-s Used Avail Capacity iused ifree %%iused Mounted on %-*.*s %*ld %8ld %8ld %5.0f%% %7ld %7ld %5.0f%% %s Y@ df: %qd: %s usage: df [-b | -H | -h | -k | -m | -P] [-ain] [-t type] [file | filesystem ...] $FreeBSD: src/sbin/mount/vfslist.c,v 1.4 1999/08/28 00:13:27 peter Exp $malloc failed@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/echo/echo.c,v 1.8 1999/08/27 23:14:10 peter Exp $-n%s$FreeBSD: src/usr.bin/yacc/skeleton.c,v 1.28 2000/01/17 02:04:06 bde Exp $B[aim3O (                      !"   (:%&)*+%-/*+-/:<=>:%&)*+-)/%&)*+-/<=>%&*)<=>/%&)*+-:/&|)+-<=>&)<=>&)+-|<=>&|)&|)<=>&)&)<=>|<=>|<=><=>|&)%&|*+-/|<=>:<=>||%&|*+|-/:<=>%*+-/||:<=> malloc() failedoverflow%qd|&=<>+-*/%:()%qd %s syntax errornon-numeric argumentdivision by zero%syacc stack overflowhx4H\p@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/kill/kill.c,v 1.11 1999/08/27 23:14:26 peter Exp $-lillegal signal number: %s%s -soption requires an argument -- s0illegal process id: %s%ssigunknown signal %s; valid signals: kill -signal_number pid ... kill -signal_name pid ... kill -l [exit_status]usage: kill [-s signal_name] pid ...%s %s %s %s @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/ln/ln.c,v 1.15.2.1 2000/09/18 02:07:11 jkh Exp $linkfisv.%s%s/%sreplace %s? not replaced %s %c> %s link file1 file2 ln [-fisv] file ... directoryusage: ln [-fisv] file1 file2%s %s %s $FreeBSD: src/bin/ls/cmp.c,v 1.9 1999/08/27 23:14:31 peter Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/ls/ls.c,v 1.32.2.4 2000/08/16 19:57:11 jhb Exp $COLUMNS1ABCFGHLPRTWabcdfgiklnoqrstuCLICOLORCLICOLOR_FORCEColor support not compiled in. H`X|\t$DPh,%s: directory causes a cycle%s: %s %s: %s: fts_readLS_COLWIDTHS0:0 %lu : %lu : %lu : %i : %i : %i : %qu : %lu %u-%lu%qu#1$FreeBSD: src/bin/ls/print.c,v 1.19.2.3 2000/07/12 06:19:14 assar Exp $%stotal %lu %*lu %*qd %s %*u %-*s %-*s %-*s %3d, 0x%08x %3d, %3d %*s%*qd %Ef %T %Y %Ef %R %Ef %Y %s/%s ls: %s: %s -> $FreeBSD: src/bin/ls/util.c,v 1.20.2.3 2000/08/07 08:05:08 ps Exp $ D   , x  p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p usage: ls [-ABCFHLPRTWabcdfgiklnoqrstu1] [file ...] @(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/mkdir/mkdir.c,v 1.19 1999/09/04 03:19:38 mharo Exp $m:pvinvalid file mode: %s%s%s usage: mkdir [-pv] [-m mode] directory ... @(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/mv/mv.c,v 1.24.2.2 2000/07/28 21:40:39 sada Exp $fiv%s: destination pathname too long%s(y/n [n]) overwrite %s? %s override %s%s%s/%s for %s? %snot overwritten %s -> %s cannot resolve %s: %scannot rename a mount pointrename %s to %smalloc failed%s: remove%s: set owner/group (was: %lu/%lu)%s: owner/group changed; clearing suid/sgid (mode was 0%03o)%s: set mode (was: 0%03o)%s: set flags (was: 0%07o)%s: set times-PRpv-PRpmv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rm mv [-f | -i] [-v] source ... directoryusage: mv [-f | -i] [-v] source target%s %s @(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/rm/rm.c,v 1.29.2.2 2000/07/01 03:08:59 ps Exp $unlinkdfiPRrvW%s: %s%s %sfts_read$$P$,$$H%s: is a directorymallocremove %s? override %s%s%s/%s %s%sfor %s? "." and ".." may not be removed unlink fileusage: rm [-f | -i] [-dPRrvW] file ...%s %s @(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/rmdir/rmdir.c,v 1.9.2.1 2000/07/04 01:13:36 ps Exp $p%susage: rmdir [-p] directory ... @(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/sleep/sleep.c,v 1.9 1999/10/01 07:53:40 ru Exp $usage: sleep seconds @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/sync/sync.c,v 1.9 1999/08/27 23:15:45 peter Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/usr.sbin/chown/chown.c,v 1.15.2.1 2000/08/07 02:03:09 ps Exp $HLPRfhvthe -R and -h options may not be specified together%s: %s%s fts_read+++++++++*+++*+++*+*+++++++++++++++++++*++++++++++++++++H,,,h,,,,,,,,,,groupuser%s%s: illegal %s nameyou are not a member of group %s chgrp [-R [-H | -L | -P]] [-f] [-h] [-v] group file ... chown [-R [-H | -L | -P]] [-f] [-h] [-v] :group file ...usage: chown [-R [-H | -L | -P]] [-f] [-h] [-v] owner[:group] file ...%s %s %s @(#) Copyright (c) 1990, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/clri/clri.c,v 1.4 1999/08/28 00:12:32 peter Exp $usage: clri filesystem inode ... %s%s: can't read superblock%s: superblock magic number 0x%x, not 0x%x%s is not a valid inode numberclearing %d @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/disklabel/disklabel.c,v 1.28.2.3 2000/07/01 06:47:46 ps Exp $DOC2KVinumCCDfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownvinumbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunusedBNRWb:ers:w/dev/%s%s%c%s%s%sioctl DIOCWLABELr444H344444444444t34443444434444444444T34434444444444443d34443856D66l778auto%s: unknown disk type/boot%s/%sioctl DIOCSDINFOwriteioctl DIOCWDINFO%s: no disk label on disk;use "disklabel -r" to install initial label %s: label magic number or checksum is wrong!(disklabel or kernel is out of date?) %s: open partition would move or shrink%s: '%c' partition must start at beginning of diskbad pack magic number (label is damaged, or pack is unlabeled)ioctl DIOCGDINFO%s/boot1%s/boot2%s too largebootstrap doesn't leave room for disk label# %s: type: %s type: %u disk: %.*s label: %.*s flags: removeable ecc badsect bytes/sector: %lu sectors/track: %lu tracks/cylinder: %lu sectors/cylinder: %lu cylinders: %lu sectors/unit: %lu rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %lu # milliseconds track-to-track seek: %ld # milliseconds drivedata: %lu %u partitions: # size offset fstype [fsize bsize bps/cpg] %c: %8lu %8lu %8.8s%8d %5lu %5lu %5.5s %5lu %5lu %5u %5lu %5lu %5d%20.20s # (Cyl. %4lu- %lu) wcan't create %scan't reopen %s for readingre-edit the label? [y]: you have too many processesforkEDITOR/usr/bin/viline %d: syntax error typeWarning, unknown disk typeline %d:%s %d flagsremoveableeccbadsectline %d: %s: bad flag drivedata%d partitionsline %d: bad # of partitions disklabelbytes/sectorline %d: %s: bad sector size sectors/trackline %d: %s: bad %s sectors/cylindertracks/cylindercylinderssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name line %d: too few numeric fields line %d: %s: bad partition size line %d: %s: bad partition offset Warning, unknown filesystem typeline %d: %s %s line %d: %s: Unknown disklabel field sector size 0 sectors/track 0 tracks/cylinder 0 cylinders/unit 0 revolutions/minute 0boot block size 0 boot block size %% sector-size != 0super block size 0 super block size %% sector-size != 0number of partitions (%lu) > MAXPARTITIONS (%d)partition %c: size 0, but offset %lupartition %c: offset past end of unit partition %c: partition extends past end of unit unused partition %c: size %d offset %lu"auto" requires the usage of a canonical disk namecannot open %sboot overlaps used partition %c marked as FS_BOOTboot overlaps partition %c, %scannot install boot programWarning, (to write disable/enable label) disklabel [-NW] disk (to restore label and boot program) disklabel -R -B [ -b boot1 [ -s boot2 ] ] disk protofile [ type ] (to write label and boot program) disklabel -w -B [ -b boot1 [ -s boot2 ] ] disk type [ packid ] (to install boot program with existing label) disklabel -B [ -b boot1 [ -s boot2 ] ] disk [ type ] (to restore label with existing boot program) disklabel -R [-r] disk protofile (to edit label) disklabel -e [-r] disk (to write label with existing boot program) disklabel -w [-r] disk type [ packid ] (to read label)usage: disklabel [-r] disk%s %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s $FreeBSD: src/sbin/disklabel/dkcksum.c,v 1.4 1999/08/28 00:12:35 peter Exp $@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/dmesg/dmesg.c,v 1.11 1999/08/28 00:12:36 peter Exp $_msgbufpM:N:dmesgkvm_nlist: %snamelist%s: msgbufp not foundkvm_read: %skernel message buffer has different magic numbermalloc failed%susage: dmesg [-M core] [-N system] $FreeBSD: src/sbin/i386/fdisk/fdisk.c,v 1.36.2.6 2000/08/24 17:56:21 jhb Exp $/dev/od0/dev/da0/dev/wd0/dev/ad0BBT (Bad Blocks Table)DOS 3.3+ SecondaryConcurrent CPM or C.DOS or CTOSBSDI BSD/386 swapBSDI BSD/386 filesystemNetBSDNEXTSTEPOpenBSDFreeBSD/NetBSD/386BSDSuspend to DiskBSD/OSAmoeba bad block tableAmoeba filesystemLinux filesystemLinux swap or Solaris x86Minix 1.4b ... 1.5.10Minix 1.1 ... 1.4aPCIXNovell Netware 3.xxNovell Netware 2.xxISC UNIX, other System V/386, GNU HURD or MachSpeedGBCP/M or Microport SysV/ATDMQNX 4.2 TertiaryQNX 4.2 SecondaryQNX 4.2 PrimaryVENIX 286plan9OPUSExtended DOS, LBAPrimary 'big' DOS (> 32MB, LBA)DOS or Windows 95 with 32 bit FAT, LBADOS or Windows 95 with 32 bit FATOS/2 Boot Manager or OPUSAIX boot partition or CoherentAIX filesystemOS/2 HPFS, NTFS, QNX-2 (16 bit) or Advanced UNIXPrimary 'big' DOS (> 32MB)Extended DOSPrimary DOS with 16 bit FAT (<= 32MB)XENIX /usr filesystemXENIX / filesystemPrimary DOS with 12 bit FATunusedBIab:f:istuv1234/dev/dev/%scannot open disk %scannot open any diskcannot allocate buffer to determine disk sector sizeread_s0%s: %d cyl %d hd %d sec SizeStartPart %11s %11s Type Flags %4d: %11lu %11lu 0x%02x 0x%02x ******* Working on device %s ******* Media sector size is %d Warning: BIOS sector numbering starts with sector 1 Information from DOS bootblock is: We haven't changed the partition table yet. This is your last chance. Should we write new partition table? -t flag specified -- partition table not written. `^`^`^`^l^l^l^l^l^l^l^l^l^l^l^l^l^]l^l^l^l^l^l^]l^l^l^l^l^l^l^l^l^l^l^l^l^l^l^l^l^l^l^l^l^l^l^^ ^l^l^l^^l^l^$^l^l^l^l^l^l^l^l^l^0^<^H^T^ fdisk -f configfile [-itv] [disk] usage: fdisk [-BIaistu] [-b bootcode] [-1234] [disk] %s%s%d: sysid %d,(%s) (active) start %lu, size %lu (%qd Meg), flag %x%s beg: cyl %d/ sector %d/ head %d; end: cyl %d/ sector %d/ head %d /boot/mbr%s%s: length must be a multiple of sector size%s: unable to allocate read buffer%s: short readThe data for partition %d is: Do you want to change it? The static data for the DOS partition 4 has been reinitialized to: sysid (165=FreeBSD)startsizeExplicitly specify beg/end address ?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorAre we happy with this entry?parameters extracted from in-core disklabel are: cylinders=%d heads=%d sectors/track=%d (%d blks/cyl) Figures below won't work with BIOS for partitions not in cyl 1 parameters to be used for BIOS calculations are: Do you want to change the active partition?active partitionActive partition number must be in range 1-4. Try again. Are you happy with this choiceDo you want to change the boot code?Do you want to change our idea of what BIOS thinks ?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorscan't get file status of %sdevice %s is not character specialcan't open device %scan't get disk parameters on %scan't get disk parameters on %s; supplying dummy onesunable to allocate buffer to read fdisk partition tablecan't read fdisk partition tableinvalid fdisk partition table foundcan't write fdisk partition table%s [n] yesYESyYSupply a decimal value for "%s" [%d] %s is an invalid decimal number. Try again. unknownERROR line %d: the geometry specification line must occur before all partition specificationsERROR line %d: incorrect number of geometry argsERROR line %d: unknown geometry arg type: '%c' (0x%02x)ERROR line %d: number of cylinders not specifiedWARNING line %d: number of cylinders (%d) may be out-of-range (must be within 1-1024 for normal BIOS operation, unless the entire disk is dedicated to FreeBSD)ERROR line %d: number of heads not specifiedERROR line %d: number of heads must be within (1-256)ERROR line %d: number of sectors not specifiedERROR line %d: number of sectors must be within (1-63)ERROR line %d: incorrect number of partition argsERROR line %d: invalid partition number %dERROR line %d: unable to adjust start of partition %d to fall on a head boundaryWARNING: adjusting start offset of partition %d from %u to %u, to fall on a head boundaryERROR: could not adjust partition to start on a head boundary and end on a cylinder boundary.WARNING: adjusting size of partition %d from %u to %u to end on a cylinder boundaryERROR line %d: size for partition %d is zeroERROR line %d: incorrect number of active args-rERROR: unable to adjust start of partition to fall on a head boundaryWARNING: adjusting start offset of partition to %u to fall on a head boundaryWARNING: adjusting size of partition to %u to end on a cylinder boundaryERROR: size for partition is zero@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/mknod/mknod.c,v 1.13 2000/01/06 17:51:46 obrien Exp $usage: mknod name [b | c] major minor [owner:group] %s%s: illegal %s namegroup must be specified when the owner isgroupowner must be specified when the group isusernode must be type 'b' or 'c'%s: non-numeric major number%s: non-numeric minor numbermajor or minor number too largesetting ownership on %s@(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/mount/mount.c,v 1.39.2.1 2000/09/05 12:07:56 sheldonh Exp $soft-updatessuiddirnoclusterwnoclusterrunionsynchronousread-onlywith quotasnosymfollownosuidnoexecnodevnoatimelocalNFS exportedasynchronousext2fslfsffsufsadfo:prwt:uvonly one -t option may be specifiedgetmntinfororwrqnoautonot currently mounted %s/%s: unknown special file or file system%s has unknown file system type:@nfsr/var/run/mountd.pid%dsignal mountd@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~@~}@~@~}@~}@~@~@~@~@~@~@~@~}}@~}@~}0~}8~,/usr/sbin/sbinforceupdateexec: mount_%s %s fork%s/mount_%smalloc failed, exec mount_%s not found in %swaitpid%s: %sstatfs %s%s on %s (%s, %s, mounted by %s, writes: sync %ld async %ld, reads: sync %ld async %ld) %s,%s-ofstabcurrentno mount [-dfpruvw] special | node mount [-adfpruvw] [-t ufs | external_type]usage: mount [-dfpruvw] [-o options] [-t ufs | external_type] special node%s %s %s %s %s %s %s %u %u 1 1 2 2 0 0 syncasync@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/mount/mount_ufs.c,v 1.16 1999/08/28 00:13:27 peter Exp $updatesyncforceasyncclusterwclusterrunionrdonlysymfollowsuidsuiddirexecdevatimeautorwrogroupquotauserquotao:ufsvfsload(ufs)ufs filesystem is not available%s on %s: mount table full%s on %s: specified device does not match mounted device%s on %s: incorrect super blockusage: mount_ufs [-o options] special node $FreeBSD: src/sbin/mount/getmntopts.c,v 1.9 1999/10/09 11:54:06 phk Exp $,-o %s: option not supported%s: not a directory%s: %s$FreeBSD: src/sbin/mount/vfslist.c,v 1.4 1999/08/28 00:13:27 peter Exp $malloc failed@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/reboot/reboot.c,v 1.9 1999/11/21 21:52:40 jdp Exp $haltdlnpqcannot dump (-d) when halting; must reboot instead???halted by %srebootrebooted by %sshutdown~SIGTSTP initSIGTERM processesWARNING: some process(es) wouldn't die (can't restart init): %s%sЕؕusage: %s [-dnpq] @(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/restore/main.c,v 1.10 1999/08/28 00:14:07 peter Exp $./restoresymtableTAPE/dev/rsa0b:cdf:himNRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0%c and %c options are mutually exclusiveillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specified.Begin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure șTTTTTTTTTTTTTTTTTTP`TpT|TTTTTTTؙ0<THȜ6666666666666666666666<66666666d6666restore -t [-chkuvy] [-b blocksize] [-f file] [-s fileno] [file ...]restore -x [-chkmuvy] [-b blocksize] [-f file] [-s fileno] [file ...]restore -R [-ckuvy] [-b blocksize] [-f file] [-s fileno]restore -r [-ckuvy] [-b blocksize] [-f file] [-s fileno]restore -i [-chkmuvy] [-b blocksize] [-f file] [-s fileno]usage: %s %s %s %s %s option requires an argument -- %c$FreeBSD: src/sbin/restore/interactive.c,v 1.8 1999/08/28 00:14:05 peter Exp $/addcd%s: not a directory delete%s: not on extraction list extracthelp directory is used If no `arg' is supplied, the current help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%slspwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help UPPPPإPPPPPPPPPPPPPPPPPPPPPPPPPPPP$P4PP$PPPģPPPP\PPrestore > %s/%s%s: out of memory command lines cannot be continued missing %c ../canonname: not enough buffer space ..ls: out of memory directory reopen failed %s: %s%s: name exceeds %d char Warning: undefined file type %d llllll%*d %srestore interrupted, continue$FreeBSD: src/sbin/restore/restore.c,v 1.7 1999/08/28 00:14:08 peter Exp $leafdir %s%10d %s %s: not on the tape ./%uMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %d) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state D4ػHH   |NIL|ONTAPE|INOFND|NAMEFND|MODECHGFind unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %d: bad first %s: not found on tape expected next file %d, got %d unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %d type should be LEAF$FreeBSD: src/sbin/restore/dirs.c,v 1.14.2.1 2000/07/21 09:00:08 dwmalone Exp $Extract directories from tape /tmp/%srstdir%d-XXXXXXw%s - cannot create directory temporary fopen%srstmode%d%s - cannot create modefile fopen/opendirfile: %s Root directory is not on tape .Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %d char lsMangled directory: reclen not multiple of 4 reclen less than DIRSIZ (%d < %d) reclen name too big (%d > %d) bad seek pointer to rst_seekdir %ld error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopen: %s cannot open mode file %s set owner/mode for '.'cannot find directory inode %d error setting directory modes Cannot find directory inode %d named %s %s: cannot create file: %s write error extracting inode %d, name %s read: %s write: %s no memory directory table $FreeBSD: src/sbin/restore/symtab.c,v 1.7 1999/08/28 00:14:08 peter Exp $addino: out of range %d duplicate inumdeleteino: out of range %d deleteino: %d not found %s is not a directory %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTcannot find entry in parent listbad name no space for string table Check pointing the restore wfopen: %s cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table .open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table read: %s cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c $FreeBSD: src/sbin/restore/tape.c,v 1.16.2.2 2000/09/15 15:09:37 mjacob Exp $-r/dev/ttycannot open %s: %s /dev/nullCannot allocate space for magtape buffer Cannot allocate space for tape buffer Verify tape and initialize maps %s: %s Tape is not a dump tape Converting to new file system format. .cannot stat .: %s bad block size %ld Tape is not volume 1 of the dump header read failed at %ld blocks no header after volume mark! Cannot find file removal list maxino = %d no memory for active inode map Cannot find file dump list no memory for file dump list Changing volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. %s%s%s%s%sYou have read volumes: %s%ld, Specify next volume #: Volume numbers are positive numerics Mount tape volume %ld Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) none Cannot open %s tape is not dump tape Wrong volume (%ld) Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld sSkipping %ld duplicate record%s. active file into volume 1 End-of-input encountered while extractingWarning: %s %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Dump date: %sthe epoch Dumped from: %sLevel %ld dump of %s on %s:%s Label: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract fifo %s %s: cannot create fifo: %s extract special file %s %s: cannot create special file: %s %s: cannot create file: %s ran off end of tape not at beginning of a file Missing address (header) block for %s at %ld blocks write error extracting inode %d, name %s write: %s seek error extracting inode %d, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s hole in map mid-media short read error. partial block read: %ld should be %ld Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %d continuecontinuation failed: %s End-of-tape encountered partial block read: %d should be %d tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%d) Tape block size is %ld Note: Doing Byte swapping 8l4s31ll2lNote: Doing Quad swapping gethead: unknown inode type %d **oldnewVolume header (%s inode format) begins with record %ldDumped inodes map headerUsed inodes map headerFile header, ino %dFile continuation header, ino %dEnd of tape header; predicted %ld blocks, got %ld blocks(8Hunexpected tape header unknown tape header type %d resync restore, skipped %ld blocks pChecksum error %o, inode %d file %s $FreeBSD: src/sbin/restore/utilities.c,v 1.8 1999/08/28 00:14:09 peter Exp $mktempname: called with TMPNAMEnot on ino listRSTTMP%s%ld%luwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d symbolichardCreate %s link %s->%s warning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s NODELEAFentry type: %s inode number: %lu flags: %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump core$FreeBSD: src/sbin/dump/dumprmt.c,v 1.14.2.1 2000/07/01 06:31:52 ps Exp $Lost connection to remote host. on %s: %s%stcpkshellshell%s/tcp: unknown service who are you? RMT/etc/rmtlogin to %s as %s failed. Connection to %s established. IP_TOS:IPTOS_THROUGHPUT setsockoptTCP_NODELAY setsockoptinvalid user name %s O%.226s %d C closeR%d readW%d writeL%d %d seekS statusI%d %d ioctl%s: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). @(#) Copyright (c) 1980, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/swapon/swapon.c,v 1.8.2.1 2000/07/01 06:31:52 ps Exp $aswnoautoswapon: adding %s as swap device %s: device already in use%susage: swapon [-a] [special_file ...] @(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/umount/umount.c,v 1.22 1999/11/22 04:23:11 dillon Exp $Aafh:t:vonly one -t option may be specifiednfscannot umount %s, %s is mounted there, umount it first/etc/fstab%slt|fstab reading failure/rwrorq%s: unknown mount typemalloc failedstrdup%s: not currently mountedcan't get net id for hostunmount of %s failed%s: unmount from %s Cannot MNT PRCBad MNT RPCcannot remove entry %s:%scalloc)|)4()p*malloc umount -a | -A [-fv] [-h host] [-t type]usage: umount [-fv] special | node%s %s $FreeBSD: src/sbin/mount/vfslist.c,v 1.4 1999/08/28 00:13:27 peter Exp $malloc failed$FreeBSD: src/usr.sbin/rpc.umntall/mounttab.c,v 1.2 2000/01/15 14:28:14 green Exp $a/var/db/mounttab%ld %s %s rcan't open %s mallocwcan't write to %swrite entry %s:%scan't remove %sdelete entries host %sdelete entry %s:%sskip bad line in mounttab with entry %s$FreeBSD: src/sbin/mount_msdos/mount_msdos.c,v 1.19.2.1 2000/07/20 10:35:13 kris Exp $nowin95longnamesshortnamesupdatesyncforceclusterwclusterrunionrdonlysymfollowsuidsuiddirexecdevatimeautorwrogroupquotauserquotasl9u:g:m:o:L:W:stat %smsdosvfsload(msdos)msdos filesystem is not available%s4555555555555555555P55555555555t5555555555555555555554,555555454unknown group id: %sunknown user id: %sinvalid file mode: %s [-s] [-l] [-9] [-L locale] [-W table] bdev dirusage: mount_msdos [-o options] [-u user] [-g group] [-m mask]%s %s /usr/libdata/msdosfs/%srcan't read u2w table row %d near line %d%i%i%i%i%i%i%i%iu2w table: missing item(s) in row %d, line %dcan't read d2u table row %d near line %dd2u table: missing item(s) in row %d, line %dcan't read u2d table row %d near line %du2d table: missing item(s) in row %d, line %d$FreeBSD: src/sbin/mount/getmntopts.c,v 1.9 1999/10/09 11:54:06 phk Exp $,-o %s: option not supported%s: not a directory%s: %s$FreeBSD: src/sbin/mount_cd9660/mount_cd9660.c,v 1.15 1999/10/09 11:54:08 phk Exp $jolietrripgensextattupdateclusterwclusterrunionrdonlysymfollowsuidsuiddirexecdevatimeautorwrogroupquotauserquotaegjo:rs:vcould not determine starting sector, using very first session using starting sector %d cd9660vfsload(cd9660)cd9660 filesystem is not available@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@|@@@@@@@@@@@@@@@@@@usage: mount_cd9660 [-egrv] [-o options] [-s startsector] special node $FreeBSD: src/sbin/mount/getmntopts.c,v 1.9 1999/10/09 11:54:06 phk Exp $,-o %s: option not supported%s: not a directory%s: %s/LtenexEebcdicimageIbinaryAasciiusage: %s [ %s%s | ]Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.typeWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] STOUSTORAPPElocal-filesusage: %s local-files mputContinue with%s: not foundr+wwusage: %s remote-file [ local-file ] local: %sRETRremote-filesusage: %s remote-files mgetonoffand logged inConnected %sto %s. Not connected.Connected for proxy commands to %s. No proxy connection.(none)Gate ftp: %s, server %s, port %s. Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off.Nmap: (in) %s (out) %s Nmap: off.Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT cmds: %s. Command line editing: %s. Macros: %s usage: %s [ on | off ] %s %s. Bell modeEditing modePacket tracingusage: %s [ on | off | bytecount ] mark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark).Verbose modeUse of PORT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] %s: bad gateport value. %ldDisabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD.XCWD %susage: %s local-directory Local directory now %s getcwd: %susage: %s remote-file DELE %smdeletefrom-nameto-nameusage: %s from-name to-name RNFR %sRNTO %s-usage: %s remote-directory local-file nlistNLSTLISToutput to local-file:usage: %s remote-files local-file mlsSHELL/bin/shsh-c%sTry again laterusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed.PWDPWD command not recognized, trying XPWD.XPWDLocal directory %s getcwddirectory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD.XMKD %sRMD %sRMD command not recognized, trying XRMD.XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITE %smodefile-nameusage: %s mode file-name SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:commandusage: %s command ?Ambiguous command.?Invalid command.?Invalid proxy command. Case mappingCarriage Return strippingNtrans off.Nmap off.mapoutusage: %s [mapin mapout] nmap: unbalanced brackets.Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP.XCUPusage: %s [restart_point] restart: Invalid offset `%s' No restart point definedRestarting at %qd for next get, put or append SYSTLimit of 16 macros have already been defined.macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line.macdef: end of file encountered.Macro not defined - 4K buffer exceeded.Restricted data portsfilenameusage: %s filename %s %qd %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". PAGERmoreCan't allocate memory for $PAGER|%s?verboseuserumasktypetracetenexsystemsuniquestructstatussizesitesendportsendruniquerstatusrmdirrhelprestrictrestartresetrrrenameregetrecvquotequitpwdputcproxypromptprogresspreservepassivepageopenntransnmapnlistnewermsendLmputmoremodtimemodemlsmkdirmgetmdirRmdeletemacdeflslpwdlessllcdimageidleChelphashglobgategetftpformexiteditdisconnectrldirdeletedebugcrclosenrchmodcduprcdcasebyebinarybellasciilrappendaccount$!...Can't allocate memory for local dircompleteCan't allocate memory for remote dir %s Must be logged in to complete.macro nameusage: %s macro_name '%s' macro not found. ?Ambiguous command.?Invalid command.Not connected.Can't allocate memory to parse URLhttp://ftp://url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %shost %s, port %s, path %s, save as %s. %s: %sCan't create socketCan't bind to %sCan't connect to %sRequesting %s Requesting %s (via %s) /GET %s%s HTTP/1.0 Writing HTTP request200Error retrieving file: %sContent-Length: Can't open %sWriting %sReading from socketSuccessfully retrieved file.Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %s http fetch aborted.ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.:@/Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'cd*?[]{}Retrieving %s/%s %s/%sgetmget%s: %ssocketbindconnect to address %sTrying %s... connectgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockopt---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUIT%c%c%c421 Service not available, remote server has closed connection.%s: send aborted waiting for remote to finish abort.sentlocal: %s remote: %s -%slocal: %s%s: not a plain file. STORAPPEREST %qdr+w%s %snetout receive aborted waiting for remote to finish abort.receivedRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly.Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: EPSV return code must be 229PASVLPSVPassive mode refused.wrong server: return code must be 227%d,%d,%d,%d,%d,%dwrong server: return code must be 228%d,%d,%d,%d,%d,%d,%d,%d,%d%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dwrong server: return code must be 229%c%c%c%d%cPassive mode address scan failure. Shouldn't happen!setsockopt (reuse address)setsockopt PORTRANGE (ignored)listenEPRT |%d|%s|%d|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dacceptSTOUproxy server does not support third party transfers.No primary connection.PORT %slocal: %s remote: %s abortresetrunique: can't find unique file name.Lost control connection for abort.%cABOR ftphttpFTPSERVERPORT%sftpgateTMPDIR/tmp/FTP_PASSIVE_MODEnopftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumb46adeginpP:s:tUvV%s: %sXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX4LXXXXXXXXXXXXXXXXXXXXX(X@ftp> sorry, input line too long.?Ambiguous command.?Invalid command.Not connected.!$Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46adeginptUvV] [-P port] [-s src_addr] [host [port]] %s host:path[/] %s ftp://host[:port]/path[/] %s http://host[:port]/file macdefmachineaccountpasswdpasswordlogindefaultHOME.%s/.netrc%s/.netrc: %sr%scan't strdup *anameanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.can't strdup *apassRemove account or make file unreadable by others.can't strdup *aacctMissing macdef name argument.Limit of 16 macros have already been defined.Macro definition missing null line terminator.4K macro buffer exceeded.Unknown .netrc keyword %sAlready connected to %s, use close first. tousage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s asciinon-printstreamfile8SYSTRemote system type is %s. 215 UNIX Type: L8binaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$initsorry, arguments too long.(%s) ftpXXXXXX%s/%sunable to create temporary file %swNLSTarcan't find list of remote files, oops.%s %s? Interactive mode: off.Prompting off for duration of %s. %s: not foundSIZE %sMDTM %s%*s %16s1919%03d%02d%02d%02d%02d%02d%04d%02d%02d%02d%02d%02dCan't convert %s to a time. KMGTP %3d%% **********************************************************************************************************************************************************|%.*s%*s| %5qd %c%c --:-- ETA - stalled -%2d: %02d:%02d ETA.AMKs%qd byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d .A>P?emacsContext sensitive argument completionftp-complete^I0isipv6addr: got %d for %sn%s sequence challenge /usr/bin/keyfork!^?offwontwilldontdohelpDisplay send options?Send request for STATUSgetstatusPerform Telnet 'Synch operation'synchSend Telnet End of File CharactereofSend Telnet 'Suspend Process'suspSend Telnet 'Abort Process'abortSend Telnet 'End of Record'eorSend Telnet 'No operation'nopintrinterruptintpSend Telnet Interrupt ProcessipSend Telnet 'Go Ahead' sequencegaSend current escape characterescapeSend Telnet Erase LineelSend Telnet Erase CharacterecbreakSend Telnet BreakbrkSend Telnet 'Are You There'aytSend Telnet Abort outputaoneed at least one argument for 'send' command 'send ?' for help Unknown send argument '%s' 'send ?' for help. Ambiguous send argument '%s' 'send ?' for help. sNeed %d argument%s to 'send %s' command. 'send %s ?' for help. ?Need to be connected first. There is not enough room in the buffer TO the network to process your request. Nothing will be done. ('send synch' will throw away most data in the network buffer, if this might help.) Telnet 'send' error - argument disappeared! SENTUsage: send %s "value" must be from 0 to 255 Valid options are: "%s" '%s': ambiguous argument ('send %s ?' for help). '%s': unknown argument ('send %s ?' for help). '%s': bad value ('send %s ?' for help). %-15s %s setsockopt (SO_DEBUG)Will send carriage returns as telnet . Will send carriage returns as telnet . Already operating in binary mode with remote host. Negotiating binary mode with remote host. Already in network ascii mode with remote host. Negotiating network ascii mode with remote host. Already receiving in binary mode. Negotiating binary mode on input. Already receiving in network ascii mode. Negotiating network ascii mode on input. Already transmitting in binary mode. Negotiating binary mode on output. Already transmitting in network ascii mode. Negotiating network ascii mode on output. print hexadecimal representation of terminal traffic(debugging) toggle printing of hexadecimal terminal datatermdatashow option processingviewing of options processing (debugging)optionsprint user readable output for "netdata"output of "netdata" to user readable format (debugging)prettydumpprint hexadecimal representation of network trafficprinting of hexadecimal network data (debugging)netdataturn on socket level debuggingdebuggingdebug recognize certain control characterslocal recognition of certain control characterslocalcharsmap carriage return on outputmapping of received carriage returnscrmodsending carriage returns as telnet crlfsending of binary dataoutbinaryreceiving of binary datainbinarysending and receiving of binary databinaryskip reading of ~/.telnetrc filedon't read ~/.telnetrc fileskiprcsend interrupt characters in urgent modeautomatic sending of interrupt characters in urgent modeautosynchflush output when sending interrupt charactersflushing of output when sending interrupt charactersautoflush%-15s toggle %s display help informationenabledisable%-15s %s %s Need an argument to 'toggle' command. 'toggle ?' for help. '%s': ambiguous argument ('toggle ?' for help). '%s': unknown argument ('toggle ?' for help). WillWon't%s %s. alternate AYT characterforw2alternate end of line characterforw1character to use for XOFFstopcharacter to use for XONstartcharacter to use to erase a wordworderasecharacter to use for line reprintreprintcharacter to cause a Suspend Processcharacter to use for literal nextlnextcharacter to use to erase a linekillcharacter to use to erase a charactereraseThe following are for local editing in linemodecharacter to cause an EOF character to cause an Abort processquitcharacter to cause an Interrupt Processcharacter to cause an Abort OutputflushoutputThe following need 'localchars' to be toggled truefile to write trace information totracefilerlogin escape characterrlogincharacter to escape back to telnet command modecharacter to toggle local echoing on/offechoTelnet rlogin escape character is '%s'. Telnet escape character is '%s'. Format is 'set Name Value' 'set ?' for help. '%s': unknown argument ('set ?' for help). '%s': ambiguous argument ('set ?' for help). onFormat is 'set togglename [on|off]' 'set ?' for help. %s set to "%s". %s character is '%s'. Need an argument to 'unset' command. 'unset ?' for help. '%s': unknown argument ('unset ?' for help). '%s': ambiguous argument ('unset ?' for help). %s reset to "%s". ?Need to have LINEMODE option enabled first. 'mode ?' for help. Print help informationkludgelineDisable literal character echo-litecho+litechoEnable literal character echolitecho-softtabs+softtabsEnable tab expansionsofttabsDisable character editing-edit+editEnable character editingeditDisable signal trapping-isig+isigEnable signal trappingisigThese require the LINEMODE option to be enabled(or enable obsolete line-by-line mode)Enable LINEMODE optionline(or disable obsolete line-by-line mode)Disable LINEMODE optioncharacterformat is: 'mode Mode', where 'Mode' is one of: 'mode' command requires an argument Unknown mode '%s' ('mode ?' for help). Ambiguous mode '%s' ('mode ?' for help). won't %s. %-15s [%s] %-15s "%s" ?Ambiguous argument '%s'. ?Unknown argument '%s'. Deprecated usage - please use 'set escape%s%s' in the future. new escape character: Escape character is '%s'. Deprecated usage - please use 'toggle crmod' in the future. %s map carriage return on output. Fork failed SHELL/bin/sh-cExeclConnection closed. fromquitbyeVerify remote special character definitionscheckUse remote special character definitionsimportUse local special character definitionsexportNeed an argument to 'slc' command. 'slc ?' for help. '%s': unknown argument ('slc ?' for help). '%s': ambiguous argument ('slc ?' for help). List the current environment variableslistSend an environment variablesendDon't mark an environment variable for automatic exportunexportMark an environment variable for automatic exportUndefine an environment variableundefineDefine an environment variabledefineNeed an argument to 'environ' command. 'environ ?' for help. '%s': unknown argument ('environ ?' for help). '%s': ambiguous argument ('environ ?' for help). only Need %s%d argument%s to 'environ %s' command. 'environ ?' for help. DISPLAYunix:%s%sUSERLOGNAMEPRINTERCannot send '%s': Telnet ENVIRON option not enabled Cannot send '%s': variable not defined %c %-20s %s Connected to %s. notmuchOperating with LINEMODE option LocalNo%s line editing %s catching of signals Operating in obsolete linemode Operating in single character mode Catching signals locally Remote%s character echo %s flow control No connection. status?Already connected to %s open (to) -l-a-susage: telnet [-l user] [-a] [-s src_addr] host-name [port] %s: %s telnetBad source route option: %s Trying %s... telnet: socketsetsockopt (source route)telnet: setsockopt (IP_TOS) (ignored)bindconnect to address %sUnable to connect to remote hostConnection closed by foreign host. skeyenvironzslctoggleunsetsetopenmodedisplaylogoutclose%s> %s ?Ambiguous command ?Invalid command Commands may be abbreviated. Commands are: %-*s %s ?Ambiguous help command %s ?Invalid help command %s HOME/.telnetrcrDEFAULT?Ambiguous command: %s ?Invalid command: %s ?Need to be connected first for %s. [host-name [port]][-r] [-s src_addr] [-n tracefile] [-4] [-6] [-8] [-E] [-L] [-N] [-S tos] [-a] [-c] [-d] [-e char] [-l user]Usage: %s %s%s%s%s rlog468EKLNS:X:acde:fFk:l:n:rs:t:x%s: Warning: -S ignored, no parsetos() support. %s: Warning: -f ignored, no Kerberos V5 support. %s: Warning: -F ignored, no Kerberos V5 support. %s: Warning: -k ignored, no Kerberos V4 support. %s: Warning: -t ignored, no TN3270 support. %s: Warning: -x ignored, no ENCRYPT support. -l-sNPNPNPPPPPPPPPPPPNOPPPPPOP OPPPPOPPPPPPPPPPPPP0OP@OPO`OxOPPPPOOPOPPPOOOPPPOselecthXhXW8X`XhXXX@XXXHXPXXX X(X0X0XSetSockOptsleep(5) from telnet, after select: %s SENTldlddlddddddddddddddddddddddddddddddddDISPLAYffffff$ffffffffffffffffffffffffffff\fDfffffUNKNOWNTERM%c%c%c%c%s%c%cNo room in buffer for terminal type. %c%c%c%c%ld,%ld%c%clm_will: not enough room in buffer kooooooo@l mmoooonlm_will: no command!!! lm_wont: no command!!! lm_do: no command!!! lm_do: not enough room in buffer lm_dont: no command!!! lm_mode: not enough room in buffer localremoteremote defaultSpecial characters are %s values slc_import: not enough room slc_end_reply: not enough room env_opt_start: malloc()/realloc() failed!!! env_opt_add: realloc() failed!!! USERPRINTERSYSTEMTYPEJOBACCTRCVDIn SUBOPTION processing, RCVDDXxLL<<<<<<<<\l|z close Remote side does not support STATUS option IACDONTDOWONTWILLSBGAELECAYTAOIPBRKDMARKNOPSEEORABORTSUSPEOFNEW-ENVIRONENCRYPTAUTHENTICATIONOLD-ENVIRONXDISPLOCLINEMODELFLOWTSPEEDNAWSX.3 PAD3270 REGIMETTYLOCOUTPUT MARKINGTACACS UIDEND OF RECORDTERMINAL TYPESEND LOCATIONSUPDUP OUTPUTSUPDUPDATA ENTRY TERMINALBYTE MACROLOGOUTEXTEND ASCIINAOLFDNAOVTDNAOVTSNAOFFDNAOHTDNAOHTSNAOCRDNAOPNAOLRCTETIMING MARKSTATUSNAMESUPPRESS GO AHEADRCPECHOBINARYEEOLEBOLEWRECROVERINSRTMCEOLMCBOLMCWRMCWLMCRMCLFORW2FORW1XOFFXONLNEXTRPEWSYNCH0-wCannot open %s. (standard output)%c 0x%x %c%.2x%.2x %s IAC %s%s IAC %d%s %s %sEXOPL%d%s %d %dresp DO_DONT %s: %d resp DO_DONT %d: %d want DO %s want DO %d want DONT %s want DONT %d DO %s DO %d resp WILL_WONT %s: %d resp WILL_WONT %d: %d want WILL %s want WILL %d want WONT %s want WONT %d WILL %s WILL %d RCVDSENT%s IAC SB (terminated by %s %d , not IAC SE!) (Empty suboption???)TERMINAL-TYPE IS "%.*s"SEND- unknown qualifier %d (0x%x).TERMINAL-SPEED (empty suboption???) IS %.*s SEND %d (unknown) ?%d?TOGGLE-FLOW-CONTROL OFF ON RESTART-ANY RESTART-XON %d %d (%d)LINEMODE WILL WONT DO DONT (no option???)Forward Mask %x%d (unknown) %dSLC %s NOSUPPORT CANTCHANGE VARIABLE DEFAULT|FLUSHOUT|FLUSHIN|ACK%s%s%s(0x%x) %d;MODE (no mode???)|LIT_ECHO|SOFT_TAB|TRAPSIG|EDIT%s%s%s%s%s (0x%x) ?0x%x? IS IS %s %s %s %d SB SEX-DISPLAY-LOCATION NEW-ENVIRON IS SEND INFO " VALUE " VAR " ESC " USERVAR " %03o %s (unknown)УPPH<LԤܤĤ̤@(#)cl_bsd.c 8.29 (Berkeley) 7/1/96@(#)cl_funcs.c 10.50 (Berkeley) 9/24/96smcuprmcupError: move: l(%u) c(%u) o(%u)xterm]0;%susage: ex [-eFRrSsv] [-c command] [-t tag] [-w size] [file ...] usage: vi [-eFlRrSv] [-c command] [-t tag] [-w size] [file ...] %s@(#)cl_main.c 10.36 (Berkeley) 10/14/96TERMunknown]0;%s/dev/ttytcgetattr%s: No terminal database found %s: %s: unknown terminal type signal-reset%s:%s @(#)cl_read.c 10.15 (Berkeley) 9/24/96Lxinputlines=%lucolumns=%lu@(#)cl_screen.c 10.49 (Berkeley) 9/24/96016|Vi's standard input and output must be a terminalTERMLINESCOLUMNS%s%s: unknown terminal typetcgetattrtcsetattrcupsmsormsoelcuu1%lu@(#)cl_term.c 10.22 (Berkeley) 9/15/96юώÎ}{oki_YWMGE4/,  ލڍ׍cursor upkkcuu1cursor rightlkcuf1delete to end of screendGkedscroll upkripage upkpppage downknpcursor lefthkcub1delete lineddkdl1insert at cursorikich1go to sol^khomego to eol$kllscroll downkinddelete to eolDkelcursor downjkcud1delete characterxkdch1insert lineOkil1D@ <8lakahajakf%d233|This terminal has no %s keyfunction key %dstderr%s046|messages not turned on: %s045|messages not turned off: %sTERMlinestigetnum: linescolstigetnum: colsLINESCOLUMNS@(#)cut.c 10.10 (Berkeley) 9/15/96 $@(#)delete.c 10.12 (Berkeley) 10/23/96002|Line length overflow$FreeBSD: src/contrib/nvi/common/exf.c,v 1.3 2000/01/10 09:17:46 kris Exp $/tmp%s/vi.XXXXXXXXXX237|Unable to create temporary file238|Warning: %s is not a regular file%s239|%s already locked, session is read-only%s/%s-c option240|%s: remove241|%s: close242|%s: remove243|%s: remove244|Read-only file, not written; use ! to override245|Read-only file, not written246|%s exists, not written; use ! to override247|%s exists, not written248|Partial file, not written; use ! to override249|Partial file, not written250|%s: file modified more recently than this copy; use ! to override251|%s: file modified more recently than this copy252|%s: write lock was unavailableaw254|%s: WARNING: FILE TRUNCATED256|%s: new file: %lu lines, %lu characters315|%s: appended: %lu lines, %lu characters257|%s: %lu lines, %lu characters258|%s expanded into too many file names.%d259|%s: not a regular file260|%s: not owned by you261|%s: accessible by a user other than the owner262|File modified since last complete write; write or use ! to override263|File modified since last complete write; write or use :edit! to override264|File modified since last complete write; write or use ! to override265|File is a temporary; exit will discard modifications266|File readonly, modifications not auto-written@(#)key.c 10.33 (Berkeley) 9/24/96079|No non-printable character found0123456789abcdef01234567276|Unexpected character event277|Unexpected end-of-file event279|Unexpected interrupt event280|Unexpected quit event281|Unexpected repaint event285|Unexpected string event286|Unexpected timeout event316|Unexpected resize event287|Unexpected write eventT`lx@(#)line.c 10.21 (Berkeley) 9/15/96003|unable to delete line %lu004|unable to append to line %lu005|unable to insert at line %lu006|unable to store line %lu007|unable to get last line008|Error: unable to retrieve line %lu@(#)log.c 10.8 (Berkeley) 3/6/96009|Log file/usr/src/usr.bin/vi/../../contrib/nvi/common/log.c010|Logging not being performed, undo not possible011|No changes to undodd8012|Logging not being performed, undo not possibleLLLL!013|Logging not being performed, roll-forward not possible014|No changes to re-do,TT015|%s/%d: log put error267|Log restarted@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1992, 1993, 1994, 1995, 1996 Keith Bostic. All rights reserved. @(#)main.c 10.48 (Berkeley) 10/11/96exnexnviewviewc:eFGlRrSst:vw:only one -c command may be specified.only one of -r and -t may be specified.only one tag file may be specified.-s option is only applicable to ex.window=%sXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXtXXXXXXXXXXXXXHPex/vi: %s%.*s---c$-s%s: %s @(#)mark.c 10.13 (Berkeley) 7/19/96017|Mark %s: not set018|Mark %s: the line was deleted019|Mark %s: cursor position no longer exists@(#)msg.c 10.48 (Berkeley) 9/15/96020|Error: %s, %d: : %s%.*s+p,S,p,,XL@5+299|yanked298|shifted297|moved296|joined295|deleted294|changed293|addedvl301|lines300|line%lu 317|%d files to edit021|new file022|name changed023|modified024|unmodified025|UNLOCKED026|readonly028|empty file027|line %lu of %lu [%lu%%]029|line %luLC_MESSAGESLANG%s%sVI_MESSAGE_CATALOG030|The file %s is not a message catalog268|confirm? [ynq]269|Press any key to continue: 270|Press any key to continue [: to enter more ex commands]: 161|Press Enter to continue: 275| cont?271|Press any key to continue [q to quit]: 9999:$:@(#)options.c 10.51 (Berkeley) 10/14/966a+!aӪȪdd}dukdeb`c[dVPFA81c)Ld"dLddLdpdکԩͩǩd @wl@cYQd@GB= 7/'8ee `e f TfڨѨȨwriteanywrapscanwrapmarginwraplenwindownamewindowwarnw9600w300w1200verbosettywerasetimeouttildeoptersetermtagstaglengthtabstopsourceanyslowopensidescrollshowmodeshowmatchshiftwidthshellmetashellsecuresectionssearchincrscrollrulerreportremapredrawrecdirreadonlypromptprintpathparagraphsoptimizeopenoctalnumbernoprintmsgcatmodelinemesgmatchtimemagiclocklistlisplinesleftrightkeytimeignorecaseiclowerhardtabsgtagsmodeflashfilecextendedexrcerrorbellsescapetimeedcompatibledirectorycommentcolumnsceditcdpathbeautifybackupautowriteautoprintautoindentaltwerase   ߬ܬ٬Ϭ̬"Ȭ%ì&,*024:786>=B<??INI~K{LxMwswmwlwiwawttytypettytstotltagswsmdsmslowshsectscrroreparaoptnumodelinesliichtgtexedebdircobfawapaiCDPATH:cdpath=%sTMPDIR/tmpdirectory=%sescapetime=6keytime=6matchtime=7/usr/share/vi/catalog/msgcat=%sreport=5paragraphs=IPLPPPQPP LIpplpipbppath=%s/var/tmp/vi.recoverrecdir=%ssections=NHSHH HUnhshSHELL/bin/shshell=%sshellmeta=~{[*?$`'"\shiftwidth=8sidescroll=16tabstop=8tags=%sscroll=%ldwindow=%lu031|Unable to set default %s optionall032|Usage: %s291|set: the %s option may not be turned off313|set: the %s option may never be turned on034|set: [no]%s option doesn't take a value035|set: %s option isn't a boolean036|set: %s option: %s037|set: %s option: %s: value overflow038|set: %s option: %s is an illegal number314|set: the %s option may never be set to 0039|set: %s option isn't a boolean305|No %s edit option specified%ld%*s no%s%s%s=%ld%s="%s"set %s set no%s set %s=%-3ld set 033|set: no %s option: 'set all' gives all option values@(#)options_f.c 10.25 (Berkeley) 7/12/96040|Screen columns too small, less than %d041|Screen columns too large, greater than %d042|Screen lines too small, less than %d043|Screen lines too large, greater than %d044|The lisp option is not implemented048|The paragraph option must be in two character groups049|The section option must be in two character groups@(#)put.c 10.11 (Berkeley) 9/23/96053|The default buffer is empty054|Buffer %s is empty@(#)screen.c 10.15 (Berkeley) 9/15/96@(#)search.c 10.25 (Berkeley) 6/30/96072|File empty; nothing to search073|Reached end-of-file without finding the pattern074|No previous search pattern075|Pattern not found076|Reached top-of-file without finding the pattern077|Search wrappedyyyyyy078|Searching...@(#)seq.c 10.10 (Berkeley) 3/30/96 %s@(#)recover.c 10.21 (Berkeley) 9/15/96%s055|Files with newlines in the name are unrecoverable%s/vi.XXXXXX056|Modifications not recoverable if the session fails057|Copying file for recovery...058|Preservation failed: %s059|Modifications not recoverable if the session fails060|File backup failed: %s061|Copying file for recovery...062|Information on user id %u not found%s/recover.XXXXXX063|Unable to lock recovery filePrecedence: bulkSubject: Nvi saved the file To: From: root (Nvi recovery program)Reply-To: rootX-vi-recover-path: X-vi-recover-file: %s%s %s%s %s %s %s%s %s%s %s -r : to this file using the -r option to You can recover most, if not all, of the changes , when it was saved for recovery. on the machine was editing a file named , the user On %s%.24s%s%s%s%s%s%s%s%s%s%s%s%s%s%s 064|Recovery file buffer overrun065|Recovery file.recdir: %srecover.r+066|%s: malformed recovery file%.24s: %s vi: no files to recover. %s/%s067|%s: malformed recovery file068|No files named %s, readable by you, to recover069|There are older versions of this file for you to recover070|There are other files for you to recover/usr/sbin/sendmail071|not sending email: %s%s -t < %s@(#)util.c 10.11 (Berkeley) 9/15/96@(#)ex.c 10.57 (Berkeley) 10/10/96script 170|Interrupted!#&*<=>@~080|Unknown command name1bca1082|%s: command not available in ex mode083|Count may not be zero084|%s: bad line specification085|Internal syntax table error (%s: %s)lr086|Usage: %s088|Flag offset to before line 1089|Flag offset past end-of-file090|@ with range running when the file/screen changed091|Global/v command running when the file/screen changed092|Ex command failed: pending commands discarded093|Ex command failed: mapped keys discarded22222222222222222222222228DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDlDDDįDDDDDDDDDDxDDDDDDDDDDDDDDDDȸ094|The second address is smaller than the first-8888888888888888888888-8888888888|88888888888888$0123456789'\/?.+-^095|No mark name supplied096|\ not followed by / or ?097|Reference to a line number less than 0L @098|The %s command is unknown099|Address value overflow100|Address value underflow101|Illegal address combination102|Illegal address: only %lu lines in the file103|Illegal address: the file is empty104|The %s command doesn't permit an address of 0@(#)ex_abbrev.c 10.7 (Berkeley) 3/6/96105|No abbreviations to display106|Abbreviations must end with a "word" character107|Abbreviations may not contain tabs or spaces108|Abbreviations may not mix word/non-word characters, except at the end109|"%s" is not an abbreviation@(#)ex_append.c 10.30 (Berkeley) 10/23/96 273|Entering ex input mode.@(#)ex_args.c 10.16 (Berkeley) 7/13/96111|No more files to edit112|No previous files to edit113|No previous files to rewind114|No file list to display ][%s%s%s@(#)ex_argv.c 10.26 (Berkeley) 9/20/96echo 115|No previous command to replace "!"116|No filename to substitute for %%117|No filename to substitute for #./%s304|Shell expansion failed289|Shell expansions not supported when the secure edit option is setpiperfdopenvfork-c118|Error: execl: %s119|I/O error: %s@(#)ex_at.c 10.12 (Berkeley) 9/15/96@(#)ex_bang.c 10.33 (Berkeley) 9/23/96!!%s 303|File modified since last write.! @(#)ex_cd.c 10.10 (Berkeley) 8/12/96120|File modified since last complete write; write or use ! to overrideHOME121|Unable to find home directory location%s/%s122|New current directory: %s%s@(#)ex_cmd.c 10.20 (Berkeley) 10/10/962 `A2 =  e $Z B=`20 1. , B<!) 8' (* {hc_@2 =0 d@$2 = 4 4x@11 & : q`H: >3.: 11 A `<0 ` ` dC wT `HT @  _ `` `` + B# rj ]HA %   4`Q @J.!d)  @(ȶ ( ! SF   $ $` 4 $Ĺ $w `,*` %f @replace previous RE with previous replacement string,[line [,line]] ~ [cgr] [count] [#lp]~display different screens of the file[line] z [-|.|+|^|=] [count] [flags]3c01zcopy lines to a cut buffer[line [,line]] ya[nk] [buffer] [count]bcayankexit[line [,line]] x[it][!] [file]xitwrite the file and exit[line [,line]] wq[!] [>>] [file]wqwrite the file and switch to the next file[line [,line]] wn[!] [>>] [file]wnwrite the file[line [,line]] w[rite][!] [ !cmd | [>>] [file]]writedisplay vi key usage statement[viu]sage [key]viusageedit another file (from vi mode only)[Vv]i[sual][!] [+cmd] [file]enter visual (vi) mode from ex mode[line] vi[sual] [-|.|+|^] [window_size] [flags]2c11visualdisplay the program version informationversionexecute a global command on lines NOT matching an RE[line [,line]] v [;/]RE[;/] [commands]vdelete an input or command mapunm[ap][!] word!w1runmapdelete an abbreviationuna[bbrev] wordunabbreviateundo the most recent changeu[ndo]undorun the tcl interpreter with the commandtc[l] cmdtcldiscard all tagstagt[op][!]tagtopmove to the previous tagtagpr[ev][!]tagprevreturn to the previous group of tagstagp[op][!] [number | file]tagpopmove to the next tagtagn[ext][!]tagnext[Tt]a[g][!] [string]tag[line [,line]] t line [flags]tsu[spend][!]suspendsuspend the edit sessionst[op][!]stopread a file of ex commandsso[urce] filef1rsourcesuspend editing and run a shellsh[ell]shellset options (use ":set all" to see all options)se[t] [option[=[value]]...] [nooption ...] [option? ...] [all]wNsetrun a shell in a screensc[ript][!] [file]scriptsubstitute on lines matching an RE[line [,line]] s [[/;]RE[/;]repl[/;] [cgr] [count] [#lp]]edit the file containing the tag[Rr]ta[g][!] [string]!w1ortagre-edit all the files in the file argument listrew[ind][!]rewindgrow or shrink the current screenresize [+-]rowsc+resizerecover a saved filerecover[!] filerecoverappend input from a command or file to the line[line] r[ead] [!cmd | [file]]readexit ex/viq[uit][!]quitappend a cut buffer to the line[line] pu[t] [buffer]putedit the previous file in the file argument list[Pp]rev[ious][!]previouspreserve an edit session for recoverypre[serve]preserverun the perl interpreter with the command, on each lineperld[o] cmdperldorun the perl interpreter with the commandpe[rl] cmdperldisplay lines[line [,line]] p[rint] [count] [#l]printenter "open" mode (not implemented)[line] o[pen] [/RE/] [flags]openchange display to number lines[line [,line]] nu[mber] [count] [l]numberedit (and optionally specify) the next file[Nn][ext][!] [+cmd] [file ...]!fNnextwrite a .exrc filemkexrc[!] file!f1rmkexrcmap input or commands to one or more keysmap[!] [keys replace]!Wmap[line] ma[rk] keymarkmove lines elsewhere in the file[line [,line]] m[ove] linelmovedisplay lines in an unambiguous form[line [,line]] l[ist] [count] [#]listmark a line position[line] k keykjoin lines into a single line[line [,line]] j[oin][!] [count] [flags]!ca1joininsert input before a line[line] i[nsert][!]insertdisplay help statementhe[lp]helpexecute a global command on lines matching an RE[line [,line]] g[lobal][!] [;/]RE[;/] [commands]globalbring a backgrounded screen into the foreground[Ff]g [file]fgdisplay (and optionally set) file namef[ile] [name]filedisplay ex command usage statement[exu]sage [command]w1oexusage[Ee]x[!] [+cmd] [file]exbegin editing another file[Ee][dit][!] [+cmd] [file]f1oeditdisplay buffers, connections, screens or tagsdisplay b[uffers] | c[onnections] | s[creens] | t[ags]w1rdisplaydelete lines from the file[line [,line]] d[elete][flags] [buffer] [count] [flags]bca1deletecreate a set of tags using a cscope commandcs[cope] command [args]!scscopecopy lines elsewhere in the file[line [,line]] co[py] line [flags]l1copychd[ir][!] [directory]chdirchange the current directorycd[!] [directory]!f1ocdchange lines to input[line [,line]] c[hange][!] [count]!cachangeput a foreground screen into the backgroundbgdisplay file argument listar[gs]argsspecify an input abbreviationab[brev] [word replace]Wabbreviateappend input to a line[line] a[ppend][!]append@ [buffer]@shift lines right[line [,line]] >[>...] [count] [flags]>display line number[line] = [flags]1=shift lines left[line [,line]] <[<...] [count] [flags]<execute a buffer* [buffer]b*repeat the last subsitution[line [,line]] & [cgr] [count] [#lp]s&display numbered lines[line [,line]] # [count] [l]ca1#filter lines through commands or run commands[line [,line]] ! commandS!scroll lines^D@(#)ex_cscope.c 10.13 (Berkeley) 9/15/964|gbT@x @ H `Discard all current cscope connectionsresetkill numberKill a cscope connectionkillhelp [command]Show help for cscope commandshelpfind c|d|e|f|g|i|s|t buffer|pattern c: find callers of name d: find all function calls made from name e: find pattern f: find files with name as substring g: find definition of name i: find files #including name s: find all uses of name t: find assignments to nameQuery the databases for a patternfindadd file | directoryAdd a new cscope databaseadd309|Use "cscope help" for helpCSCOPE_DIRS :cscope.out%s/%scscope.tpath%s:pipevforkcd '%s' && exec cscope -dl -f %s-csh/bin/shexecl: %swr310|No cscope connections running%d%s 278|No matches for querysgdct efi311|%s: unknown search type: use one of %scscope: %d lines%1[ ]%s: "%s" %s doesn't match any cscope command Command: %s (%s) Usage: %s cscope commands: %*s: %s 312|%d: no such cscope session1No cscope connections. %2d %s (process %lu) @(#)ex_delete.c 10.9 (Berkeley) 10/23/96@(#)ex_display.c 10.12 (Berkeley) 4/10/96buffersconnectionsscreenstags123|No cut buffers to displaydefault buffer (line mode) (character mode)********** %s%s @(#)ex_edit.c 10.10 (Berkeley) 4/27/96@(#)ex_equal.c 10.10 (Berkeley) 3/6/96%ld @(#)ex_file.c 10.12 (Berkeley) 7/12/96@(#)ex_filter.c 10.34 (Berkeley) 10/23/96piperfdopenvfork-cexecl: %sfilterforkwparent-writerfilter read@(#)ex_global.c 10.22 (Berkeley) 10/10/96124|The %s command can't be used as part of a global or v commandpp@(#)ex_init.c 10.26 (Berkeley) 8/12/96/etc/vi.exrcNEXINITEXINITHOME.nexrc%s/%s.exrc125|%s/%s: not sourced: not owned by you or root126|%s/%s: not sourced: not owned by you127|%s/%s: not sourced: writeable by a user other than the owner128|%s: not sourced: not owned by you or root129|%s: not sourced: not owned by you130|%s: not sourced: writeable by a user other than the owner@(#)ex_join.c 10.10 (Berkeley) 9/15/96131|No following lines to join.?!@(#)ex_map.c 10.9 (Berkeley) 3/6/96132|No input map entries133|No command map entries134|The %s character may not be remapped135|"%s" isn't currently mapped@(#)ex_mark.c 10.8 (Berkeley) 3/6/96136|Mark names must be a single character@(#)ex_mkexrc.c 10.11 (Berkeley) 3/6/96.exrc137|%s exists, not written; use ! to override%swabbreviate map map! 138|New exrc file: %s@(#)ex_move.c 10.10 (Berkeley) 9/15/96139|Destination line is inside move range@(#)ex_open.c 10.7 (Berkeley) 3/6/96140|The open command requires that the open option be set141|The open command is not yet implemented@(#)ex_preserve.c 10.12 (Berkeley) 4/27/96142|Preservation of this file not possible143|File preserved@(#)ex_print.c 10.18 (Berkeley) 5/12/96%6lu TOOBIG $ [ynq]%c@(#)ex_put.c 10.7 (Berkeley) 3/6/96@(#)ex_quit.c 10.7 (Berkeley) 4/27/96@(#)ex_read.c 10.38 (Berkeley) 8/12/96!!%s ! r%s145|Only regular files and named pipes may be read146|%s: read lock was unavailable147|Reading...148|%s: %lu lines, %lu characters@(#)ex_screen.c 10.11 (Berkeley) 6/29/96149|No background screens to display @(#)ex_script.c 10.30 (Berkeley) 9/24/96150|The script command is only available in vi modetcgetattrptyforkemacsTERMemacs:TERMCAPtEMACS-iexecl: %sselectError: timed outError: shell: EOFshell151|No command to execute script-shellttypqrs0123456789abcdef@(#)ex_set.c 10.7 (Berkeley) 3/6/96@(#)ex_shell.c 10.38 (Berkeley) 8/19/96%s -i vfork-cexecl: %swaitpid; core dumped ...%.*s%s: received signal: %s%s%.*s%s: exited with status %dG; 1$  ~y fS C8) t\Filesize limit exceededCputime limit exceededWindow size changesVirtual timer expiredUser defined signal 2User defined signal 1Urgent I/O conditionStopped (tty output)Stopped (tty input)SuspendedTrace/BPT trapTerminatedBad system callSuspended (signal)Segmentation faultQuitProfiling timer expiredBroken pipeKilledIOT trapI/O possibleInterruptInformation requestIllegal instructionHangupFloating point exceptionEMT trapContinuedChild exitedBus errorAlarm clockAbort trapUnknown signal: %d@(#)ex_shift.c 10.11 (Berkeley) 9/15/96152|shiftwidth option set to 0@(#)ex_source.c 10.12 (Berkeley) 8/10/96%s@(#)ex_stop.c 10.10 (Berkeley) 3/6/96@(#)ex_subst.c 10.37 (Berkeley) 9/15/96153|Count overflow154|Count underflow155|Regular expression specified; r flag meaningless156|The #, l and p flags may not be combined with the c flag in vi mode169|Confirm change? [n]157|No match foundi i i i i i i i i i i i i i i i i i i i i i i i i i h i i i i i i i g i h i i  h  h  h  h  h  h  h  h  h  h i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i h i i i 4i i i i i Hi i i i Ti i `i [[:<:]][[:>:]]^.[]$*([ ]|/\*([^*]|\*/)*\*/)*\^.[]$*+?()|{}RE error: %s p p p p p p p p p           p p p p p p p p p p p  p p p p p p @ p p p p p p p p ` p p p p p p p p p p p p p p p  p p p p p p 0 p p p p p p p p P @(#)ex_tag.c 10.36 (Berkeley) 9/15/96158|No previous tag entered282|Already at the last tag of this group255|Already at the first tag of this group159|Less than %s entries on the tags stack; use :display t[ags]160|No file %s on the tags stack to return to; use :display t[ags]292|Display too small.%2d ... %*.*s %*.*s* %s%.*s 164|%s: the tag's line number is past the end of the file165|The tags stack is empty166|%s: search pattern not foundrxxglobal -%s '%s'r162|%s: tag not found%s 163|%s: corrupted tag in %smunmapclose%s/%s@(#)ex_txt.c 10.17 (Berkeley) 10/10/96 Ч   ܧ  ܧ ܧ ܧ ܧ   ԩ     4    >         %c%6lu %.*s@(#)ex_undo.c 10.6 (Berkeley) 3/6/96@(#)ex_usage.c 10.13 (Berkeley) 5/3/96To see the list of vi commands, enter ":viusage" To see the list of ex commands, enter ":exusage" For an ex command usage statement enter ":exusage [cmd]" For a vi key usage statement enter ":viusage [key]" To exit, enter ":q!" The %.*s command is unknown Command: %s Usage: %s ^D%*s: %s The %s key has no current meaning Key:%s%s Usage: %s %s @(#)ex_util.c 10.23 (Berkeley) 6/19/96167|%d more files to edit168|Buffer %s is empty144|%s: expanded into too many file names283|The %s command requires the ex terminal interface272|That form of %s requires the ex terminal interface274|Command failed, no file read in yet.173|The %s command requires that a file have already been read in171|No previous buffer to execute172|No previous regular expression230|This screen may not be suspended290|The %s command is not supported when the secure edit option is set284|That form of %s is not supported when the secure edit option is set174|Usage: %s< D T \ d |      @(#)ex_version.c 10.31 (Berkeley) 8/22/96Version 1.79 (10/23/96) The CSRG, University of California, Berkeley.@(#)ex_visual.c 10.13 (Berkeley) 6/28/96175|The visual command requires that the open option be set%luz%c%lu%luz%c @(#)ex_write.c 10.30 (Berkeley) 7/12/96! 253|Writing...%s@(#)ex_yank.c 10.7 (Berkeley) 3/6/96@(#)ex_z.c 10.10 (Berkeley) 3/6/96---------------------------------------- @(#)ex_tcl.c 8.10 (Berkeley) 9/15/96302|Vi was not loaded with a Tcl interpreter@(#)ex_perl.c 8.10 (Berkeley) 9/15/96306|Vi was not loaded with a Perl interpreter@(#)getc.c 10.10 (Berkeley) 3/6/96177|Empty file    < @(#)v_at.c 10.8 (Berkeley) 4/27/96 %lu@(#)v_ch.c 10.8 (Berkeley) 3/6/96     4 D T d t 178|No previous F, f, T or t search179|%s not found@(#)v_cmd.c 10.9 (Berkeley) 3/28/96 "@TB) )  )(((t  (( \(D(  :( (\ (((  D(' D'' ''` HD'' Dj'T' DJ'6' 3'"'  @''$   '&&& &&l && &&u&@&, ;&%&  @"& &, &%  D%%  ,%@%  %$ D$$X "@D$$ $$ (C$$ "@Dl$V$0 "@DM$4$ HD+$$  D## HD##k#P# "@B#0#  @.## ""x  D""  ,"u"p  ,_"@" "@2""  ""  !!c  D!!!!!{!_  Dr!X!T  FE! !L HE!  E       p b l EY @ 0 E> %  "@#       ,   n]?  F,X  [  Dh  aTk Q;  @D8#  @D x  D @Dp "B  c  D{X  ]I  +_  D  F(  D0  r DiS DJ6  D-P   "@#       |g  V>  F+Y  [  DLg  h  `Hi @ , "@D  D8 "@DU   ~ reverse case[count]~ } move forward paragraph[count]} | move to column[count]| { move back paragraph[count]{ z reposition the screen[line]z[window_size][-|.|+|^|] y copy text to motion into a cut buffer[buffer][count]y[count]motion x delete character[buffer][count]x w move to next word[count]w u undo last changeu t before character in line forward search[count]t character s substitute character[buffer][count]s r replace character[count]r character p insert after cursor from buffer[buffer]p o append after line[count]o n repeat last search m set markm[a-z] l move right by columns[count]l k move up by lines[count]k j move down by lines[count]j i insert before cursor[count]i h move left by columns[count]h f character in line forward search[count]f character e move to end of word[count]e d delete to motion[buffer][count]d[count]motion c change to motion[buffer][count]c[count]motion b move back word[count]b a append after cursor[count]a ` move to mark`[`a-z] _ move to first non-blank_ ^ move to first non-blank^]] move forward section]][[ move back section[[ZZ save file and exitZZ Y copy line[buffer][count]Y X delete character before cursor[buffer][count]X W move to next bigword[count]W U Restore the current lineU T before character in line backward search[count]T character S substitute for the line(s)[buffer][count]S R replace characters[count]R Q switch to ex modeQ P insert before cursor from buffer[buffer]P O insert above line[count]O N reverse last searchn M move to screen middleM L move to screen bottom[count]L J join lines[count]J I insert before first nonblank[count]I H move to count lines from screen top[count]H G move to line[count]G F character in line backward search[count]F character E move to end of bigword[count]E D delete to end-of-line[buffer]D C change to end-of-line[buffer][count]C B move back bigword[count]B A append to the line[count]A @ execute buffer@buffer ? search backward?RE[? offset] > shift lines right to motion[count]>[count]motion < shift lines left to motion[count]<[count]motion ; repeat last F, f, T or t search[count]; : ex command:command [| command] ... 0 move to first character0 / search forward/RE[/ offset] . repeat the last command. - move up by lines (to first non-blank)[count]- , reverse last F, f, T or t search[count], + move down by lines (to first non-blank)[count]+ ) move forward sentence[count]) ( move back sentence[count]( ' move to mark (to first non-blank)'['a-z] & repeat substitution& % move to match% $ move to last column [count]$ # number increment/decrement[count]# +|-|# ! filter through command(s) to motion[count]![count]motion command(s) move right by columns[count]' '^^ switch to previous file^^^] tag push cursor word^] ^\ switch to ex mode^\^[ exit input mode, cancel partial commands^[ ^Z suspend editor^Z^Y page up by lines[count]^Y^W move to next screen^W^V input a literal character^V^U half page up (set count)[count]^U^T tag pop^T^R redraw screen^R^P move up by lines[count]^P^N move down by lines[count]^N^M move down by lines (to first non-blank)[count]^M^L redraw screen^L^J move down by lines[count]^J^H move left by characters[count]^H^G file status^G^F scroll down by screens[count]^F^E scroll down by lines[count]^E^D scroll down by half screens (setting count)[count]^D^C interrupt an operation (e.g. read, write, search)^C^B scroll up by screens[count]^B^A search forward for cursor word[count]^A@(#)v_delete.c 10.9 (Berkeley) 10/23/96@(#)v_ex.c 10.42 (Berkeley) 6/28/96207|The Q command requires the ex terminal interface <>suspend180|No previous file to edit!307|No ex command to execute@(#)v_increment.c 10.12 (Berkeley) 3/19/96*****%#0*lo0x%0*lx0X%0*lX%+ld%ldabcdefABCDEF181|Cursor not in a number182|Resulting number too large183|Resulting number too small@(#)v_init.c 10.8 (Berkeley) 3/30/96@(#)v_itxt.c 10.16 (Berkeley) 10/23/96@(#)v_left.c 10.7 (Berkeley) 3/6/96@(#)v_mark.c 10.8 (Berkeley) 9/20/96@(#)v_match.c 10.8 (Berkeley) 3/6/96184|No match character on this line185|Matching character not found@(#)v_paragraph.c 10.7 (Berkeley) 3/6/96@(#)v_put.c 10.5 (Berkeley) 3/6/96        @(#)v_redraw.c 10.6 (Berkeley) 3/6/96@(#)v_replace.c 10.17 (Berkeley) 6/30/96186|No characters to replace    T 4 T T T T $ @(#)v_right.c 10.7 (Berkeley) 3/6/96@(#)v_screen.c 10.10 (Berkeley) 4/27/96308|Enter to execute a command, :q to exit187|No other screen to switch to@(#)v_scroll.c 10.9 (Berkeley) 4/27/96@(#)v_search.c 10.18 (Berkeley) 9/19/96search+%lu188|Characters after search string, line offset and/or z command[[:>:]][[:<:]]%s%s%s189|No previous search pattern190|Search wrapped to original position@(#)v_section.c 10.7 (Berkeley) 3/6/96@(#)v_sentence.c 10.7 (Berkeley) 3/6/96                                                                                     @(#)v_status.c 10.9 (Berkeley) 5/15/96@(#)v_txt.c 10.87 (Berkeley) 10/13/96191|Abbreviation exceeded expansion limit: characters discarded 192|Illegal character; quote to enter! l! l! * ! |! ! ! ! ! ! 2 , , D2 1 D2 D2 % t* D2 82 % 1 1 D2  . 1 2 . , 193|Already at the beginning of the insert%s %s%*s Unmatched %s194|No more characters to erase@(#)v_ulcase.c 10.7 (Berkeley) 3/6/96@(#)v_undo.c 10.5 (Berkeley) 3/6/96@(#)v_util.c 10.11 (Berkeley) 6/30/96195|Movement past the end-of-file196|Movement past the end-of-line197|No cursor movement made198|Already at the beginning of the file199|Movement past the beginning of the file200|Already in the first column201|Buffers should be specified before the command209|The file is empty202|Already at end-of-file203|Already at end-of-line204|%s isn't a vi commandWindow resize interrupted text input mode205|Usage: %sD[ P[ \[ h[ t[ t[ [ [ @(#)v_word.c 10.5 (Berkeley) 3/6/96@(#)v_xchar.c 10.9 (Berkeley) 10/23/96206|No characters to delete@(#)v_yank.c 10.9 (Berkeley) 5/19/96@(#)v_z.c 10.10 (Berkeley) 5/16/96@(#)v_zexit.c 10.6 (Berkeley) 4/27/96@(#)vi.c 10.57 (Berkeley) 10/13/96110|Vi command failed: mapped keys discarded231|Interrupted: mapped keys discarded236|Interrupted3n Xn p r n p xV  ,99 ~ change case to motion[count]~[count]motion234|Only one buffer may be specified208|No command to repeat210|%s may not be used as a motion command211|Already in command mode214|Windows option value is too large, max is %u%d screens backgrounded; use :display to list them212|Cursor not in a word235|Number larger than %luL   d  |       @(#)vs_line.c 10.19 (Berkeley) 9/26/96%7lu @(#)vs_msg.c 10.77 (Berkeley) 10/13/96|/-\%s %.*s. ; .+=+=+=+=+=+=+=+%.*s @(#)vs_refresh.c 10.44 (Berkeley) 10/13/96n<c<W<L<@<219|Replace218|Insert217|Command216|Change215|Append%lu,%lu @(#)vs_relative.c 10.11 (Berkeley) 5/13/96@(#)vs_smap.c 10.25 (Berkeley) 7/12/96        220|Movement past the end-of-screen221|Movement past the beginning-of-screen@(#)vs_split.c 10.31 (Berkeley) 10/13/96222|Screen must be larger than %d lines to split223|There are no background screens224|There's no background screen editing a file named %s225|You may not background your only displayed screen227|The screen cannot shrink228|The screen cannot grow226|The screen can only shrink to %d rowsMemory exhausted:blank:]:cntrl:]:graph:]:print:]:alnum:]:punct:]:space:]:xdigit:]:digit:]:lower:]:upper:]:alpha:]Unfinished \ escapeunfinished repeat countmalformed repeat countUnbalanced [                          l     ,     |   8 8 8 8 8 8 8 8 8      t   H                         p   $  l                           @                 Unbalanced (No syntax specifiedUnbalanced )      | \ \ \ \ \ \ \    \  $ $ out of memoryPOSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument 0123456789A:B:C::EFGHIRUVX:abcd:e:f:hiLlnqrsuvwxyZzword-regexpwith-filenameversionunix-byte-offsetsbinarytextsilentinvert-matchregexprecursivequietnull-datanulldecompressno-messagesno-filenamemmapline-regexpline-numberignore-casehelpfixed-stringsfixed-regexpfiles-without-matchfiles-with-matchesfileextended-regexpdirectoriescountcontextbyte-offsetbinary-filesbefore-contextbasic-regexpafter-context%s: %s: %s %s: %s memory exhaustedrfstatlseek%s%cwriting output--Binary file %s matches (standard input)%d recursive directory loop%s: warning: %s: %s Memory exhaustedUsage: %s [OPTION]... PATTERN [FILE]... Try `%s --help' for more information. Usage: %s [OPTION]... PATTERN [FILE] ... Search for PATTERN in each FILE or standard input. Example: %s -i 'hello world' menu.h main.c Regexp selection and interpretation: -E, --extended-regexp PATTERN is an extended regular expression -F, --fixed-strings PATTERN is a set of newline-separated strings -G, --basic-regexp PATTERN is a basic regular expression -e, --regexp=PATTERN use PATTERN as a regular expression -f, --file=FILE obtain PATTERN from FILE -i, --ignore-case ignore case distinctions -w, --word-regexp force PATTERN to match only whole words -x, --line-regexp force PATTERN to match only whole lines -z, --null-data a data line ends in 0 byte, not newline Miscellaneous: -s, --no-messages suppress error messages -v, --invert-match select non-matching lines -V, --version print version information and exit --help display this help and exit -Z, --decompress decompress input before searching (HAVE_LIBZ=1) --mmap use memory-mapped input if possible Output control: -b, --byte-offset print the byte offset with output lines -n, --line-number print line number with output lines -H, --with-filename print the filename for each match -h, --no-filename suppress the prefixing filename on output -q, --quiet, --silent suppress all normal output --binary-files=TYPE assume that binary files are TYPE TYPE is 'binary', 'text', or 'without-match'. -a, --text equivalent to --binary-files=text -I equivalent to --binary-files=without-match -d, --directories=ACTION how to handle directories ACTION is 'read', 'recurse', or 'skip'. -r, --recursive equivalent to --directories=recurse. -L, --files-without-match only print FILE names containing no match -l, --files-with-matches only print FILE names containing matches -c, --count only print a count of matching lines per FILE --null print 0 byte after FILE name Context control: -B, --before-context=NUM print NUM lines of leading context -A, --after-context=NUM print NUM lines of trailing context -C, --context[=NUM] print NUM (default 2) lines of output context unless overridden by -A or -B -NUM same as --context=NUM -U, --binary do not strip CR characters at EOL (MSDOS) -u, --unix-byte-offsets report offsets as if CRs were not there (MSDOS) `egrep' means `grep -E'. `fgrep' means `grep -F'. With no FILE, or when FILE is -, read standard input. If less than two FILEs given, assume -h. Exit status is 0 if match, 1 if no match, and 2 if trouble. Report bugs to . conflicting matchers specifiedGREP_OPTIONSinvalid context length argumentegrepfgrepgrepreadskiprecurseunknown directories method-without-matchunknown binary-files type2.4%s (GNU grep) %s Copyright (C) 1988, 1992-1998, 1999 Free Software Foundation, Inc. This is free software; see the source for copying conditions. There is NO warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. defaultZ Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z V V V V V V V V V V Z Z Z Z Z Z Z  V \V V Z V V V W Z Z Z \Y Z Z Z Z Z W Z Z Z  W Z W Z Z Z Z Z Z Z Z gZ 4W DW `W W g;g8g5g2g/g,g)g&g#g ggggggg ggggfffffffffffffffffffffffffffffffffffffffffff~f{fxfufrfoflfifffcf`f]fZfWfTfQfNfKfHfEfBf?fd;d8d5d2d/d,d)d&d#d ddddddd ddddccccccccccccccccccccccccccccccccccccccccccc~c{cxcucrcoclcicfccc`c]cZcWcTcQcNcKcHcEcBc?chardware tabs with a width other than 8: %dhardware tabs with a non-^I tab string %s,unknown capability `%s' in ko stringko translation table is invalid, I give upno value for ko capability %s%s (%s) already has an explicit value %s, ignoring koacsc string synthesized from XENIX capabilities``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~acsc string synthesized from AIX capabilitiesHOMEOut of memory%s/.terminfo@%&*!#Illegal character (expected alphanumeric or %s) - %spremature EOFempty longname fieldwhitespace in name or alias fieldslashes aren't allowed in names or aliases$[]!*?dubious character `%c' in name or alias fieldSeparator inconsistent with syntaxMissing separator after `%s', have %sno value given for `%s'Missing separatorIllegal character - %sPremature EOFIllegal ^ character - %sAllow ^? as synonym for \177Non-octal digit `%c' in \ sequenceIllegal character %s in \ sequenceVery long string found. Missing separator?Ƥ ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` P ` ` ` ` ` ` ` ` ` ` ` ` ` X ` ` ` ` ` ` ` ` ` `  ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` @ ` H ` `   ` `  0 ` ` ` ` `  `  ` ` `  ( 8 Can't backspace off beginning of line|xtolifc` ] Z W S NKEB?<83.)#  !"#$ܧ٧էҧϧ˧Ƨç     .{wsnie_ZSL DHDA=930-)#  I   ަۦզϦʦĦ !"#$%&'()~*y+t,n-k.g/c0_1;[2LX3S4O5L6H7C8>9b8:2;-<'=!>?@AB CDEFG=HIJKLMۥNեOѥPͥQɥRåST7UiVWQXYZ[\]^!_`ab|c^xdtepflghhdiaj]kYlTmQnMoIpEqAr;s35t1u-v)w%x!yz{|~}~ ݤ٤դѤͤȤĤ{vqlg6b]XSNIFD?:50+&! PeܣأӣΣɣģ Hzupkgb]XSNI+D?:50+ &!!"#$% &()*+,-./ۢ0֢Ѣ2̢3Ǣ4¢56789:<=>?@AB|CwDrm Fh Gc H^ IZ VQOLLHC>83%-)$ !"#$%&'()ߡ*١+ӡ,ϡ-ʡ.Eš/0123456789:;<N=y>u?o@jAfB`C[DpUEOFKGFH@I:J4K5/L)M/"NOPQR STUVWXYZޠ[X٠\Ԡ]Π^|Ƞ_à`ab[cdefWghijkl|mwnmrolpfq`rZsUtMuGvAw8x1yt+z%{|}R~ ޟٟџ̟ǟŸ!%&'"# ()$%&|w*r+mhc^YTOJE@<;y61,box1memumemlOTGCOTGVOTGHOTGDOTGUOTGLOTGROTG4OTG1OTG3OTG2OTxrOTptOTmaOTkoOTknOTdTOTdBOTNLOTMTOTbcOTnlOTdNOTdCOTncOTnsOTbsOTugOTrsOTi2slengthsgr1evhlmethlmerhlmelohlmelhlmehhlmscesascescpctrmrmscsmscrmpchsmpchdispcslinessetcolorendbidefbicolornmbicrbinelbirepsmgtbsmglrs3dss2dss1dss0dscsindevtpfxlsetabsetafgetmreqmpminfokmouscsnmzeromdocrsupcssubcsrcsdrbimscsdsbimsmgtpsmgtsmgrpsmglpsmgbpsmgbscsmcuumcufmcubmcudpordermcuu1mvpamcuf1mcub1mcud1mhparumrsupmrsubmrshmrmicmrlmritmrwidmsumssupmssubmsshmsnrmqsnlqsmicmslmsitmsdrfqswidmdefccvrchrlpicpisetbsetfscpinitpinitcocopu9u8u7u6u5u4u3u2u1u0waitpausehookpulsetoneqdialdialhupwingocwinrmclkdclksclkflnsmgrsmglmgcel1kf63kf62kf61kf60kf59kf58kf57kf56kf55kf54kf53kf52kf51kf50kf49kf48kf47kf46kf45kf44kf43kf42kf41kf40kf39kf38kf37kf36kf35kf34kf33kf32kf31kf30kf29kf28kf27kf26kf25kf24kf23kf22kf21kf20kf19kf18kf17kf16kf15kf14kf13kf12kf11rfikUNDkSPDkSAVkRESkRITkRPLkRDOkPRTkPRVkOPTkNXTkMOVkMSGkLFTkICkHOMkHLPkFNDkEXTkEOLkENDksltkDLkDCkCRTkCPYkCMDkCANkBEGkundkspdksavkreskrstkrplkrfrkrefkrdokprtkprvkoptkopnknxtkmovkmsgkmrkkhlpkfndkextkentkendkcrtkcpykcmdkclokcankbegrmlnsmlnenacsxoffcxoncrmamsmamrmxonsmxonkcbtplnacscrmpmc5pkc3kc1kb2ka3ka1iproghuuctslhtwindhtssgrriindscvparcrfrs3rs2rs1repmc5mc4mc0pfxpflocpfkeycuurincufcubilindnichcuddldchpadnelsmmrmmlf9lf8lf7lf6lf5lf4lf3lf2lf10lf1lf0smkxrmkxkcuu1khtskrikindkcuf1kppknpkllkcub1kil1kich1khomekf9kf8kf7kf6kf5kf4kf3kf2kf10kf1kf0kedkelkrmirkcud1kdl1kdch1kctabkclrktbckbsipil1ich1ifis3is2is1fslffflashrmulrmsormirrmdcrmcupsgr0rmacsechsmulsmsorevprotinvissmirdimsmdcsmcupboldblinksmacshddsldl1dch1cvviscuu1llcuf1cnormmrcupcub1civishomecud1cupcmdchhpaedelcleartbccsrcrbelcbtbitypebitwinbtnswidcscpsorviorhiorlorcnpinsmlsmcsmjumpmaddrspinhspinvbufszncvpairscolorswnummalwlhnlabwslvtpbxmclmlinesitcolslpixcpixsamxvpadaisycrxmxhpahlsbcecccndscrnpcnrrmcchtsmc5inxonxonulhzxteslokosmsgrmirdbdainhskmhcgneoxenlxhpxsbambwLLP0Ĉ\X|`(,ppԍ8T̞l4td@l(`Tx̒dԐ htP؏@șL$ДpH$t@ `܈, $xl<hЗ`Ћ<`<Dx܋4XȐĎX,4p ؉08،Ԝ  ,hȊؒhX|H\x̘d8dl8P|$dԊ8P<ċ48| dD\d0ėtT ܔ( 0XhD,К ؞l4<\<t؛|x`00ܚؘX0ܝLDЎܗTĝ<ĚTX`̉HXHpĔld|̏܎Н̛@HT, |lifc` ] Z W  KB?< |!y"v#s$pm٧jҧϧgdç   a ^ [XUROLIFC@=:741.+(% "A       aۦ !"#$%&'(-)*+,-k./0f12X345L6789:;<=>}?z@wAtBqCnDkEhFeGbH_I\JYKVLSMPNMOJPGQDRAS>T;U8V5W2X/Y,Z)[&\##] ^_`abcd efxghijklmnopoqrstuvwxyz{|}~%u~{~xurolifc`]ZWTtQNaKmHEBd? <9v6`30W-*'$!  z.'X(/56789:;<=|>y?v@sApBmDjEgda^[XUROLIFC^@=:741. + ( % "    !"#$%&'()ߡ*+,-./01234506789:;<=>?@ABCDgEFhGHIJKLMNO}PzQwRtSqTnUkVhWeXbY_Z\[Y\V]S^P_M`JaGbDcAd>e;f8g5h2i/j,k)l&mC#n opUqrstuv wxyz{|}e~fghi!%&'"#()$%&{*+~{xbxmumlGCGVGHGDGUGLGRG4G1G3G2xrptkokndTdBNLbcnldNdCncnsbsugrsi2sLsAXvXtXrXoXlXhS8S7S6S5S4S3S2S1YZYzYyYxYwYvZzXyMTs3s2s1s0cidvxlABAFGmRQMiKmZyZxZwZvZuZtZsZrZqZpZoZnZmZlZkZjZiZhZgZfZeZdZcZbZaZZZYZXZWZVZUZTZSZRZQZPZOZNZMZLZKZJZIZHZGZFZEZDZCZBZASbSfspIpIcWAPAfhPUTOQDDIHUWGCWRCDKSCLfMRMLMCcbFrFqFpFoFnFmFlFkFjFiFhFgFfFeFdFcFbFaFZFYFXFWFVFUFTFSFRFQFPFOFNFMFLFKFJFIFHFGFFFEFDFCFBFAF9F8F7F6F5F4F3F2F1RF!3!2!1%j%i%h%g%f%e%d%c%b%a#4#3#2#1*0*9*8*7*6*5*4*3*2*1&0&9&8&7&6&5&4&3&2&1%0%9%8%7%6%5%4%3%2%1@0@9@8@7@6@5@4@3@2@1LFLOeAXFXNRASARXSXkBpnacrPpOK5K4K2K3K1iPtstawistsasrsfcvr3r2r1rppopfpspxplpkUPSRRILEALSFICDODLDCpcnwmmmol9l8l7l6l5l4l3l2lal1l0kskekukTkRkFkrkPkNkHklkAkIkhk9k8k7k6k5k4k3k2k;k1k0kSkEkMkdkLkDktkCkakbalici3isi1fsvbueseeitemeaeecussomrmpmkimmhdmtimdmbasdsdcvsupndveCMlevihodocmCCchcdceclctcsblbtYpYoBTYnYmYlYkYjYiYhYgYfYeYdYcYbYaNCpaCoMWNlwssglicoYGYFYEYDYCYBYAhlutccNDNPNRHC5inxxoesmsmixnxsxbH8p\|0TL8`h` X0 t,|0lT (8H|<dhLĿ4ld<| $\xT4Lxl<ļ@D@4Lм$ܿDt<p <, ` `H@dLD(4H tX|ܹ@$DXx(Hؽ,hxX P40tXptxXHhl$$dP4xT08LXpp0d(lTDtl 4pt,dDX h,(,\Ld@h<Ⱦ$||p$d<PT,H0\@Ĺ`hȻpP(@Ի,ru]VGDZ5Q~qzwztzqznzkzhzzBCKFKEKDKCKBTekKAIRISHSIBMkqGGGcGvGhGdGuGrG8G5G7G6RTPSPNPDLDHMENCOCFGSGEXENIXEEXSDSCVCIAT&TBOBSDsbic|]wWrQLӣkselkbtabfont3font2font1font0Out of memorystring too complex to convertI'm confused%'%{string may not be optimal%Pa%ga%p%{96}%^%{127}%^saw %%r twice in %ssaw %%m twice in %ssaw %%n twice in %s%i%{10}%/%{16}%*%{10}%m%+%{2}%*%-%?%>%t%+%;%+%-%*%/%+%c%s%-%c%c%2d%3d%d%\unknown %% code %s (%#x) in %s$</>h      T        $     H      d      H                                @  x        ̯     |                    ܱ \%03o%>%%%%?%%{%d}%%>%%t%%{%d}%%+%%;%%?%%{%d}%%>%%t%%'%c'%%+%%;%%?%%'%c'%%>%%t%%{%d}%%+%%;%%?%%'%c'%%>%%t%%'%c'%%+%%;%B%%{%d}%%+%%c%%'%c'%%+%%c%D%n%mdoxX.%.%rT           l l l l l l l l l l                                                h           Out of memory.|yvspmjgda^[XUROLIFC@=:741/-+)'%#!   }{ywuspmjgda^[XUROLIFC@=:741.+(%"  ~|zxvtrpnljhfdb`^\ZXVTRP~_~^~]~\~[~Z~Y~X~W~V~U~T~S~R~Q~P~O~N~M~L~K~J~I~H~G~F~E~D~C~B~A~@^?~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"! ^_^^^]^\^[^Z^Y^X^W^V^U^T^S^R^Q^P^O^N^M^L^K^J^I^H^G^F^E^D^C^B^A^@(null)(cancelled)\%03o"%s", line %d, col %d, terminal '%s' @=950-*'$! OTxrOTptOTNLOTMTOTncOTnsOTbslpixcpixsamxvpadaisycrxmxhpahlsbcecccndscrnpcnrrmcchtsmc5inxonxonulhzxteslokosmsgrmirdbdainhskmhcgneoxenlxhpxsbambwnaWJ:' znbTH1&l[C2 return_does_clr_eolhas_hardware_tabslinefeed_is_newlinegnu_has_meta_keyno_correctly_working_crcrt_no_scrollingbackspaces_with_bslpi_changes_rescpi_changes_ressemi_auto_right_marginrow_addr_glitchhas_print_wheelcr_cancels_micro_modecol_addr_glitchhue_lightness_saturationback_color_erasecan_changenon_dest_scroll_regionno_pad_charnon_rev_rmcuphard_cursorprtr_silentneeds_xon_xoffxon_xofftransparent_underlinetilde_glitchdest_tabs_magic_smsostatus_line_esc_okover_strikemove_standout_modemove_insert_modememory_belowmemory_aboveinsert_null_glitchhas_status_linehas_meta_keyhard_copygeneric_typeerase_overstrikeeat_newline_glitchceol_standout_glitchno_esc_ctlcauto_right_marginauto_left_margin/,&#  }xOTknOTdTOTdBOTdNOTdCOTugbitypebitwinbtnswidcscpsorviorhiorlorcnpinsmlsmcsmjumpmaddrspinhspinvbufszncvpairscolorswnummalwlhnlabwslvtpbxmclmlinesitcols'& vl]M<+ xp\M6 number_of_function_keyshorizontal_tab_delaybackspace_delaynew_line_delaycarriage_return_delaymagic_cookie_glitch_ulbit_image_typebit_image_entwiningbuttonswide_char_sizeprint_rateoutput_res_vert_inchoutput_res_horz_inchoutput_res_lineoutput_res_charnumber_of_pinsmicro_line_sizemicro_col_sizemax_micro_jumpmax_micro_addressdot_horz_spacingdot_vert_spacingbuffer_capacityno_color_videomax_pairsmax_colorsmaximum_windowsmax_attributeslabel_widthlabel_heightnum_labelswidth_status_linevirtual_terminalpadding_baud_ratemagic_cookie_glitchlines_of_memoryinit_tabscolumns   | x r o l h b ^ Y T N I C = 8 5 0 * % !                                   } w q l f ` \ X T P K G C ? ; 7 3 / + %        ztplhd`\XTQNJGC@<830,)&  ~ytoje`[VQLGB=83.)$ ~ytoje`[VQLGB=83.)$ }wrlhc]XRMGB?<9630-*'$! ysnha\WRMID>82-'" wpjd^YTNHB<6/)# box1memumemlOTGCOTGVOTGHOTGDOTGUOTGLOTGROTG4OTG1OTG3OTG2OTmaOTkoOTbcOTnlOTrsOTi2slengthsgr1evhlmethlmerhlmelohlmelhlmehhlmscesascescpctrmrmscsmscrmpchsmpchdispcslinessetcolorendbidefbicolornmbicrbinelbirepsmgtbsmglrs3dss2dss1dss0dscsindevtpfxlsetabsetafgetmreqmpminfokmouscsnmzeromdocrsupcssubcsrcsdrbimscsdsbimsmgtpsmgtsmgrpsmglpsmgbpsmgbscsmcuumcufmcubmcudpordermcuu1mvpamcuf1mcub1mcud1mhparumrsupmrsubmrshmrmicmrlmritmrwidmsumssupmssubmsshmsnrmqsnlqsmicmslmsitmsdrfqswidmdefccvrchrlpicpisetbsetfscpinitpinitcocopu9u8u7u6u5u4u3u2u1u0waitpausehookpulsetoneqdialdialhupwingocwinrmclkdclksclkflnsmgrsmglmgcel1kf63kf62kf61kf60kf59kf58kf57kf56kf55kf54kf53kf52kf51kf50kf49kf48kf47kf46kf45kf44kf43kf42kf41kf40kf39kf38kf37kf36kf35kf34kf33kf32kf31kf30kf29kf28kf27kf26kf25kf24kf23kf22kf21kf20kf19kf18kf17kf16kf15kf14kf13kf12kf11rfikUNDkSPDkSAVkRESkRITkRPLkRDOkPRTkPRVkOPTkNXTkMOVkMSGkLFTkICkHOMkHLPkFNDkEXTkEOLkENDksltkDLkDCkCRTkCPYkCMDkCANkBEGkundkspdksavkreskrstkrplkrfrkrefkrdokprtkprvkoptkopnknxtkmovkmsgkmrkkhlpkfndkextkentkendkcrtkcpykcmdkclokcankbegrmlnsmlnenacsxoffcxoncrmamsmamrmxonsmxonkcbtplnacscrmpmc5pkc3kc1kb2ka3ka1iproghuuctslhtwindhtssgrriindscvparcrfrs3rs2rs1repmc5mc4mc0pfxpflocpfkeycuurincufcubilindnichcuddldchpadnelsmmrmmlf9lf8lf7lf6lf5lf4lf3lf2lf10lf1lf0smkxrmkxkcuu1khtskrikindkcuf1kppknpkllkcub1kil1kich1khomekf9kf8kf7kf6kf5kf4kf3kf2kf10kf1kf0kedkelkrmirkcud1kdl1kdch1kctabkclrktbckbsipil1ich1ifis3is2is1fslffflashrmulrmsormirrmdcrmcupsgr0rmacsechsmulsmsorevprotinvissmirdimsmdcsmcupboldblinksmacshddsldl1dch1cvviscuu1llcuf1cnormmrcupcub1civishomecud1cupcmdchhpaedelcleartbccsrcrbelcbt$$$$$|$t$l$]$K$<$0$$$$$#########w#`#O#?#1###"""""""y"e"X"G"6"#"""!!!!!!!!!|!r!h!_!X!Q!H!@!8!0!)!"!!! !!                 r f _ X P I B ; 4 - &     wh_TJ=4, qbUKD=6/(}rh\SH@6-$ymd[OB8,$~tg\QG:0" zrjbZRJB:2*" zrdTC6,XR}sgVF7(xgM8&ycR=2' zeO@, }oeTC9-nYJ:*{iUC, |of]TKA7."box_chars_1memory_unlockmemory_lockacs_plusacs_vlineacs_hlineacs_tteeacs_bteeacs_rteeacs_lteeacs_lrcorneracs_urcorneracs_llcorneracs_ulcornerarrow_key_mapother_non_function_keysbackspace_if_not_bslinefeed_if_not_lftermcap_resettermcap_init2set_pglen_inchset_a_attributesenter_vertical_hl_modeenter_top_hl_modeenter_right_hl_modeenter_low_hl_modeenter_left_hl_modeenter_horizontal_hl_modealt_scancode_escscancode_escapepc_term_optionsexit_scancode_modeenter_scancode_modeexit_pc_charset_modeenter_pc_charset_modedisplay_pc_charset_page_lengthset_color_bandend_bit_image_regiondefine_bit_image_regioncolor_namesbit_image_carriage_returnbit_image_newlinebit_image_repeatset_tb_marginset_lr_marginset3_des_seqset2_des_seqset1_des_seqset0_des_seqcode_set_initdevice_typepkey_plabset_a_backgroundset_a_foregroundget_mousereq_mouse_posmouse_infokey_mousechar_set_nameszero_motionthese_cause_crsuperscript_characterssubscript_charactersstop_char_set_defstop_bit_imagestart_char_set_defstart_bit_imageset_top_margin_parmset_top_marginset_right_margin_parmset_left_margin_parmset_bottom_margin_parmset_bottom_marginselect_char_setparm_up_microparm_right_microparm_left_microparm_down_microorder_of_pinsmicro_upmicro_row_addressmicro_rightmicro_leftmicro_downmicro_column_addressexit_upward_modeexit_superscript_modeexit_subscript_modeexit_shadow_modeexit_micro_modeexit_leftward_modeexit_italics_modeexit_doublewide_modeenter_upward_modeenter_superscript_modeenter_subscript_modeenter_shadow_modeenter_normal_qualityenter_near_letter_qualityenter_micro_modeenter_leftward_modeenter_italics_modeenter_draft_qualityenter_doublewide_modedefine_charchange_res_vertchange_res_horzchange_line_pitchchange_char_pitchset_backgroundset_foregroundset_color_pairinitialize_pairinitialize_colororig_colorsorig_pairuser9user8user7user6user5user4user3user2user1user0wait_tonefixed_pauseflash_hookquick_dialdial_phonehangupgoto_windowcreate_windowremove_clockdisplay_clockset_clocklabel_formatset_right_marginset_left_marginclear_marginsclr_bolkey_f63key_f62key_f61key_f60key_f59key_f58key_f57key_f56key_f55key_f54key_f53key_f52key_f51key_f50key_f49key_f48key_f47key_f46key_f45key_f44key_f43key_f42key_f41key_f40key_f39key_f38key_f37key_f36key_f35key_f34key_f33key_f32key_f31key_f30key_f29key_f28key_f27key_f26key_f25key_f24key_f23key_f22key_f21key_f20key_f19key_f18key_f17key_f16key_f15key_f14key_f13key_f12key_f11req_for_inputkey_sundokey_ssuspendkey_ssavekey_srsumekey_srightkey_sreplacekey_sredokey_sprintkey_spreviouskey_soptionskey_snextkey_smovekey_smessagekey_sleftkey_sickey_shomekey_shelpkey_sfindkey_sexitkey_seolkey_sendkey_selectkey_sdlkey_sdckey_screatekey_scopykey_scommandkey_scancelkey_sbegkey_undokey_suspendkey_savekey_resumekey_restartkey_replacekey_refreshkey_referencekey_redokey_printkey_previouskey_optionskey_openkey_nextkey_movekey_messagekey_markkey_helpkey_findkey_exitkey_enterkey_endkey_createkey_copykey_commandkey_closekey_cancelkey_beglabel_offlabel_onena_acsxoff_characterxon_characterexit_am_modeenter_am_modeexit_xon_modeenter_xon_modekey_btabplab_normacs_charschar_paddingprtr_nonkey_c3key_c1key_b2key_a3key_a1init_progup_half_lineunderline_charto_status_linetabset_windowset_tabset_attributesscroll_reversescroll_forwardsave_cursorrow_addressrestore_cursorreset_filereset_3stringreset_2stringreset_1stringrepeat_charprtr_onprtr_offprint_screenpkey_xmitpkey_localpkey_keyparm_up_cursorparm_rindexparm_right_cursorparm_left_cursorparm_insert_lineparm_indexparm_ichparm_down_cursorparm_delete_lineparm_dchpad_charnewlinemeta_onmeta_offlab_f9lab_f8lab_f7lab_f6lab_f5lab_f4lab_f3lab_f2lab_f10lab_f1lab_f0keypad_xmitkeypad_localkey_upkey_stabkey_srkey_sfkey_rightkey_ppagekey_npagekey_llkey_leftkey_ilkey_ickey_homekey_f9key_f8key_f7key_f6key_f5key_f4key_f3key_f2key_f10key_f1key_f0key_eoskey_eolkey_eickey_downkey_dlkey_dckey_ctabkey_clearkey_catabkey_backspaceinsert_paddinginsert_lineinsert_characterinit_fileinit_3stringinit_2stringinit_1stringfrom_status_lineform_feedflash_screenexit_underline_modeexit_standout_modeexit_insert_modeexit_delete_modeexit_ca_modeexit_attribute_modeexit_alt_charset_modeerase_charsenter_underline_modeenter_standout_modeenter_reverse_modeenter_protected_modeenter_secure_modeenter_insert_modeenter_dim_modeenter_delete_modeenter_ca_modeenter_bold_modeenter_blink_modeenter_alt_charset_modedown_half_linedis_status_linedelete_linedelete_charactercursor_visiblecursor_upcursor_to_llcursor_rightcursor_normalcursor_mem_addresscursor_leftcursor_invisiblecursor_homecursor_downcursor_addresscommand_charactercolumn_addressclr_eosclr_eolclear_screenclear_all_tabschange_scroll_regioncarriage_returnbellback_tab_HiStOrY_V1_ rw%sX H x     ` l  4       *?_-.[]~=bindtelltcsettcechotcsettyp             0 H ` /.editrcHOME%s%sr^DEditline extended commanded-commandMove down one lineed-next-lineMove up one lineed-prev-lineSearch next in history for a line matching the currented-search-next-historySearch previous in history for a line matching the currented-search-prev-historyMove to the next history lineed-next-historyMove to the previous history lineed-prev-historyFirst character in a bound sequenceed-sequence-lead-inErase current line and start from scratched-start-overRedisplay everythinged-redisplayClear screen leaving current line at the toped-clear-screenDelete the character to the left of the cursored-delete-prev-charExecute commanded-newlineTty allow output charactersed-tty-start-outputTty disallow output charactersed-tty-stop-outputTty suspend charactered-tty-sigtstpTty quit charactered-tty-sigquitTty flush output charactersed-tty-flush-outputTty delayed suspend charactered-tty-dsuspTty interrupt charactered-tty-sigintIndicates unbound charactered-unassignedDigit that starts argumented-argument-digitAdds to argument or enters a digited-digitAdd the next character typed verbatimed-quoted-insertMove to the left one charactered-prev-charMove to the beginning of the current worded-prev-wordMove to the right one charactered-next-charExchange the character to the left of the cursor with the one under ited-transpose-charsMove cursor to the beginning of lineed-move-to-begMove cursor to the end of lineed-move-to-endCut to the end of lineed-kill-lineDelete character under cursored-delete-next-charDelete from beginning of current word to cursored-delete-prev-wordAdd character to the lineed-insertIndicate end of fileed-end-of-fileEmacs incremental reverse searchem-inc-search-prevEmacs incremental next searchem-inc-search-nextCopy current word to cursorem-copy-prev-wordSwitch from insert to overwrite mode or vice versaem-toggle-overwriteAdd 8th bit to next character typedem-meta-nextUniversal argument (argument times 4)em-universal-argumentExchange the cursor and markem-exchange-markSet the mark at cursorem-set-markLowercase the characters from cursor to end of current wordem-lower-caseCapitalize the characters from cursor to end of current wordem-capitol-caseUppercase the characters from cursor to end of current wordem-upper-caseMove next to end of current wordem-next-wordExchange the two characters before the cursorem-gosmacs-trasposeCopy area between mark and cursor to cut bufferem-copy-regionCut area between mark and cursor and save in cut bufferem-kill-regionCut the entire line and save in cut bufferem-kill-linePaste cut buffer at cursor positionem-yankCut from cursor to end of current wordem-delete-next-wordDelete character under cursor or list completions if at end of lineem-delete-or-listVi repeat current character search in the opposite search directionvi-repeat-prev-charVi repeat current character search in the same search directionvi-repeat-next-charVi move up to the character specified previousvi-to-prev-charVi move up to the character specified nextvi-to-next-charVi move to the character specified previousvi-prev-charVi move to the character specified nextvi-next-charVi repeat current search in the opposite search directionvi-repeat-search-prevVi repeat current search in the same search directionvi-repeat-search-nextVi search history nextvi-search-nextVi search history previousvi-search-prevVi cut from beginning of line to cursorvi-kill-line-prevVi list choices for completion or indicate end of file if empty linevi-list-or-eofVi move to previous character (backspace)vi-delete-prev-charVi move to the beginning of linevi-zeroVi enter command mode (use alternative key bindings)vi-command-modeVi undo all changesvi-undo-lineVi undo last changevi-undoVi move to the end of the current wordvi-to-end-wordVi move to the end of the current space delimited wordvi-end-wordVi delete prefix commandvi-delete-metaVi enter insert mode at end of linevi-add-at-eolVi enter insert mode after the cursorvi-addVi enter insert modevi-insertVi change to end of linevi-change-to-eolVi substitute entire linevi-substitute-lineVi replace character under the cursor and enter insert modevi-substitute-charVi enter replace modevi-replace-modeVi replace character under the cursor with the next character typedvi-replace-charVi enter insert mode at the beginning of linevi-insert-at-bolVi change prefix commandvi-change-metaVi change case of character under the cursor and advance one charactervi-change-caseVi move to the next wordvi-next-wordVi move to the next space delimited wordvi-next-space-wordVi move to the previous wordvi-prev-wordVi move to the previous space delimited wordvi-prev-space-wordVi paste previous deletion to the left of the cursorvi-paste-prevVi paste previous deletion to the right of the cursorvi-paste-next%d %skey_add: Null extended-key not allowed. key_add: sequence-lead-in command not allowed key_delete: Null extended-key not allowed. Unbound extended key "%s" Some extended keys too long for internal print buffer "%s..." %-15s-> %s ""[]no inputemacsvi%s -> %s %-15s-> is undefined %-4s to %-7s-> %s Standard key bindings Alternative key bindings Multi-character bindings Arrow key bindings %s %s %s: Invalid switch `%c'. %s: Invalid \ or ^ in instring. %s: Invalid \ or ^ in outstring. %s: Invalid command `%s'. ! " " " ! " " " " " ! ! " " " " " ! ! " " ! historyT' T' T' T' T' T' T' T' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' & ' ' ' H' 0' ' ' ' ' ' ' ' ' ' ' ' <' '  ' ' $' , , , - , d, - , , *[]?> > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > sends cursor end@7sends cursor homekhcursor up multipleUPcursor right multipleRIcursor left multipleLEinsert multiple charsICcursor down multipleDOdelete multiple charsDCvisible bellvbend underlineuebegin underlineuscursor up oneupcursor to status linetsbegin standoutsoend standoutsenon destructive spacendend attributesmebegin boldmdsends cursor upkusends cursor rightkrsends cursor leftklsends cursor downkdinsert paddingipstart insert modeiminsert characterichome cursorhocursor from status linefsend insert modeeiend delete modeedstart delete modedmdelete a linedldelete a characterdcclear screenclcursor to horiz poschclear to end of linececlear to bottomcdaudible bellbladd new blank linealMTTab chars destructivextHas meta keykmNumber of columnscoNumber of lineslihas physical tabsptOut of termcap string space. TERMdumbCannot read termcap database; No entry for terminal type "%s"; using dumb terminal settings. downleftrighthomeend Your terminal has the following characteristics: It has %d columns and %d lines ano It has %s meta key not It can%suse tabs (empty) %25s (%s) == %s yessettc: Bad value `%s'. %s %d tabsmetabaud%lu rowslinescolsechotc: Termcap parameter `%s' not found. echotc: Warning: unknown termcap %% `%c'. echotc: Warning: Extra argument `%s'. echotc: Warning: Missing argument. echotc: Warning: Too many required arguments (%d). f e e e e e e e e e e e e e e e e e e e e e e e e f e e e f e f e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e e f e e e e f e e e f chars:lflag:cflag:oflag:iflag:timeminstatuslnextdiscardreprintdsuspsuspwerasestopstarteol2eoleofkillerasequitintrextprocaltwerasenokerninfoiextenpendinflushoechokeechoprtechoctltostopnoflshechonlechokechoeechoicanonisigmdmbufcrts_iflowccts_oflowclocalhupclparoddparenbcreadcstopbcignorextabsonlretonoeotonlcropostimaxbelixoffixanyixonicrnligncrinlcristripinpckparmrkignparbrkintignbrk%s: Unknown switch `%c'. %*s%c%s %s %s: Invalid argument `%s'.     ( ̄    P x        ؄ Ȅ  ( 4  @ `     Unmatched ) or \)Regular expression too bigPremature end of regular expressionInvalid preceding regular expressionMemory exhaustedInvalid range endInvalid content of \{\}Unmatched \{Unmatched ( or \(Unmatched [ or [^Invalid back referenceTrailing backslashInvalid character class nameInvalid collation characterInvalid regular expressionNo matchalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit                          @      Y L   ̎                 L                               @                             ܙ ̙ ̫ ,  ܭ Э ܭ ܭ ܭ ܭ ܭ          ܭ ܭ X ܭ < Э ܭ ܭ  ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ l ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ  ܭ  ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ ܭ  ܭ ܭ ܭ    D d X  ܶ ܶ 8               Զ  @      p 0    <  $ d       x     |   X  (   d       L d d d d           \   d d d d No previous regular expression$FreeBSD: src/lib/libkvm/kvm.c,v 1.12.2.2 2000/08/23 08:53:00 kris Exp $%s: : %s : %scan't allocate %u bytes: %sexec file name too longbad flags arg/dev/mem%s/dev/null%s: not physical memory device/dev/kmem%s: %s invalid address (%x)kvm_readshort readkvm_writeshort writekvm_write not implemented for dead kernels$FreeBSD: src/lib/libkvm/kvm_i386.c,v 1.11 1999/12/27 07:14:57 peter Exp $cannot allocate vm_IdlePTDbad namelistcannot read IdlePTDcannot read PTDvatop called in live kernel!_kvm_vatop: lseek_kvm_vatop: readinvalid address (%x)1.1.3%c%c%c%c%c%c%c%c%c%c: 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-unknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data checkl  U     8    F    deflate 1.1.3 Copyright 1995-1998 Jean-loup Gailly T          1.1.3q     invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeatwkz Dincompatible versionbuffer errorinsufficient memorydata errorstream errorfile errorstream endneed dictionary1.1.3       L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c         (08@P`p  0@`  0@`invalid literal/length codeinvalid distance code ==>L?$@@ABC:]]ض,Է(pĸlh     +(      %drcmd: getaddrinfo: %s rcmd: socket: All ports in use rcmd: socket: %s connect to address %s: Trying %s... %s: %s rcmd: write (setting up stderr): %s rcmd: too many files rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: accept: %s socket: protocol failure in circuit setup. rcmd: %s: %s 0r/etc/hosts.equiv/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts owner.rhosts writeable by other than owner$FreeBSD: src/lib/libc/locale/setlocale.c,v 1.25.2.2 2000/09/08 07:31:52 kris Exp $LC_MESSAGESLC_TIMELC_NUMERICLC_MONETARYLC_CTYPELC_COLLATELC_ALLLANGC/PATH_LOCALE/usr/share/localePOSIX0%X%XthP\/var/run/dev.db/dev/$FreeBSD: src/lib/libc/gen/strtofflags.c,v 1.18.2.1 2000/06/28 01:52:24 joe Exp $nouunlinknouunlnknoopaquenodumpnouimmutablenouchangenouchgnouappendnouappndnosunlinknosunlnknosimmutablenoschangenoschgnoarchivednoarchnosappendnosappnd ,stringlist: %m}}}}}}}}}}}}}}}}}}}}}x}s}n}k}f}a}Z}U}O}J}E}@}usr2usr1infowinchprofvtalrmxfszxcpuiottouttinchldconttstpstopurgtermalrmpipesyssegvbuskillfpeemtabrttrapillquitinthupSignal 0}F<7# {h^TG3~~~~~~v~`~User defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangup 444444444444444444444444%ur+sh-c/bin/shHOME.$FreeBSD: src/lib/libc/gen/getvfsbyname.c,v 1.5 1999/08/27 23:58:45 peter Exp $passwd.byname%upasswd.byuid/etc/pwd.db/etc/spwd.db%s: %mpasswd.adjunct.byname:##master.passwd.bynamemaster.%s%sw+/dev/tty /etc/netgroupr%c*%s.%s%s.**.%s*.*netgroup.byusernetgroup.byhost), , netgroup%s %sgroup.byname%dgroup.bygidr/etc/group: :BLOCKSIZEGKM%s: unknown blocksizemaximum blocksize is %ldGminimum blocksize is 512%ld%s-blocks/kernel...//dev/ : xxswufsswap ,rwrqror/etc/fstabfstab: :%d: PATH/usr/bin:/bin:.execvp: : path too long sh/bin/shs`@`@`@`@``_@`@`@``@`@`@`@`@`@`@`s`@`@`@`@`@``@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`@`s`s`rbJ7! эl`TB ьfW?2 }_@nP @و`5"Ӈ‡xb@$ΆkXE*҅Illegal byte sequenceOperation canceledValue too large to be stored in data typeNo message of desired typeIdentifier removedNeed authenticatorAuthentication errorInappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisc quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0W$FreeBSD: src/lib/libc/gen/disklabel.c,v 1.9 1999/11/04 04:46:18 ache Exp $DOC2KVinumCCDfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownvinumbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunused/etc/disktabb0b1tyremovablesimulatedsfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdxauthunix_create: out of memory auth_none.c - Fatal marshalling problem|xtph_YSNIB80' ّґɑh_YSNIB80'%B %e%b %e%a %Ef %X %Z %YPMAM%a %Ef %X %Y%m/%d/%y%H:%M:%SSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJanCPOSIX//LC_TIMECPOSIXPATH_LOCALE/usr/share/locale//LC_CTYPErNONEUTF2EUCBIG5MSKanjiRuneMagi/%s.dbtcrhxphxp$FreeBSD: src/lib/libc/gen/err.c,v 1.6 1999/08/27 23:58:33 peter Exp $%s: : %s (44444444444444444444444444444444444484444x444444444444444^4444444ب444444444484444444da444ۨp4,444\î\îî44îîîîîîîPPPPPPîîîîîîîîîîîîîîîîîlîîîîîîîîPPPPPPîîîîîîîîîîîîîîîîîlsssssssssssss$sssssssssssssssssssssssssssssss$CPOSIX//LC_COLLATEr1.0 __collate_substitute__collate_strdup: xdr_array: out of memory udptcp%d%u/etc/host.confrhostslocalfilefilesdnsbindnis# /etc/hosts0123456789abcdefip6.intin-addr.arpa;; res_query(%s, %d, %d) ;; res_query: mkquery failed ;; res_query: send error ;; rcode = %d, ancount=%d ;; res_querydomain(%s, %s, %d, %d) %s.%sHOSTALIASESr;; res_mkquery(%d, %s, %d, %d) /&LOCALDOMAINr/etc/resolv.confdomain searchnameserver%dsortlistoptionsconfRES_OPTIONSenv;; res_setoptions("%s", "%s")... ndots:;; ndots=%d debug;; res_setoptions("%s", "%s").. ;; debug inet6no_tld_querydx`ttcpudpUnknown errorArgument res is NULLResolved protocol is unknownInvalid value for hintsSystem error returned in errnoai_socktype not supportedservname not supported for ai_socktypehostname nor servname provided, or not knownNo address associated with hostnameMemory allocation failureai_family not supportedNon-recoverable failure in name resolutionInvalid value for ai_flagsTemporary failure in name resolutionAddress family for hostname not supportedSuccess# /etc/host.confrhostslocalfilefilesdnsbindnisGAI# /etc/hosts%s.%s%d/%sservices.byportservices.byname%.*s %s/%sr/etc/services# ,/nisyellowpagesypdomaindnsbindhtablehosttable/etc/hostshostsr/etc/host.conf ,:; hosts.bynamehosts.byaddrr/etc/hosts# gethostby*.gethostanswer: asked for "%s", got "%s"gethostby*.gethostanswer: asked for "%s %s %s", got type "%s"size (%d) too big Too many addresses (%d) Impossible condition (type=%d) res_search failed (%d) %u.%u.%u.%u.in-addr.arpa%x.%x.ip6.intres_query failed (%d) static buffer is too small (%d) syslog: unknown facility/priority: %x<%d>%.15s %s[%d]: %m /dev/console /var/run/log/dev/log$FreeBSD: src/lib/libc/yp/yplib.c,v 1.34 2000/01/27 23:06:55 jasone Exp $SuccessInternal ypbind errorDomain not boundSystem resource allocation failureUnknown ypbind error: #%d /var/yp/binding%s/%s.%dclnttcp_createYP: server for domain %s not responding, retrying clntudp_createfcntl: F_SETFDyp_match: clnt_callyp_first: clnt_callyp_next: clnt_callclnttcp_create failed yp_order: clnt_callyp_master: clnt_callyp_maplist: clnt_callRequest arguments badRPC failureCan't bind to server which serves this domainNo such map in server's domainNo such key in mapYP server errorLocal resource allocation failureNo more records in map databaseCan't communicate with portmapperCan't communicate with ypbindCan't communicate with ypservLocal domain name not setServer data base is badYP server version mismatch - server can't supply service.Access violationDatabase is busyYP unknown error %d gghhh$h,h4h>HEADER<<- opcode: %s, status: %s, id: %d ; flags: qr aa tc rd ra ?? ad cd; %s: %d, %s: %d930)% NONEANYHESIODHSCHAOSINxADDITIONALAUTHORITYANSWERQUERY߽ؽxUPDATEPREREQUISITEZONEicTP=:2/     rnifSM;7+& ~qmd`@$ !"zu[VHB #%"any"URN Naming AuthorityNAPTRmail agent (deprecated)MAILAmailbox-related data (deprecated)MAILBzone transferAXFRincremental zone transferIXFRATM address (unimplemented)ATMAserver selectionSRVNIMROD locator (unimplemented)NIMLOCendpoint identifier (unimplemented)EIDnext valid name (unimplemented)NXTlocationLOCIPv6 addressAAAAgeographical position (withdrawn)GPOSmapping informationPXkeyKEYsignatureSIGNSAP_PTRnsap addressNSAProuterRTISDN addressISDNX25 addressX25DCE or AFS serverAFSDBresponsible personRPtextTXTmail exchangerMXmailbox informationMINFOhost informationHINFOdomain name pointerPTRwell-known service (deprecated)WKSnullNULLmail renameMRmail group memberMGmailboxMBstart of authoritySOAcanonical nameCNAMEmail forwarder (deprecated)MFmail destination (deprecated)MDname serverNSaddressA%dinitdebugaaonly(unimpl)usevcprimry(unimpl)igntcrecursdefnamstyopndnsrchinsecure1insecure2?0x%lx?%u%ld.%.2ld< < < < < < < < < < < <  < < <  < < < < < < < < < < < < < < < < < < < < < < < < <  < < <  ` l l l l l l l l T l l l l T l l l ` l l l l l l l l l l l l l ` l l l l l l l l T l l l l T l l l ` ?; error: unknown LOC RR version%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %sm%04d%02d%02d%02d%02d%02dZONEREFZONEINIT131211109876UPDATENOTIFYCQUERYUCQUERYMIQUERYQUERYNOCHANGE14ZONEERRNOTAUTHNXRRSETYXRRSETYXDOMAINREFUSEDNOTIMPNXDOMAINSERVFAILFORMERRNOERRORADDITIONALPREREQUISITESZONE. @ %s %s ( %lu; serial ; refresh ; retry ; expiry ); minimum %u %u %u %u %u %u %u ( %d )0x%04x %u %u ( %s %d %lu %s %sunknown RR typeRR format error\#( ; %s %02x ; ##8#lhhh@#P #|###`#" "\\len <= *buflen/usr/src/lib/libc/../libc/net/ns_print.c ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=assertion "%s" failed: file "%s", line %d 66666666666666666666%d%cr<4=<4=4==<4=<HASH: Out of overflow pages. Increase page size iiiiiiiiiii m@xndnn0nL~n<{nvn8qndlninfn`n ]nZnTn&NnL(In*CnD*=nD*8n/.n2(nlZ"n]n,zn4}nDn\m\mxmm(4m@mEmmmmm @mt@Bʚ;Ƥ~@P.ܲزӲ˲ƲHC9/& ܲ/tmp/EdDk.XXXXXXXXXX`L1    @ 9@MNOPQRVac`dEe1u,zqjR@  @ @  @ 951*@6zrmc@\V M@D>@83,##.a!V!S!P!K!E!A!T)TD$TD!T T,TLTlbbXbYb baaaPaea@a +aa a`!````Њ[`P` `\__QW__T__`_ _^^ ^j^@^"^^]]>T"$T"ih@hUh̊ggTgg@_QW_`gCg g oUf ff Tpf _QW_@f&ff ee ee U@e "ee dd dd dfd `d@d :d@d YV"d" mhm)QW@mmm|)QWlQWQWQWllqll*kll*elMl*Hl/ll*)ll*#l l*lkl*kl*k l*kkl*kl*kk*$T*Yk@)QWQW>TBk*pp`uppulp@pu$T1>TBk1ss5rrh6pr6Xr r6 rq7qq|7$T2>TBk2connect to a siteclose current connectionforcibly logout remote user and close the connectionexit telnetprint status informationprint help informationtransmit special characters ('send ?' for more)set operating parameters ('set ?' for more)unset operating parameters ('unset ?' for more)toggle operating parameters ('toggle ?' for more)change state of special charaters ('slc ?' for more)display operating parameterssuspend telnetcompute response to s/key challengeinvoke a subshellchange environment variables ('environ ?' for more)try to enter line or character mode ('mode ?' for more)x~0wp1wU+w +vll:wll:fH1 r lw`$wH'v48w"w 2wr/ T/w2>TFwdeprecated command -- use 'toggle crmod' insteaddeprecated command -- use 'set escape' instead$TFU-`.@(#) Copyright (c) 1988, 1990, 1993 The Regents of the University of California. All rights reserved. @(#)main.c 8.2 (Berkeley) 12/15/93@(#)network.c 8.2 (Berkeley) 12/15/93@(#)ring.c 8.1 (Berkeley) 6/6/93@(#)sys_bsd.c 8.2 (Berkeley) 12/15/93@(#)telnet.c 8.2 (Berkeley) 12/15/93~""""@(#)terminal.c 8.1 (Berkeley) 6/6/93@(#)tn3270.c 8.2 (Berkeley) 5/30/95@(#)utilities.c 8.2 (Berkeley) 12/15/93LGA=:60,)&"  {tmf_XQJ=6+؂͂sd\P& ,)&"=ALG ۃփ҃΃Ƀă(standard output)\^:   }) 0/dev/ptyXX/? ?H ? ? ? ? ?8 ?p ? ? ? ?P ?FAFGFBFFbFCFcFdFEFfnFlZFLMFF?FF:F.Fi"FnFxF FhEsEZEEzEqErEeEvEqEaEUEuEVEHtEwo [Xs Dv VXs Dv PXt Dv LXt Dv FX@y y  $FreeBSD: src/lib/msun/src/s_ilogb.c,v 1.6 1999/08/28 00:06:49 peter Exp $\]^7ba_`c8V9Mdefg:U;J<H=>LhW?O@NiAB CD  !"#$%E &'()*+,-./F 0123456789G :;<=>?@ABCH D E F GIJKjkLMKNIOP[lmcnoQRpqRSrZstuvwxSyz{|}~TPUQVTW9 l Fx%%p%c%%{10}%%/%%{16}%%*%%p%c%%{10}%%m%%+@(#)history.c 8.1 (Berkeley) 6/4/93$  0   D    (  ` t \    T <  l (  H L 4  D L < T \ l d  \    T L  4 \     T 8  l  < z { Hx  y \z 8~ @{  \{ z 7g7U@77X76Y66;66Z`6J6= 66B55A5m5RR5C5Q,55M44N4h4C@4,4H43V33W3`3K 33L22'`2G2& 22511,1x1-@101%10)000`0<040/#/|/.@/!/1 /.(..3../`.3.2.-$--*--+`-=-(---,,,r,e, N,?, ,, +++`+ @+*++****c*@***)")))))u)Y)J)7)())(!(( (( (o(@(-(('''''`'B' ''&&&w&@&& &%%%%=1 ' ""   !,-5/"""""""""""""""""""""""""""""""$""""""""""""""""""""""""#&"0"""""."""""4"%""""""""#&"0""""".""""""4"%"""""""B=   !A;""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" "" """   !"A""""/""" """ """"""L"RZK"""Q"7I: UH""@""NG"PTWY"D"""" ""6J9<>C"? "M"F"OSVX"E"""""8""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""J% \%c 8? O%` V%a c%q ? fwdbck:*DDDDDCCCCCCCCCCCCyCvCfCcCSCPC8C5C)C&CCCCBBBBBBBBBBBBB{BxBbB_BRBOB@B=B'B$BBBBBAAAAAAAAAAA}AgAdAQANA Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`??`l$FreeBSD: src/lib/libc/stdio/asprintf.c,v 1.6 1999/08/28 00:00:55 peter Exp $qrWrLr1r$r rqqqqqqqtqiqPq Eq1q 'q q qp pp pppmpbp@p"ppoorrrrrrrrrr r r uuuuuuuuuuuu u u u ~u qu nu du au Qu NuKuGuCu?u;u7u3u/u+u'u$u uuuuuu uuuur t!t"t#t$t%t&t't(t)zt*pt+jt,ct-Vt-Ot.Et.?t/7t/2t0.t1*t2$t3t4t5t6t7 t8t9s:s;s<s=s>s?s@s[s\~s\is]^s^Ls^As_8s_+s` s{ s{r|r}r}r~rzzzzzztzCCCCCCC/dev/|||w|p|f|Y|P|F|=|3|,|"||||{{@(#)getbsize.c 8.1 (Berkeley) 6/4/93WSNFA<60*# Ï~wWrje_ssttuC  d k@`? Ϝl@ ݟџ͟ mtssu t`x{zz`|{d8lx@(#)localtime.c 7.57WILDABBRSS@(#)asctime.c 7.7$FreeBSD: src/lib/libc/net/ns_netint.c,v 1.2 1999/08/28 00:00:14 peter Exp $$FreeBSD: src/lib/libc/net/ns_name.c,v 1.2 1999/08/28 00:00:14 peter Exp $0123456789Unknown error: D |T(` ,`@(RuneMagiNONEHBBBBB@(((((((((((((((          (((((((    ((((((    ((((  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~@U2 0000000000000000}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMD7yACnF?O8M20HwZ