<fjQPS1Pjf1ɎَѼ|}r,g|uuƀrIᾬ}R1҉ 5w ޿))0`duddu`ûDL Ss*}}0r4uRZr?tfFRff1fC0fZf=wD@(f8r^P[s Ot0FsF ^(Fw.yURAZoUd]BReadBoot error PUWEVfd1440P$@ ,WEV(i @ @ @ BTX@1мfjf9W_s uU}EEE Efh ( f"1ɱѱ8ٺ6 -)б3QPhj+5 QQQQRja 1f֐ юَH"1Ўػptr4!PP 栈!桰!桰!XX!j@j td>0tc>2tk> u~tEj$USm]]fEfE EfCe[]XPPPP`jr11t$PV^=1ɱ󥖋D$@t+rBR/=_D$HuKKf)8󥑉-w1)ثufȫd$aσuD$ `X6rtltŰ=Vtf\tGt3CRu fu6 Ж1t -t ^ u 뎪PXPX$< i/ u`1ɴPf 8cuf1< tPЀfBPr0ƀrf Pffag ?P}9m(t int@errDeflPeipHeax4ebx(ecx0edx,esiediebp espcsLds es fsgssscs:eipHss:espBTX halted'11b100 1h01 5 1Çl$EMU ]$PXE(PD$E,D$Xu0}4l$UWVS0 1 )@*1Ҁ=@*|D*H* )@L*00T0j)001۾00011tO00 ы1 у? C~h"zthh`*P`*=`*t&Sh"h# S t1`*tH`,=`,u:u#j h#S j7u Su jh#S h`,P*aP5H*D*"@*Ph #| $tt jZtw`*j$ƃ u ttA, t"u"`*vOj j 1"-`*=}GtV uj 1h`*t j h`, UUWVSEP8u =0 URhV#r j4EP8PEf= t=ELFh]#hd#0 }+10uS8RE%uS8PYqE%EË1ډ0jEPS E܅PS8P !]jS8R3VS8PlE0Dž41f}t=1j \/S8R;u 4FE9} 4~11\/+1D/0t/S8P<T F~ŋE%Ë1ډ0UMA9DE0jP0Z=0tCPh"!.K:Sut @A:uu:kCÍ9rhS6߃t=0tj 1ۅ~:/uB 1u[^_US]Su u#9u1h]#hd#V] UWVS]=\*u}= *uh@7 *(*jj5 *{u+hd5 *h $=|)Tth#8P$ 4*\*u19(*54*15$lj $<$!=8$=0$15$Ƌ $> $P5 *f15$)5 * (*00*,*E E05))9uvuUU6 p$0  <)k)90*tI=$*uh@$*54* $)P5$*)0*C=$$*:  C p$ )9wu;)w5P$5)#5X)5`)#5l$9=,*t* P $P5 *S=,*0#X));uvuV *PMQu50)uEe[^_ UWVS=\*U=8*uhx8*T*jj58* 8*þL*ǃw=1ڀzu uw Fu t Fvڃ=L*uL*t#t\{t h#CT*jT*@P58*(uy 8*9WEVu WEVt=P*tih#E=X*ufyu D*X*P*9suh#hd#4#T*uT*E E Pue[^_ UWVS}u %Gst% ctut0xt+vvo^;tdPqC;uSEuuE F]1u#CȅuKE9rP&KE9sPGN1e[^_US] uj S]UVSuUM t ACJu[^ U=<*u1$1%)У<*<*U‰<*UE000UWVS]} u$$Ph#b00%1 0=0f1؃10 5@*51i01u1W0Ph#e[^_ UVSu=`0|21jt l+1u9r9r1e[^US]$t(0%01$tS؋]US]=`0|I$tjBt u&j3*$ttu t1]US]00 u 0 14[fRf fZBB--uf1ɵ@ tD$ f1$ÐDhaCcdgnPrsv  """""dafd wdad%s /boot.config%s: %s/boot/loader/kernel >> FreeBSD/i386 BOOT Default: %u:%s(%u,%c)%s boot: No %s formatInvalid %s yesnoKeyboard: %s Not ufs slicelabelpartition%cDisk error 0x%x (lba=0x%x) 0123456789abcdef/|\- 083γ@@   2γ@` K/mnt@@<@T 082γ@@   2γ@`S}@@<@TU 2γ@@  K0(4 < h _9 )@A2γ@2γ@2γ@|TA2γ@2γ@2γ@"+1γ@1γ@2γ@YR`@!1γ@1γ@2γ@_t!1γ@1γ@2γ@C:!1γ@1γ@2γ@|!1γ@1γ@2γ@Tz!1γ@1γ@2γ@H;S!1γ@1γ@2γ@h4!1γ@1γ@2γ@ r(!1γ@1γ@2γ@w!1γ@1γ@2γ@^!1γ@1γ@2γ@ud!1γ@1γ@2γ@̭I_!1γ@1γ@2γ@3 !1γ@1γ@2γ@-({!1γ@1γ@2γ@NCmA2γ@2γ@2γ@3X!1γ@1γ@2γ@SHF!1γ@1γ@2γ@ԍ(!1γ@1γ@2γ@ } !1γ@1γ@2γ@4t!1γ@1γ@2γ@zq!1γ@1γ@2γ@]s!1γ@1γ@2γ@=!1γ@1γ@2γ@k|!1γ@1γ@2γ@9e!1γ@1γ@2γ@ 7҄!1γ@1γ@2γ@ ^!1γ@1γ@2γ@ Rq!1γ@1γ@2γ@ oB!1γ@1γ@2γ@ `!1γ@1γ@2γ@ x!1γ@1γ@2γ@ ;!1γ@1γ@2γ@ !1γ@1γ@2γ@ [W!1γ@1γ@2γ@ Ћ!1γ@1γ@2γ@ 7!1γ@1γ@2γ@ 2*!1γ@1γ@2γ@ 8oM!1γ@1γ@2γ@ 4d.!1γ@1γ@2γ@ "!1γ@1γ@2γ@ f,!1γ@1γ@2γ@ ?!1γ@1γ@2γ@ u!1γ@1γ@2γ@ [ M!1γ@1γ@2γ@ h!1γ@1γ@2γ@ F!1γ@1γ@2γ@ 2Aia!1γ@1γ@2γ@ T!1γ@1γ@2γ@ F!1γ@1γ@2γ@ L!1γ@1γ@2γ@ `I!1γ@1γ@2γ@  O7!1γ@1γ@2γ@ u!1γ@1γ@2γ@ 띍X!1γ@1γ@2γ@ w˒8!1γ@1γ@2γ@ –[!1γ@1γ@2γ@ !p[!1γ@1γ@2γ@ $N!1γ@1γ@2γ@tGM!1γ@1γ@2γ@t!1γ@1γ@2γ@tme!1γ@1γ@2γ@tDj!1γ@1γ@2γ@t !1γ@1γ@2γ@tdYhq!1γ@1γ@2γ@tuA!1γ@1γ@2γ@t[9!1γ@1γ@2γ@tw!1γ@1γ@2γ@t.gl!1γ@1γ@2γ@t#!1γ@1γ@2γ@t\J&!1γ@1γ@2γ@t*,!1γ@1γ@2γ@t92!1γ@1γ@2γ@t 69!1γ@1γ@2γ@t:!1γ@1γ@2γ@t !1γ@1γ@2γ@t=G!1γ@1γ@2γ@t0!1γ@1γ@2γ@tKZa!1γ@1γ@2γ@tq!1γ@1γ@2γ@u\v!1γ@1γ@2γ@v×@c!1γ@1γ@2γ@v^;f!1γ@1γ@2γ@vh>.!1γ@1γ@2γ@vA!Y!1γ@1γ@2γ@vj>!1γ@1γ@2γ@v jg!1γ@1γ@2γ@v{4!1γ@1γ@2γ@vl!1γ@1γ@2γ@v5!1γ@1γ@2γ@vF!1γ@1γ@2γ@vcL7!1γ@1γ@2γ@v!1γ@1γ@2γ@v l!1γ@1γ@2γ@vFglX!1γ@1γ@2γ@v| !1γ@1γ@2γ@v-!1γ@1γ@2γ@vCR!1γ@1γ@2γ@vj!1γ@1γ@2γ@vL!1γ@1γ@2γ@vv!1γ@1γ@2γ@v;g*!1γ@1γ@2γ@w,w")!1γ@1γ@2γ@wNssK!1γ@1γ@2γ@qc!1γ@1γ@2γ@HK]:!1γ@1γ@2γ@}dK!2γ@2γ@2γ@'+!2γ@2γ@2γ@flj!2γ@2γ@2γ@ɾ,!2γ@2γ@2γ@H!2γ@2γ@2γ@uUSa!2γ@2γ@2γ@fa!2γ@2γ@2γ@ .!2γ@2γ@2γ@ݓ*!2γ@2γ@2γ@ i!2γ@2γ@2γ@m!2γ@2γ@2γ@w!2γ@2γ@2γ@b!2γ@2γ@2γ@ uf!2γ@2γ@2γ@m#-!2γ@2γ@2γ@!2γ@2γ@2γ@k?!2γ@2γ@2γ@ 8H!2γ@2γ@2γ@0 !2γ@2γ@2γ@E(o!2γ@2γ@2γ@E T!2γ@2γ@2γ@W9!2γ@2γ@2γ@Wz7)!2γ@2γ@2γ@WvX!2γ@2γ@2γ@W9LvS!2γ@2γ@2γ@W A!2γ@2γ@2γ@W"9!2γ@2γ@2γ@WeØ|!2γ@2γ@2γ@WVd> !2γ@2γ@2γ@W*g!2γ@2γ@2γ@W6!2γ@2γ@2γ@W6X!2γ@2γ@2γ@WC!2γ@2γ@2γ@Wtb!!2γ@2γ@2γ@Wثa!2γ@2γ@2γ@WG[!2γ@2γ@2γ@W9ʵ!2γ@2γ@2γ@W= a!2γ@2γ@2γ@W\V !2γ@2γ@2γ@W^!2γ@2γ@2γ@W$~!2γ@2γ@2γ@Ww!2γ@2γ@2γ@Zt !2γ@2γ@2γ@+WZ!2γ@2γ@2γ@+zH!2γ@2γ@2γ@+;7!2γ@2γ@2γ@+,2<!2γ@2γ@2γ@+M!2γ@2γ@2γ@+Ʈ!2γ@2γ@2γ@+["H!2γ@2γ@2γ@+dU!2γ@2γ@2γ@+ҶT!2γ@2γ@2γ@+!2γ@2γ@2γ@+~!2γ@2γ@2γ@+GW-!2γ@2γ@2γ@+HGU!2γ@2γ@2γ@+м@!2γ@2γ@2γ@+@0!2γ@2γ@2γ@+ Q!2γ@2γ@2γ@+M5M!2γ@2γ@2γ@+U!2γ@2γ@2γ@+W!2γ@2γ@2γ@+&!2γ@2γ@2γ@+y*!2γ@2γ@2γ@ *!2γ@2γ@2γ@Z+!2γ@2γ@2γ@ ^!2γ@2γ@2γ@SX,!2γ@2γ@2γ@`A!2γ@2γ@2γ@!2γ@2γ@2γ@h?!2γ@2γ@2γ@?!2γ@2γ@2γ@!2γ@2γ@2γ@6J!2γ@2γ@2γ@ ><\!2γ@2γ@2γ@ !2γ@2γ@2γ@ q@!2γ@2γ@2γ@ in!2γ@2γ@2γ@#E+F!2γ@2γ@2γ@ 6~!2γ@2γ@2γ@ `2γ@2γ@2γ@ttyv0!2γ@2γ@2γ@VBD!2γ@2γ@2γ@4bBD!2γ@2γ@2γ@BD!2γ@2γ@2γ@MD\!2γ@2γ@2γ@/N7!2γ@2γ@2γ@[[!2γ@2γ@2γ@3!2γ@2γ@2γ@9 !2γ@2γ@2γ@R)!2γ@2γ@2γ@T[K!2γ@2γ@2γ@S!2γ@2γ@2γ@ӧ-P!2γ@2γ@2γ@qv!2γ@2γ@2γ@4;!2γ@2γ@2γ@,k-|!2γ@2γ@2γ@|!2γ@2γ@2γ@9sh!2γ@2γ@2γ@;=!2γ@2γ@2γ@ !2γ@2γ@2γ@(!2γ@2γ@2γ@{p}!2γ@2γ@2γ@ !2γ@2γ@2γ@ #)r!2γ@2γ@2γ@ Y!2γ@2γ@2γ@ m!2γ@2γ@2γ@ s!2γ@2γ@2γ@ !r!2γ@2γ@2γ@ (d!2γ@2γ@2γ@ Vu!2γ@2γ@2γ@ rR!2γ@2γ@2γ@ !2γ@2γ@2γ@w[K!2γ@2γ@2γ@Z4!2γ@2γ@2γ@!2γ@2γ@2γ@N!2γ@2γ@2γ@̉1l!2γ@2γ@2γ@rzv!2γ@2γ@2γ@!2γ@2γ@2γ@1u!2γ@2γ@2γ@ !2γ@2γ@2γ@MN!2γ@2γ@2γ@!2γ@2γ@2γ@7p!2γ@2γ@2γ@D!2γ@2γ@2γ@B!2γ@2γ@2γ@el!2γ@2γ@2γ@MA!2γ@2γ@2γ@a1+!2γ@2γ@2γ@Q)!2γ@2γ@2γ@O!2γ@2γ@2γ@M!S!2γ@2γ@2γ@Id'!2γ@2γ@2γ@.3e!2γ@2γ@2γ@o=E!2γ@2γ@2γ@!2γ@2γ@2γ@0!2γ@2γ@2γ@9!2γ@2γ@2γ@!).s!2γ@2γ@2γ@Yg!2γ@2γ@2γ@wl.!2γ@2γ@2γ@E!2γ@2γ@2γ@->hg!2γ@2γ@2γ@y!2γ@2γ@2γ@z!2γ@2γ@2γ@UN!2γ@2γ@2γ@H!2γ@2γ@2γ@f!2γ@2γ@2γ@x!2γ@2γ@2γ@ Rm$K!2γ@2γ@2γ@@D#\!2γ@2γ@2γ@!2γ@2γ@2γ@pJq!2γ@2γ@2γ@Zb!2γ@2γ@2γ@v !2γ@2γ@2γ@ 0^!2γ@2γ@2γ@ R%!2γ@2γ@2γ@ou!2γ@2γ@2γ@Y-!2γ@2γ@2γ@RP!2γ@2γ@2γ@isb!2γ@2γ@2γ@jIn!2γ@2γ@2γ@o?#!2γ@2γ@2γ@4F!2γ@2γ@2γ@T!2γ@2γ@2γ@hhE!2γ@2γ@2γ@'G!2γ@2γ@2γ@'9W!2γ@2γ@2γ@2!!2γ@2γ@2γ@ܸ;!2γ@2γ@2γ@hAr>!2γ@2γ@2γ@<v^P!2γ@2γ@2γ@7T!2γ@2γ@2γ@;m%!2γ@2γ@2γ@; v&J!2γ@2γ@2γ@8K{!2γ@2γ@2γ@@8TJ(!2γ@2γ@2γ@9!A2γ@2γ@2γ@̔bm't(ͳ@(ͳ@2γ@xhH !m 2γ@2γ@2γ@ ]A1γ@1γ@2γ@&>A1γ@1γ@2γ@9A2γ@2γ@2γ@R+eB1}p4/ Tw|7j3]剸0?"P<1SY2!kxp6jP,jojQq >ƛy.|>?^9KG 4~ҳ/?A˪TR~2yqֆ:XEo 6"d Q1E2j'8ddp;* K# ...nit` ;; agpgart) mknod agpgart c 148 0 ;; twe*) unit=`expr $i : 'twe\(.*\)'` mknod twe$unit c 146 `unit2minor $unit` ;; tw*) unit=`expr $i : 'tw\(.*\)'` mknod tw$unit c 19 `unit2minor $unit` root:operator ;; cfs*) unit=`expr $i : 'cfs\(.*\)'` mknod cfs$unit c 93 $unit root:operator ;; nsmb*) unit=`expr $i : 'nsmb\(.*\)'` mknod nsmb$unit c 144 $unit ;; local) umask 0 # XXX should be elsewhere sh MAKEDEV.local umask 77 ;; *) echo $i - no such device name ;; esac done  . .. 0 1 2 3 4 5 6 7 8|9  . ..! fixit_crunch! cat!chmod+!chroot! cp! dd! df!echor+!exprr+!killr+! ln! ls!mkdir+! mv! rm!rmdir+!sleep+!syncr+!chown+!clrir+! disklabel+!dmesg+!fdisk+!mknod+!mount+!reboot!restore!swapon!umount! mount_msdos! mount_cd9660!rrestoret+!chgrp+! ftp!telnet! vi!grepr+!viewr+! ex"tar$ ...% . ..& protocols'group(spwd.db)services  . .. dev stand# bin$sbin% etc* mnt+mnt1,mnt2-mnt3.mnt4/ tmp0 usr4@.profile wfd0s1rwfd0s1wfd0s1arwfd0s1at+wfd0s1brwfd0s1bt+wfd0s1crwfd0s1ct+wfd0s1drwfd0s1dt+wfd0s1erwfd0s1et+wfd0s1frwfd0s1ft+wfd0s1grwfd0s1gt+wfd0s1hrwfd0s1ht+wfd0s2rwfd0s2wfd0s3rwfd0s3wfd0s4rwfd0s4rwst04 vn0rvn0r+vn0ap4rvn0a+vn0bp4rvn0b+vn0cp4rvn0c+vn0dp4rvn0d+vn0ep4rvn0e+vn0fp4rvn0f+vn0gp4rvn0g+vn0hp4rvn0h+vn0s14rvn0s1vn0s1arvn0s1avn0s1brvn0s1bvn0s1crvn0s1cvn0s1drvn0s1dvn0s1ervn0s1evn0s1frvn0s1fvn0s1grvn0s1gvn0s1hrvn0s1hvn0s24rvn0s2vn0s34rvn0s3vn0s44rvn0s4cd0ap4cd0cp4rcd0a+rcd0c+sa0.ctlrsa0.ctlt+sa0.04rsa0.0nsa0.0nrsa0.0esa0.0ersa0.0sa0.14rsa0.1nsa0.1nrsa0.1esa0.1ersa0.1sa0.24rsa0.2nsa0.2nrsa0.2esa0.2ersa0.2sa0.34rsa0.3 sa0nsa0.3nrsa0.3esa0.3ersa0.3rsa0r+nsa0r+nrsa0+esa0r+ersa0+ttyv04ttyv14 vgacuaa04cuaia0cuala0ttyp04ptyp04ttyp14ptyp14ttyp24ptyp24ttyp34ptyp34ttyp44ptyp44ttyp54ptyp54ttyp64ptyp64ttyp74ptyp74ttyp84ptyp84ttyp94ptyp94ttypa4ptypa4ttypb4ptypb4ttypc4ptypc4ttypd4ptypd4ttype4ptype4ttypf4ptypf4ttypg4ptypg4ttyph4ptyph4ttypi4ptypi4ttypj4ptypj4ttypk4ptypk4ttypl4ptypl4ttypm4ptypm4ttypn4ptypn4ttypo4ptypo4ttypp4ptypp4ttypq4ptypq4ttypr4ptypr4ttyps4ptyps4ttypt4ptypt4ttypu4ptypu4ttypv4ptypv4ttyd04ttyid0ttyld0 zs0kbd0p4mse0p4psm0p4 sysmouse  consolectl lpt0p4 lpctl0 ppi0p4iic0p4smb0p4ums0p4tun0p4 ch0tap0p4 apmapmctlcard04pass04xpt0p4 i4bi4bctli4btrc0i4btrc1i4btel0i4bteld0Di4brbch0#!/bin/sh - # # Copyright (c) 1990 The Regents of the University of California. # All rights reserved. # # Written and contributed by W. Jolitz 12/90 # # Redistribution and use in source and binary forms are permitted provided # that: (1) source distributions retain this entire copyright notice and # comment, and (2) distributions including binaries display the following # acknowledgement: ``This product includes software developed by the # University of California, Berkeley and its contributors'' in the # documentation or other materials provided with the distribution and in # all advertising materials mentioning features or use of this software. # Neither the name of the University nor the names of its contributors may # be used to endorse or promote products derived from this software without # specific prior written permission. # THIS SOFTWARE IS PROVIDED ``AS IS'' AND WITHOUT ANY EXPRESS OR IMPLIED # WARRANTIES, INCLUDING, WITHOUT LIMITATION, THE IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. # # @(#)MAKEDEV 5.2 (Berkeley) 6/22/90 # $FreeBSD: src/etc/MAKEDEV,v 1.243.2.67 2004/04/07 09:53:54 rik Exp $ # # Device "make" file. Valid arguments: # all makes all known devices, standard number of units (or close) # std standard devices # jail suitable for a jail(8) # local configuration specific devices # mach-4 mach4&lites+devices for Mach's XFree86 distribution # (see http://www.cs.hut.fi/lites.html for more info on LITES) # # Tapes: # ast* ATAPI tape drives # wt* QIC-interfaced (e.g. not SCSI) 3M cartridge tape # sa* SCSI Sequential Access Devices # # Disks: # aac* Adaptec FSA RAID controllers # aacd* Adaptec FSA RAID # acd* ATAPI CD-ROM disks # ad* ATA disks # afd* ATAPI floppy disks # amrd* AMI MegaRAID # cd* SCSI CD-ROM disks # da* SCSI Direct Access Devices # fd* floppy disk drives (3 1/2", 5 1/4") # fla* M-Systems DiskOnChip # idad* Compaq Smart-2 RAID arrays # mcd* Mitsumi CD-ROM disks # md* Memory (or malloc) disk # mlx* Mylex DAC960 RAID controllers # mlxd* Mylex DAC960 RAID disk volumes # pst* Promise SuperTrak RAID disks # scd* Sony CD-ROM disks # vn* vnode disks # # Console ports: # vty* virtual console devices for syscons/pcvt/codrv # # Pointing devices: # mse* Logitech and ATI Inport bus mouse # psm* PS/2 mouse # jogdial Sony VAIO Jogdial # sysmouse Mousesystems mouse emulator for syscons # # Time devices: # refclock-* serial ports used by xntpd parse refclocks # # Terminal ports: # tty* general purpose serial ports # cua* dialout serial ports # ttyA* Specialix SI/XIO dialin ports ('*' = number of devices) # cuaA* Specialix SI/XIO dialout ports # ttyD* Digiboard - 16 dialin ports # cuaD* Digiboard - 16 dialout ports # ttyE* Stallion EasyIO (stl) dialin ports # cuaE* Stallion EasyIO (stl) dialout ports # ttyF* Stallion Brumby (stli) dialin ports # cuaF* Stallion Brumby (stli) dialout ports # ttyR* Rocketport dialin ports # cuaR* Rocketport dialout ports # ttyx* Cronyx/Sigma serial ports (dialout) # ttyy* Cronyx/Sigma serial ports (dialout) # ttyz* Cronyx/Sigma serial ports (dialout) # cuax* Cronyx/Sigma serial ports (dialin) # cuay* Cronyx/Sigma serial ports (dialin) # cuaz* Cronyx/Sigma serial ports (dialin) # # stlN Stallion EasyIO board N dialin and dialout # stliN Stallion Brumby board N dialin and dialout # # Pseudo terminals: # pty* set of 32 master and slave pseudo terminals # vty* virtual terminals using syscons/pcvt/codrv console # # Parallel port: # lpt* Printer # ppi* Parallel port i/o # pps* Pulse per second timing interface # pcfclock* Parallel time sync interface # # I2C and SMBus: # iic* I2C devices # smb* SMBUS devices # # USB devices: # usb* USB bus control device # ucom* USB serial and modem devices # ugen* generic USB device # uhid* Human Interface Device (HID) # ulpt* printer # ums* mouse # urio* Diamond Rio 500 # uscanner* USB scanners # # SCSI devices (other than CD-ROM, tape and disk): # ch* SCSI Media-Changer (juke box) driver # pt* Processor Type (HP scanner, as one example) # pass* CAM Passthrough device # ses* SES (SCSI Environmental Services) and # SAF-TE (Scsi Accessable Fault-Tolerant Enclosures) device # # PC-CARD (previously called PCMCIA) support # card* PC-CARD slots # # ISDN devices: # i4b isdnd call control device # i4bctl debugging control device # i4btrc* trace data interface(s), one per passive card # i4btel* telephony interface(s) # i4bteld* telephony dialout interface(s) # i4brbch* raw b channel access device(s) # # Special purpose devices: # apm Advanced Power Management BIOS # apmctl APM BIOS control device # bpf* packet filter # crypto crypto interface # speaker pc speaker # tw* xten power controller # snd* various sound cards # pcaudio PCM audio driver # socksys iBCS2 socket system driver # vat VAT compatibility audio driver (requires snd*) # gsc Genius GS-4500 hand scanner # joy pc joystick # tun* Tunneling IP device # tap* Ethernet Tunneling device # snp* tty snoop devices # spigot Video Spigot video acquisition card # ctx* Cortex-I video acquisition card # meteor* Matrox Meteor video acquisition card (pci) # bktr* Bt848 based video acquisition card (pci) # labpc* National Instrument's Lab-PC and LAB-PC+ # perfmon CPU performance-monitoring counters # pci PCI configuration-space access from user mode # ipl ipfilter control devices (ipl, ipnat, ipstate, ipauth) # kbd keyboard devices # elan-mmcr AMD Elan support (e.g. mmap MMCR) # agpgart AGP interface # cfs* Coda Distributed Filesystem # nsmb* SMB/CIFS protocol interface # ct* Control devices for Cronyx/Tau adapters # cx* Control devices for Cronyx/Sigma adapters # if [ -n "$MAKEDEVPATH" ]; then PATH="$MAKEDEVPATH" else PATH=/sbin:/bin fi umask 77 # Usage: die exitcode msg die() { echo $2 exit $1 } # Convert integer to partition name dkitop() { local p case $1 in 0) p=a;; 1) p=b;; 2) p=c;; 3) p=d;; 4) p=e;; 5) p=f;; 6) p=g;; 7) p=h;; *) p="?";; esac echo $p } # Convert integer to slice name dkitos() { local s case $1 in 0) s="";; 1) s="";; *) s=s$(($1-1));; esac echo $s } # Convert disk (type, unit, slice, partition) to minor number dkminor() { echo $(($1 << 25 | ($2 / 32) << 21 | ($2 % 32) << 3 | $3 << 16 | $4)) } # Override mknod(2) to add extra handling to it. mknod=/sbin/mknod for i in `IFS=':'; echo $PATH`; do if [ -x "${i}/mknod" ]; then mknod="${i}/mknod" break fi done mknod() { rm -f "$1" || exit 1 case $# in 4) "$mknod" "$@" root:wheel || die 2 "$mknod $@ failed";; 5) "$mknod" "$@" || die 2 "$mknod $@ failed";; *) die 2 "bad node: mknod $@";; esac } # Convert tape (ctrl, unit, mode, access) to minor number saminor() { echo $(($1 << 29 | ($2 / 16) << 16 | ($2 % 16) << 4 | $3 << 2 | $4)) } # Convert the last character of a tty name to a minor number. ttyminor() { case $1 in [0-9]) m=$1;; a) m=10;; b) m=11;; c) m=12;; d) m=13;; e) m=14;; f) m=15;; g) m=16;; h) m=17;; i) m=18;; j) m=19;; k) m=20;; l) m=21;; m) m=22;; n) m=23;; o) m=24;; p) m=25;; q) m=26;; r) m=27;; s) m=28;; t) m=29;; u) m=30;; v) m=31;; *) m="?";; esac echo $m } # Convert a unit number to a minor number. unit2minor() { echo $(((($1 >> 8) << 16) | ($1 % 256))) } # For the stallion devices tty[EF] # stallion major letter card iscallout stallion () { major=$1 letter=$2 card=$3 iscallout=$4 port=0 maxport=8 pref=tty owner= minorbase=0 if [ $iscallout -gt 0 ]; then pref=cua owner=uucp:dialer minorbase=128 fi case "$card" in [0-7]);; *) die 1 "Invalid stl card number $card";; esac # make the mem interface for extracting stats & loading microcode. # 0x1000000 + card number mknod staliomem$card c $major 0x0100000$card while [ $port -lt $maxport ]; do minor=$(($minorbase + $card * 1048576 + $port)) if [ $port -ge 32 ]; then minor=$(($minor + 65504)) fi unit=$(($card * 64 + $port)) mknod ${pref}${letter}$unit c $major $minor $owner mknod ${pref}i${letter}$unit c $major $(($minor + 32)) $owner mknod ${pref}l${letter}$unit c $major $(($minor + 64)) $owner port=$(($port + 1)) done } # Raw partition for disks dkrawpart=2 # Compatibility slice for disks dkcompatslice=0 # Raw slice for disks dkrawslice=1 # Standard umasks disk_umask=037 # allow group operator to read disks tape_umask=017 # allow group operator to read/write tapes for i in $*; do case $i in all) sh MAKEDEV std # standard sh MAKEDEV fd0 fd1 # bdev, floppy disk sh MAKEDEV da0 da1 da2 da3 # bdev, SCSI disk sh MAKEDEV ata # cdev, ATA control sh MAKEDEV ad0 ad1 ad2 ad3 # bdev, ATA disk sh MAKEDEV ar0 ar1 # bdev, ATA RAID disk sh MAKEDEV acd0 afd0 ast0 # bdev, ATAPI devices sh MAKEDEV wd0 wd1 wd2 wd3 # bdev, OLD disk sh MAKEDEV wcd0 wfd0 wst0 # bdev, OLD ATAPI devs sh MAKEDEV vn0 # bdev, virtual disk sh MAKEDEV cd0 mcd0 scd0 # bdev, cdrom sh MAKEDEV sa0 wt0 # bdev, tape sh MAKEDEV vty12 # cdev, virtual tty sh MAKEDEV cuaa0 cuaa1 cuaa2 cuaa3 # cdev, serial tty sh MAKEDEV pty0 # cdev, pseudo tty sh MAKEDEV ttyd0 ttyd1 ttyd2 ttyd3 # cdev, serial tty sh MAKEDEV zs0 # big-Alpha serial tty sh MAKEDEV kbd0 kbd1 # cdev, keyboard sh MAKEDEV mse0 psm0 jogdial sysmouse # cdev, mouse sh MAKEDEV pcaudio speaker snd0 # cdev, noise sh MAKEDEV lpt0 lpt1 lpt2 # cdev, printer sh MAKEDEV ppi0 ppi1 ppi2 # cdev, parallel port sh MAKEDEV iic0 iic1 # cdev, I2C device sh MAKEDEV smb0 smb1 # cdev, SMBus device sh MAKEDEV usb usb0 uhid0 ums0 ulpt0 ugen0 # cdev, USB devices sh MAKEDEV urio0 uscanner0 ucom0 # cdev, USB devices too sh MAKEDEV bpf0 bpf1 bpf2 bpf3 # cdev, network sh MAKEDEV ipl tun0 tun1 tun2 tun3 # cdev, network sh MAKEDEV tap0 tap1 tap2 tap3 # cdev, network sh MAKEDEV ch0 perfmon tw0 # cdev, miscellaneous sh MAKEDEV apm apmctl card0 card1 card2 card3 # cdev, laptop sh MAKEDEV pass4 xpt2 # cdev, CAM sh MAKEDEV i4b i4bctl i4btrc0 i4btrc1 # cdev, ISDN sh MAKEDEV i4btel0 i4btel1 i4bteld0 i4bteld1 # cdev, ISDN sh MAKEDEV i4brbch0 i4brbch1 # cdev, ISDN sh MAKEDEV agpgart # cdev, AGP sh MAKEDEV nsmb0 # cdev, SMB/CIFS sh MAKEDEV crypto # cdev, crypto sh MAKEDEV fw0 # cdev, firewire sh MAKEDEV dcons # cdev, dcons sh MAKEDEV ct # cdev, Cronyx/Tau sh MAKEDEV cx ttyx ttyy ttyz cuax cuay cuaz # cdev, Cronyx/Sigma ;; # a much restricted set of the above, to save precious i-nodes on the # fixit floppy fixit) sh MAKEDEV std # standard sh MAKEDEV fd0 # bdev, floppy disk sh MAKEDEV da0 # bdev, SCSI disk sh MAKEDEV ad0 # bdev, ATA disk sh MAKEDEV acd0 afd0 ast0 # bdev, ATAPI devices sh MAKEDEV wd0 # bdev, OLD disk sh MAKEDEV wcd0 wfd0 wst0 # bdev, OLD ATAPI devs sh MAKEDEV vn0 # bdev, virtual disk sh MAKEDEV cd0 # bdev, cdrom sh MAKEDEV sa0 # bdev, tape sh MAKEDEV vty2 # cdev, virtual tty sh MAKEDEV cuaa0 # cdev, serial tty sh MAKEDEV pty0 # cdev, pseudo tty sh MAKEDEV ttyd0 # cdev, serial tty sh MAKEDEV zs0 # big-Alpha serial tty sh MAKEDEV kbd0 # cdev, keyboard sh MAKEDEV mse0 psm0 sysmouse # cdev, mouse sh MAKEDEV lpt0 # cdev, printer sh MAKEDEV ppi0 # cdev, parallel port sh MAKEDEV iic0 # cdev, I2C device sh MAKEDEV smb0 # cdev, SMBus device sh MAKEDEV ums0 # cdev, USB devices sh MAKEDEV tun0 # cdev, network sh MAKEDEV tap0 # cdev, network sh MAKEDEV ch0 # cdev, miscellaneous sh MAKEDEV apm apmctl card0 # cdev, laptop sh MAKEDEV pass1 xpt1 # cdev, CAM sh MAKEDEV i4b i4bctl i4btrc0 i4btrc1 # cdev, ISDN sh MAKEDEV i4btel0 i4bteld0 # cdev, ISDN sh MAKEDEV i4brbch0 # cdev, ISDN rm -f fd/[1-9]? ;; std) mknod console c 0 0; chmod 600 console mknod kmem c 2 1 root:kmem; chmod 640 kmem mknod mem c 2 0 root:kmem; chmod 640 mem mknod null c 2 2; chmod 666 null mknod random c 2 3; chmod 644 random mknod urandom c 2 4; chmod 644 urandom mknod zero c 2 12; chmod 666 zero mknod io c 2 14; chmod 600 io mknod tty c 1 0; chmod 666 tty mknod klog c 7 0; chmod 600 klog mknod stdin c 22 0; chmod 666 stdin mknod stdout c 22 1; chmod 666 stdout mknod stderr c 22 2; chmod 666 stderr mknod pci c 78 0; chmod 644 pci mkdir -p fd (cd fd && i=0 && while [ $i -lt 64 ]; do mknod $i c 22 $i i=$(($i + 1)) done ) chmod 555 fd chmod 666 fd/* ;; jail) sh MAKEDEV std pty0 rm mem kmem pci io klog console # for security ln -sf null mem # for libkvm (ab)users ln -sf null kmem # --//-- ln -sf null console ;; mach-4) mknod iopl c 22 0 mknod kbd c 23 0 mknod mouse c 24 0 mknod time c 25 0 mknod timezone c 26 0 ;; # Create device files for new Archive/Wangtek QIC-02 tape driver (vak) wt*) umask $tape_umask u=`expr $i : '..\(.*\)'` if [ -z "${u}" ]; then u=0; fi # default density, 512b blocks mknod rwt${u} c 10 $(( 0 + $u)) root:operator mknod nrwt${u} c 10 $(( 4 + $u)) root:operator # default density, 1024b blocks # mknod rWt${u} c 10 $((64 + $u)) root:operator # mknod nrWt${u} c 10 $((68 + $u)) root:operator mknod rwt${u}b c 10 $((16 + $u)) root:operator # 60 megabytes mknod nrwt${u}b c 10 $((20 + $u)) root:operator mknod rwt${u}c c 10 $((24 + $u)) root:operator # 120 megabytes mknod nrwt${u}c c 10 $((28 + $u)) root:operator mknod rwt${u}d c 10 $((32 + $u)) root:operator # 150 megabytes mknod nrwt${u}d c 10 $((36 + $u)) root:operator # mknod rwt${u}e c 10 $((40 + $u)) root:operator # 300 megabytes? # mknod nrwt${u}e c 10 $((44 + $u)) root:operator # mknod rwt${u}f c 10 $((48 + $u)) root:operator # 600 megabytes? # mknod nrwt${u}f c 10 $((52 + $u)) root:operator umask 77 ;; # Individual slices. aacd*s*|ad*s*|ar*s*|afd*s*|amrd*s*|da*s*|fla*s*|idad*s*|md*s*|mlxd*s*|pst*s*|twed*s*|vn*s*|wd*s*|wfd*s*) umask $disk_umask case $i in aacd*s*) name=aacd; chr=151;; ad*s*) name=ad; chr=116;; ar*s*) name=ar; chr=157;; afd*s*) name=afd; chr=118;; amrd*s*) name=amrd; chr=133;; da*s*) name=da; chr=13;; fla*s*) name=fla; chr=102;; idad*s*) name=idad; chr=109;; md*s*) name=md; chr=95;; mlxd*s*) name=mlxd; chr=131;; pst*s*) name=pst; chr=168;; twed*s*) name=twed; chr=147;; vn*s*) name=vn; chr=43;; wd*s*) name=wd; chr=3;; wfd*s*) name=wfd; chr=87;; esac case $i in aacd*s*|amrd*s*|idad*s*|mlxd*s*|twed*s*) unit=`expr $i : '....\([0-9]*\)s'` slice=`expr $i : '....[0-9]*s\([0-9]*\)'` part=`expr $i : '....[0-9]*s[0-9]*\(.*\)'` ;; afd*s*|fla*s*|pst*s*|wfd*s*) unit=`expr $i : '...\([0-9]*\)s'` slice=`expr $i : '...[0-9]*s\([0-9]*\)'` part=`expr $i : '...[0-9]*s[0-9]*\(.*\)'` ;; *) unit=`expr $i : '..\([0-9]*\)s'` slice=`expr $i : '..[0-9]*s\([0-9]*\)'` part=`expr $i : '..[0-9]*s[0-9]*\(.*\)'` ;; esac case $unit in [0-9]|[0-9][0-9]|[0-4][0-9][0-9]|50[0-9]|51[0-1]) case $slice in [0-9]|[1-2][0-9]|30) oldslice=$slice slice=$(($slice+1)) slicename=`dkitos $slice` minor=`dkminor 0 $unit $slice $dkrawpart` mknod $name$unit$slicename c $chr $minor root:operator ln -f $name$unit$slicename r$name$unit$slicename case $part in [a-h]) case $oldslice in 0) slice=$oldslice ;; esac for part in 0 1 2 3 4 5 6 7 do minor=`dkminor 0 $unit $slice $part` partname=`dkitop $part` mknod $name$unit$slicename$partname \ c $chr $minor root:operator ln -f $name$unit$slicename$partname \ r$name$unit$slicename$partname done ;; "") ;; *) echo bad partition for disk in: $i ;; esac ;; *) echo bad slice for disk in: $i ;; esac ;; *) echo bad unit for disk in: $i "(unit=$unit, slice=$slice, part=$part)" ;; esac umask 77 ;; fd*) umask $disk_umask unit=`expr $i : '..\(.*\)'` name=fd; chr=9 case $unit in 0|1|2|3) mknod ${name}${unit} c $chr $(($unit * 64)) root:operator ln -f ${name}${unit} r${name}${unit} # Fake BSD partitions for i in a b c d e f g h do ln -f ${name}${unit} ${name}${unit}$i ln -f r${name}${unit} r${name}${unit}$i done # User-readable and programmer-readable name sets mknod ${name}${unit}.1720 c $chr $(($unit * 64 + 1)) \ root:operator ln -f ${name}${unit}.1720 r${name}${unit}.1720 # ln -f ${name}${unit}.1720 ${name}${unit}135hs21 # ln -f r${name}${unit}.1720 r${name}${unit}135hs21 mknod ${name}${unit}.1480 c $chr $(($unit * 64 + 2)) \ root:operator ln -f ${name}${unit}.1480 r${name}${unit}.1480 # ln -f ${name}${unit}.1480 ${name}${unit}135hs18 # ln -f r${name}${unit}.1480 r${name}${unit}135hs18 # ln -f ${name}${unit}.1480 ${name}${unit}96hs18 # ln -f r${name}${unit}.1480 r${name}${unit}96hs18 mknod ${name}${unit}.1440 c $chr $(($unit * 64 + 3)) \ root:operator ln -f ${name}${unit}.1440 r${name}${unit}.1440 # ln -f ${name}${unit}.1440 ${name}${unit}135 # ln -f r${name}${unit}.1440 r${name}${unit}135 # ln -f ${name}${unit}.1440 ${name}${unit}135ds18 # ln -f r${name}${unit}.1440 r${name}${unit}135ds18 # ln -f ${name}${unit}.1440 ${name}${unit}96ds18 # ln -f r${name}${unit}.1440 r${name}${unit}96ds18 mknod ${name}${unit}.1200 c $chr $(($unit * 64 + 4)) \ root:operator ln -f ${name}${unit}.1200 r${name}${unit}.1200 # ln -f ${name}${unit}.1200 ${name}${unit}96 # ln -f r${name}${unit}.1200 r${name}${unit}96 # ln -f ${name}${unit}.1200 ${name}${unit}96ds15 # ln -f r${name}${unit}.1200 r${name}${unit}96ds15 # ln -f ${name}${unit}.1200 ${name}${unit}135ds15 # ln -f r${name}${unit}.1200 r${name}${unit}135ds15 mknod ${name}${unit}.820 c $chr $(($unit * 64 + 5)) \ root:operator ln -f ${name}${unit}.820 r${name}${unit}.820 # ln -f ${name}${unit}.820 ${name}${unit}96hs10 # ln -f r${name}${unit}.820 r${name}${unit}96hs10 # ln -f ${name}${unit}.820 ${name}${unit}135hs10 # ln -f r${name}${unit}.820 r${name}${unit}135hs10 mknod ${name}${unit}.800 c $chr $(($unit * 64 + 6)) \ root:operator ln -f ${name}${unit}.800 r${name}${unit}.800 # ln -f ${name}${unit}.800 ${name}${unit}96ds10 # ln -f r${name}${unit}.800 r${name}${unit}96ds10 # ln -f ${name}${unit}.800 ${name}${unit}135ds10 # ln -f r${name}${unit}.800 r${name}${unit}135ds10 mknod ${name}${unit}.720 c $chr $(($unit * 64 + 7)) \ root:operator ln -f ${name}${unit}.720 r${name}${unit}.720 # ln -f ${name}${unit}.720 ${name}${unit}96ds9 # ln -f r${name}${unit}.720 r${name}${unit}96ds9 # ln -f ${name}${unit}.720 ${name}${unit}135ds9 # ln -f r${name}${unit}.720 r${name}${unit}135ds9 mknod ${name}${unit}.360 c $chr $(($unit * 64 + 8)) \ root:operator ln -f ${name}${unit}.360 r${name}${unit}.360 # ln -f ${name}${unit}.360 ${name}${unit}48 # ln -f r${name}${unit}.360 r${name}${unit}48 # ln -f ${name}${unit}.360 ${name}${unit}48ds9 # ln -f r${name}${unit}.360 r${name}${unit}48ds9 mknod ${name}${unit}.640 c $chr $(($unit * 64 + 9)) \ root:operator ln -f ${name}${unit}.640 r${name}${unit}.640 # ln -f ${name}${unit}.640 ${name}${unit}96ds8 # ln -f r${name}${unit}.640 r${name}${unit}96ds8 # ln -f ${name}${unit}.640 ${name}${unit}135ds8 # ln -f r${name}${unit}.640 r${name}${unit}135ds8 mknod ${name}${unit}.1232 c $chr $(($unit * 64 + 10)) \ root:operator ln -f ${name}${unit}.1232 r${name}${unit}.1232 # ln -f ${name}${unit}.1232 ${name}${unit}96ds8 # ln -f r${name}${unit}.1232 r${name}${unit}96ds8 # ln -f ${name}${unit}.1232 ${name}${unit}135ds8 # ln -f r${name}${unit}.1232 r${name}${unit}135ds8 ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; aacd*|ad*|ar*|afd*|amrd*|da*|fla*|idad*|md*|mlxd*|pst*|twed*|vn*|wd*|wfd*) umask $disk_umask case $i in aacd*) name=aacd; chr=151;; ad*) name=ad; chr=116;; ar*) name=ar; chr=157;; afd*) name=afd; chr=118;; amrd*) name=amrd; chr=133;; da*) name=da; chr=13;; fla*) name=fla; chr=102;; idad*) name=idad; chr=109;; md*) name=md; chr=95;; mlxd*) name=mlxd; chr=131;; pst*) name=pst; chr=168;; twed*) name=twed; chr=147;; vn*) name=vn; chr=43;; wd*) name=wd; chr=3;; wfd*) name=wfd; chr=87;; esac case $i in aacd*|amrd*|idad*|mlxd*|twed*) unit=`expr $i : '....\(.*\)'` ;; afd*|fla*|pst*|wfd*) unit=`expr $i : '...\(.*\)'` ;; *) unit=`expr $i : '..\(.*\)'` ;; esac case $unit in [0-9]|[0-9][0-9]|[0-4][0-9][0-9]|50[0-9]|51[0-1]) for slicepartname in s0h s1h s2 s3 s4 do sh MAKEDEV $name$unit$slicepartname done ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; ccd*) umask $disk_umask name=ccd chr=74 unit=`expr $i : '...\(.*\)'` case $unit in [0-9]|[0-9][0-9]|[0-4][0-9][0-9]|50[0-9]|51[0-1]) for part in 0 1 2 3 4 5 6 7 do minor=`dkminor 0 $unit 0 $part` partname=`dkitop $part` mknod $name$unit$partname c $chr $minor root:operator ln -f $name$unit$partname r$name$unit$partname done ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; # SCSI processor type driver pt[0-9]*) chr=61 name=pt unit=`expr $i : 'pt\([0-9][0-9]*\)'` if [ -z "${unit}" ]; then unit=0 fi unit=$(($unit + 1 - 1)) mknod ${name}${unit} c $chr `unit2minor $unit` ;; # SCSI SES/SAF-TE type driver ses[0-9]*) chr=110 name=ses unit=`expr $i : 'ses\([0-9][0-9]*\)'` if [ -z "${unit}" ]; then unit=0 fi unit=$(($unit + 1 - 1)) mknod ${name}${unit} c $chr `unit2minor $unit` ;; # SCSI target mode sample driver targ[0-9]*) chr=65 name=targ unit=`expr $i : 'targ\([0-9][0-9]*\)'` if [ -z "${unit}" ]; then unit=0 fi unit=$(($unit + 1 - 1)) mknod ${name}${unit} c $chr `unit2minor $unit` mknod ${name}.ctl c $chr 0xffff00ff ;; # CAM transport layer device xpt*) # This major number is temporary chr=104 name=xpt units=`expr $i : 'xpt\(.*\)'` if [ -z "${units}" ]; then units=1 fi i=0 while [ $i -lt $units ]; do dname=$name$i rm -rf $dname r$dname mknod $dname c $chr `unit2minor $i` root:operator i=$(($i + 1)) done ;; # CAM passthrough device pass*) # This major number is temporary chr=31 name=pass units=`expr $i : 'pass\(.*\)'` if [ -z "${units}" ]; then units=1 fi i=0 while [ $i -lt $units ]; do dname=$name$i rm -rf $dname r$dname mknod $dname c $chr `unit2minor $i` root:operator i=$(($i + 1)) done ;; pty*) class=`expr $i : 'pty\(.*\)'` case $class in 0) offset=0 name=p;; 1) offset=32 name=q;; 2) offset=64 name=r;; 3) offset=96 name=s;; # Note that xterm (at least) only look at p-s. 4) offset=128 name=P;; 5) offset=160 name=Q;; 6) offset=192 name=R;; 7) offset=224 name=S;; # This still leaves [tuTU]. *) echo bad unit for pty in: $i;; esac umask 0 case $class in 0|1|2|3|4|5|6|7) i=0 while [ $i -lt 32 ]; do # This was an awk substr() before. c=$(echo 0123456789abcdefghijklmnopqrstuv | dd bs=1 skip=$i count=1 2>/dev/null) mknod tty$name$c c 5 $(($offset + $i)) mknod pty$name$c c 6 $(($offset + $i)) i=$(($i + 1)) done ;; esac umask 77 ;; sa*) umask $tape_umask unit=`expr $i : '..\(.*\)'` chr=14 case $unit in [0-9]|[1-9][0-9]|[1-9][0-9][0-9]|[1-9][0-9][0-9][0-9]) mknod sa${unit}.ctl c $chr `saminor 1 ${unit} 0 0` ln -f sa${unit}.ctl rsa${unit}.ctl for m in 0 1 2 3 do mknod sa${unit}.${m} c $chr \ `saminor 0 ${unit} ${m} 0` root:operator ln -f sa${unit}.${m} rsa${unit}.${m} mknod nsa${unit}.${m} c $chr \ `saminor 0 ${unit} ${m} 1` root:operator ln -f nsa${unit}.${m} nrsa${unit}.${m} mknod esa${unit}.${m} c $chr \ `saminor 0 ${unit} ${m} 2` root:operator ln -f esa${unit}.${m} ersa${unit}.${m} done ln -f sa${unit}.0 sa${unit} ln -f sa${unit}.0 rsa${unit}.0 ln -f sa${unit}.0 rsa${unit} ln -f nsa${unit}.0 nsa${unit} ln -f nsa${unit}.0 nrsa${unit}.0 ln -f nsa${unit}.0 nrsa${unit} ln -f esa${unit}.0 esa${unit} ln -f esa${unit}.0 ersa${unit}.0 ln -f esa${unit}.0 ersa${unit} ;; *) echo bad unit for tape in: $i ;; esac umask 77 ;; ch*) umask 37 unit=`expr $i : '..\(.*\)'` case $i in ch*) name=ch; chr=17;; esac case $unit in 0|1|2|3|4|5|6) mknod ${name}${unit} c $chr $unit root:operator ;; *) echo bad unit for media changer in: $i ;; esac umask 77 ;; ata) mknod ata c 159 0 root:operator ;; ast*) umask 2 ; unit=`expr $i : '...\(.*\)'` chr=119 case $unit in 0|1|2|3) mknod ast${unit} c $chr $(($unit * 8 + 0)) root:operator chmod 640 ast${unit} mknod nast${unit} c $chr $(($unit * 8 + 1)) root:operator chmod 640 nast${unit} ;; *) echo bad unit for tape in: $i ;; esac umask 77 ;; acd*t*) umask $disk_umask units=`expr $i : '...\(.*\)t'`; tracks=`expr $i : '.*t\(.*\)'`; name=acd; chr=117; if [ -z "${units}" ]; then units=0 fi if [ -z "${tracks}" ]; then tracks=100 fi if [ "${units}" -le 31 -a "${tracks}" -le 169 ]; then i=0 while [ $i -le $units ]; do dname=$name$i rm -rf ${dname}t* j=1 while [ $j -le ${tracks} ]; do mknod ${dname}t$j c $chr \ $((($i * 8) + (65536 * $j))) \ root:operator j=$(($j + 1)) done i=$(($i + 1)) done else echo "$i is invalid -- can't have more than 32 cd devices or 169 tracks" fi umask 77 ;; acd*|cd*|mcd*|scd*) umask $disk_umask case $i in acd*) units=`expr $i : '...\(.*\)'`; name=acd; chr=117;; cd*) units=`expr $i : '..\(.*\)'`; name=cd; chr=15;; mcd*) units=`expr $i : '...\(.*\)'`; name=mcd; chr=29;; scd*) units=`expr $i : '...\(.*\)'`; name=scd; chr=45;; esac if [ -z "${units}" ]; then units=0 fi if [ "${units}" -le 31 ]; then i=0 while [ $i -le $units ]; do dname=$name$i rm -rf ${dname}* r${dname}* mknod ${dname}a c $chr $(($i * 8)) root:operator case $name in acd) ln -f ${dname}a ${dname}c;; *) mknod ${dname}c c $chr $(($i * 8 + 2)) root:operator;; esac ln -f ${dname}a r${dname}a ln -f ${dname}c r${dname}c i=$(($i + 1)) done else echo "$i is invalid -- can't have more than 32 cd devices" fi umask 77 ;; wcd*) umask 2 ; unit=`expr $i : '...\(.*\)'` chr=69 case $unit in 0|1|2|3|4|5|6|7) mknod wcd${unit}a c $chr $(($unit * 8 + 0)) root:operator mknod wcd${unit}c c $chr $(($unit * 8 + 2)) root:operator ln -f wcd${unit}a rwcd${unit}a ln -f wcd${unit}c rwcd${unit}c chmod 640 wcd${unit}[a-h] rwcd${unit}[a-h] ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; wst*) umask 2 ; unit=`expr $i : '...\(.*\)'` chr=90 case $unit in 0|1|2|3) mknod rwst${unit} c $chr $(($unit * 8 + 0)) root:operator chmod 640 rwst${unit} ;; esac umask 77 ;; iic*) unit=`expr $i : 'iic\(.*\)'` mknod iic$unit c 105 `unit2minor $unit` ;; smb*) unit=`expr $i : 'smb\(.*\)'` mknod smb$unit c 106 `unit2minor $unit` ;; pcfclock*) unit=`expr $i : 'pcfclock\(.*\)'` mknod pcfclock$unit c 140 `unit2minor $unit` ;; ppi*) unit=`expr $i : 'ppi\(.*\)'` mknod ppi$unit c 82 `unit2minor $unit` ;; pps*) unit=`expr $i : 'pps\(.*\)'` mknod pps$unit c 89 `unit2minor $unit` ;; usb) mknod usb c 108 255 root:operator chmod 0660 usb ;; usb*) umask 7 unit=`expr $i : 'usb\(.*\)'` mknod usb$unit c 108 `unit2minor $unit` root:operator umask 77 ;; ucom*) umask 7 unit=`expr $i : 'ucom\(.*\)'` minor=$(($unit + 128)) minor=`unit2minor $(($unit + 128))` mknod ucom$unit c 138 $minor uucp:dialer umask 77 ;; ufm*) umask 7 unit=`expr $i : 'ufm\(.*\)'` mknod ufm$unit c 200 `unit2minor $unit` root:operator umask 77 ;; uhid*) umask 7 unit=`expr $i : 'uhid\(.*\)'` mknod uhid$unit c 122 `unit2minor $unit` root:operator umask 77 ;; ums*) umask 7 unit=`expr $i : 'ums\(.*\)'` mknod ums$unit c 111 `unit2minor $unit` root:operator umask 77 ;; ulpt*) unit=`expr $i : 'ulpt\(.*\)'` minor=`unit2minor $unit` mknod ulpt$unit c 113 $minor minor=`unit2minor $(($unit + 64))` mknod unlpt$unit c 113 $minor # and the 'no prime' version ;; ugen*) umask 7 unit=`expr $i : 'ugen\([0-9][0-9]*\)'` endpoint=`expr $i : 'ugen.*\.\([0-9][0-9]*\)'` if [ -z "${unit}" ]; then echo $i - Invalid unit number fi if [ -z "${endpoint}" ]; then # ugen0 & ugen0.1 - ugen0.15 mknod ugen$unit c 114 \ `unit2minor $(($unit * 16))` root:operator i=1 while [ $i -lt 16 ]; do mknod ugen$unit.$i c 114 \ `unit2minor $(($unit * 16 + $i))` root:operator i=$(($i + 1)) done else minor=`unit2minor $(($unit * 16 + $endpoint))` mknod ugen$unit.$endpoint c 114 $minor root:operator fi umask 77 ;; urio*) umask 7 unit=`expr $i : 'urio\(.*\)'` mknod urio$unit c 143 `unit2minor $unit` root:operator umask 77 ;; uscanner*) umask 7 unit=`expr $i : 'uscanner\(.*\)'` mknod uscanner$unit c 156 `unit2minor $unit` root:operator umask 77 ;; lpt*) unit=`expr $i : 'lpt\(.*\)'` mknod lpt$unit c 16 `unit2minor $unit` mknod lpctl$unit c 16 `unit2minor $(($unit + 128))` ;; # Use this to create virtual consoles for syscons, pcvt or codrv # ttyv0-b # use as MAKEDEV vtyNN to create NN entries vty*) chr=12 units=`expr $i : 'vty\(.*\)'` i=0 while [ $i -lt $units ]; do mknod ttyv$(printf %01x $i) c $chr `unit2minor $i` i=$(($i + 1)) done ln -fs ttyv0 vga # XXX X still needs this pccons relic ;; nmdm*) units=`expr $i : 'nmdm\(.*\)'` chr=18 i=0 while [ $i -lt $units ]; do minor=`unit2minor $i` minor=$(($minor + $minor)) mknod nmdm${i}A c $chr $minor mknod nmdm${i}B c $chr $(($minor + 1)) i=$(($i + 1)) done ;; bpf*) nbpf=`expr $i : 'bpf\(.*\)$'` unit=0 while [ $unit -le $nbpf ]; do mknod bpf$unit c 23 `unit2minor $unit` unit=$(($unit + 1)) done ;; speaker) mknod speaker c 26 0 ;; cuax|cuay|cuaz) sh MAKEDEV ${i}0 ${i}1 ${i}2 ${i}3 ${i}4 ${i}5 ${i}6 ${i}7 sh MAKEDEV ${i}8 ${i}9 ${i}a ${i}b ${i}c ${i}d ${i}e ${i}f ;; cua?|cuaa?|cuaa??) umask 7 unit_low=`expr $i : 'cua.*\(.\)$'` case $i in cua?|cuaa?) unit_high="" m_high=0 ;; cuaa??) unit_high=`expr $i : 'cuaa\(.\).$'` m_high=`ttyminor $unit_high` ;; esac unit=$unit_high$unit_low m=$(($m_high << 16 | `ttyminor $unit_low`)) mknod cuaa$unit c 28 $(($m | 128)) uucp:dialer mknod cuaia$unit c 28 $(($m | 32 | 128)) uucp:dialer mknod cuala$unit c 28 $(($m | 64 | 128)) uucp:dialer umask 77 ;; crypto) mknod crypto c 70 0 root:operator chmod 666 crypto ;; fw?) unit=`expr $i : 'fw\(.\)$'` for sub in 0 1 2 3 do minor=$(($unit << 16 | $sub)) mknod fw$unit.$sub c 127 $minor root:operator chmod 660 fw$unit.$sub mknod fwmem$unit.$sub c 127 $((1<<24 | $minor)) root:operator chmod 660 fwmem$unit.$sub done ln -sf fw$unit.0 fw$unit ln -sf fwmem$unit.0 fwmem$unit ;; dcons) mknod dcons c 184 0 root:wheel chmod 600 dcons ;; ttyx|ttyy|ttyz) sh MAKEDEV ${i}0 ${i}1 ${i}2 ${i}3 ${i}4 ${i}5 ${i}6 ${i}7 sh MAKEDEV ${i}8 ${i}9 ${i}a ${i}b ${i}c ${i}d ${i}e ${i}f ;; tty?|tty0?|ttyd?|ttyd??) unit_low=`expr $i : 'tty.*\(.\)$'` case $i in tty?|tty0?|ttyd?) unit_high="" m_high=0 ;; ttyd??) unit_high=`expr $i : 'ttyd\(.\).$'` m_high=`ttyminor $unit_high` ;; esac unit=$unit_high$unit_low m=$(($m_high << 16 | `ttyminor $unit_low`)) mknod ttyd$unit c 28 $m mknod ttyid$unit c 28 $(($m | 32)) mknod ttyld$unit c 28 $(($m | 64)) ;; cuac?) umask 7 portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q r s t u v" major=48 card=`expr $i : 'cua.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=$(($card * 65536 + $minor)) name=$card$unit mknod cuac$name c $major $(($minor + 128)) uucp:dialer mknod cuaic$name c $major $(($minor + 32 + 128)) uucp:dialer mknod cualc$name c $major $(($minor + 64 + 128)) uucp:dialer done umask 77 ;; ttyc?) portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q r s t u v" major=48 card=`expr $i : 'tty.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=$(($card * 65536 + $minor)) name=$card$unit mknod ttyc$name c $major $minor mknod ttyic$name c $major $(($minor + 32)) mknod ttylc$name c $major $(($minor + 64)) done ;; # RISCom8 'rc' driver entries cuam?) umask 7 unit=`expr $i : 'cua.*\(.\)$'` m=`ttyminor $unit` mknod cuam$unit c 63 $(($m + 128)) uucp:dialer umask 77 ;; ttym?) unit=`expr $i : 'tty.*\(.\)$'` m=`ttyminor $unit` mknod ttym$unit c 63 $m ;; # Specialix SI/XIO. # Note: these are 'base 1' to match the numbers on the panels, and to match # the manual that comes with the system. ttyA*) major=68 nports=`expr $i : 'ttyA\(.*\)$'` port=1 while [ $port -le $nports ]; do minor=$(($port - 1)) name=$(printf %02d $port) mknod ttyA$name c $major $minor mknod ttyiA$name c $major $(($minor + 65536)) mknod ttylA$name c $major $(($minor + 131072)) port=$(($port + 1)) done # For the user-mode control program, 'sicontrol' mknod si_control c 68 262144 ;; cuaA*) umask 7 major=68 nports=`expr $i : 'cuaA\(.*\)$'` port=1 while [ $port -le $nports ]; do minor=$(($port - 1)) name=$(printf %02d $port) mknod cuaA$name c $major $(($minor + 128)) uucp:dialer mknod cuaiA$name c $major $(($minor + 128 + 65536)) \ uucp:dialer mknod cualA$name c $major $(($minor + 128 + 131072)) \ uucp:dialer port=$(($port + 1)) done umask 77 ;; # Alpha AS8[24]00 (TurboLaser) console. zs?) unit=`expr $i : 'zs.*\(.\)$'` m=`ttyminor $unit` mknod zs$unit c 135 $m ;; # Digiboard PC/?? 16 port card. # The current scheme of minor numbering is: # # unused{14} CARD{2} major{8} CALLOUT{1} LOCK{1} INIT{1} PORT{5} # # CARD bitfield in future versions may be extended to 3 bits. # # See dgb(4) # ttyD?) portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" major=58 card=`expr $i : 'tty.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=$(($card * 65536 + $minor)) name=$card$unit mknod ttyD$name c $major $minor mknod ttyiD$name c $major $(($minor + 32)) mknod ttylD$name c $major $(($minor + 64)) done ;; cuaD?) umask 7 portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" major=58 card=`expr $i : 'cua.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=$(($card * 65536 + $minor)) name=$card$unit mknod cuaD$name c $major $(($minor + 128)) uucp:dialer mknod cuaiD$name c $major $(($minor + 32 + 128)) uucp:dialer mknod cualD$name c $major $(($minor + 64 + 128)) uucp:dialer done umask 77 ;; # Stallion multi serial cards (stl and stli drivers) # # These drivers reserve 64 minor devices per board, even if the board # supports only 4 devices. We default to creating only 8 of the 64 devices # to keep /dev from getting too large (which => slow). The last part of the # arg is the board number to create ports for. So: # ttyE0 will create 8 dialin ports ttyE0-ttyE7, plus ttyiE* and ttylE* # cuaE0 will create 8 dialout ports cuaE0-cuaE7, plus cuaiE* and cualE* # ttyE1 will create 8 dialin ports ttyE64-ttyE71, plus ttyiE* and ttylE* # etc # If you have EasyConnect 8/32 or 8/64 cards, you will need to change the # definition of "maxport" below to get nodes for the full 32 or 64 # ports per card. # # Note that the mapping of minor device numbers (with the hole between # 32-64k) is a bit odd to keep compatibility with ttyd? for # lock/initial devices. # Minor device field for the ports is # card{3} unused{4} unit-msb{1} unused{8} callout{1} lock{1} init{1} unit-lsbs{5} # for the mem device is # 0x1000000 + card # (For stl, there is only 1 mem device per system; for stli, one per board) ttyE*) stallion 72 E `expr $i : 'tty.*\(.\)$'` 0 ;; cuaE*) stallion 72 E `expr $i : 'cua.*\(.\)$'` 1 ;; stl*) card=`expr $i : 'stl\(.\)$'` stallion 72 E $card 0 stallion 72 E $card 1 ;; ttyF*) stallion 75 F `expr $i : 'tty.*\(.\)$'` 0 ;; cuaF*) stallion 75 F `expr $i : 'cua.*\(.\)$'` 1 ;; stli*) card=`expr $i : 'stl\(.\)$'` stallion 75 F $card 0 stallion 75 F $card 1 ;; ttyM*) portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" modulelist="a b c d" major=101 card=`expr $i : 'tty.*\(.\)$'` for unit in $modulelist do moduleminor=`ttyminor $unit` moduleminor=$(($moduleminor % 10 * 16)) modulename=$unit for unit in $portlist do minor=`ttyminor $unit` minor=$(($card * 65536 + $minor + $moduleminor)) name=$card$modulename$unit rm -f tty*M$name mknod ttyM$name c $major $minor mknod ttyiM$name c $major $(($minor + 64)) mknod ttylM$name c $major $(($minor + 128)) done done ;; cuaM?) umask 7 portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" modulelist="a b c d" major=101 card=`expr $i : 'cua.*\(.\)$'` for unit in $modulelist do moduleminor=`ttyminor $unit` moduleminor=$(($moduleminor % 10 * 16)) modulename=$unit for unit in $portlist do minor=`ttyminor $unit` minor=$(($card * 65536 + $minor + $moduleminor)) name=$card$modulename$unit rm -f cua*M$name mknod cuaM$name c $major $(($minor + 262144)) \ uucp:dialer mknod cuaiM$name c $major $(($minor + 64 + 262144)) \ uucp:dialer mknod cualM$name c $major $(($minor + 128 + 262144)) \ uucp:dialer done done umask 77 ;; ttyR?) major=81 BOARD=1; Rnum=0 MINOR=$(($BOARD * 65536)) controllers=$( dmesg | while read first rest; do case "$first" in RocketPort[0-4]) echo "$first" ;; esac done ) rm -f ttyR* ttyiR* ttylR* for i in $controllers; do ndevices=$( dmesg | while read first bar ports rest; do case "$first" in $i*) echo "$ports" ;; esac done ) echo -n "Creating $ndevices devices for $i: " dev=0 while [ $dev -lt $ndevices ]; do mknod ttyR$Rnum c $major $MINOR mknod ttyiR$Rnum c $major $(($MINOR + 32)) mknod ttylR$Rnum c $major $(($MINOR + 64)) Rnum=$(($Rnum + 1)) MINOR=$(($MINOR + 1)) dev=$(($dev + 1)) done BOARD=$(($BOARD + 1)) MINOR=$(($BOARD * 65536)) echo " " done ;; cuaR?) major=81 BOARD=1; Rnum=0 MINOR=$(($BOARD * 65536)) controllers=$( dmesg | while read first rest; do case "$first" in RocketPort[0-4]) echo "$first" ;; esac done ) rm -f cuaR* cuaiR* cualR* for i in $controllers; do ndevices=$( dmesg | while read first bar ports rest; do case "$first" in $i*) echo "$ports" ;; esac done ) echo -n "Creating $ndevices devices for $i: " dev=0 while [ $dev -lt $ndevices ]; do mknod cuaR$Rnum c $major $(($MINOR + 128)) uucp:dialer mknod cuaiR$Rnum c $major $(($MINOR + 128 + 32)) \ uucp:dialer mknod cualR$Rnum c $major $(($MINOR + 128 + 64)) \ uucp:dialer Rnum=$(($Rnum + 1)) MINOR=$(($MINOR + 1)) dev=$(($dev + 1)) done BOARD=$(($BOARD + 1)) MINOR=$(($BOARD * 65536)) echo " " done ;; mse*) unit=`expr $i : 'mse\(.*\)'` chr=27 # non-blocking for X11 mknod mse$unit c $chr `unit2minor $(($unit * 2 + 1))` ;; psm*) unit=`expr $i : 'psm\(.*\)'` chr=21 # non-blocking for X11 mknod psm$unit c $chr `unit2minor $(($unit * 2 + 1))` ;; mouse*) name=`expr $i : 'mouse\(.*\)'` if [ ! -c $name ]; then $0 $name # make the appropriate device fi ln -fs $name mouse ;; pcaudio) mknod pcaudio c 24 0 mknod pcaudioctl c 24 128 ;; socksys) mknod socksys c 41 0 mknod spx c 41 1 ln -fs socksys nfsd chmod 666 socksys nfsd spx ;; snd*) # # changes from Linux voxware # minor Linux FreeBSD # 8 sequencer2 (aka music0) music0 # 17 patmgr0 sequencer1 # 33 patmgr1 sequencer2 # unit=`expr $i : 'snd\(.*\)'` chr=30 # XXX write this less verbosely, like std snd_security_hole=0 # XXX umask $snd_security_hole ln -fs mixer$unit mixer ln -fs sequencer$unit sequencer ln -fs dsp$unit dsp ln -fs audio$unit audio ln -fs dspW$unit dspW ln -fs music$unit music ln -fs pss$unit pss ln -fs dsp$unit.0 dsp$unit ln -fs audio$unit.0 audio$unit ln -fs dspW$unit.0 dspW$unit mknod mixer$unit c $chr `unit2minor $(($unit * 16 + 0))` mknod sequencer$unit c $chr `unit2minor $(($unit * 16 + 1))` mknod midi$unit c $chr `unit2minor $(($unit * 16 + 2))` for chn in 0 1 2 3 do minor=$(($chn * 65536 + $unit * 16)) mknod dsp$unit.$chn c $chr $(($minor + 3)) mknod audio$unit.$chn c $chr $(($minor + 4)) mknod dspW$unit.$chn c $chr $(($minor + 5)) done mknod sndstat c $chr 6 # minor number 7 is unused mknod music$unit c $chr `unit2minor $(($unit * 16 + 8))` mknod pss$unit c $chr `unit2minor $(($unit * 16 + 9))` # minor numbers 10-15 are unused umask 77 ;; vat) mknod vatio c 25 128 chmod 660 vatio ;; gsc*) unit=`expr $i : 'gsc\(.*\)'` mknod gsc${unit} c 47 `unit2minor $unit` mknod gsc${unit}p c 47 `unit2minor $(($unit + 8))` mknod gsc${unit}d c 47 `unit2minor $(($unit + 32))` mknod gsc${unit}pd c 47 `unit2minor $(($unit + 40))` chmod 666 gsc${unit}* ;; apm) mknod apm c 39 0 root:operator chmod 664 apm ;; apmctl) mknod apmctl c 39 8 root:operator chmod 660 apmctl ;; card*) unit=`expr $i : 'card\(.*\)'` chr=50 mknod card$unit c $chr `unit2minor $unit` chmod 644 card$unit ;; ct*) unit=`expr $i : 'c.\(.*\)'` if [ ! $unit ]; then unit=0 while [ $unit -lt 6 ] do mknod ${i}${unit} c 99 $unit chmod 644 ${i}${unit} unit=$(($unit + 1)) done else mknod ${i} c 99 $unit chmod 644 ${i} fi ;; cx*) unit=`expr $i : 'c.\(.*\)'` if [ ! $unit ]; then unit=0 while [ $unit -lt 48 ] do mknod ${i}${unit} c 42 $(($unit + 64)) chmod 644 ${i}${unit} unit=$(($unit + 1)) done else mknod ${i} c 42 $(($unit + 64)) chmod 644 ${i} fi ;; cuax?|cuay?|cuaz?) case $i in *0) unit=0;; *1) unit=1;; *2) unit=2;; *3) unit=3;; *4) unit=4;; *5) unit=5;; *6) unit=6;; *7) unit=7;; *8) unit=8;; *9) unit=9;; *a) unit=10;; *b) unit=11;; *c) unit=12;; *d) unit=13;; *e) unit=14;; *f) unit=15;; esac case $i in cuax?) unit=$(($unit + 128));; cuay?) unit=$(($unit + 144));; cuaz?) unit=$(($unit + 160));; esac mknod $i c 42 $unit ;; ttyx?|ttyy?|ttyz?) case $i in *0) unit=0;; *1) unit=1;; *2) unit=2;; *3) unit=3;; *4) unit=4;; *5) unit=5;; *6) unit=6;; *7) unit=7;; *8) unit=8;; *9) unit=9;; *a) unit=10;; *b) unit=11;; *c) unit=12;; *d) unit=13;; *e) unit=14;; *f) unit=15;; esac case $i in ttyy?) unit=$(($unit + 16));; ttyz?) unit=$(($unit + 32));; esac mknod $i c 42 $unit ;; joy) mknod joy0 c 51 0 root:operator mknod joy1 c 51 1 root:operator chmod 640 joy0 joy1 ;; spigot) mknod spigot c 11 0 chmod 444 spigot ;; ctx?) unit=`expr $i : 'ctx\(.*\)'` mknod ctx$unit c 40 `unit2minor $unit` chmod 444 ctx$unit ;; meteor?) unit=`expr $i : 'meteor\(.*\)'` mknod meteor$unit c 67 `unit2minor $unit` chmod 444 meteor$unit ;; bktr?) unit=`expr $i : 'bktr\(.*\)'` mknod bktr$unit c 92 `unit2minor $unit` mknod tuner$unit c 92 `unit2minor $((16 + $unit))` mknod vbi$unit c 92 `unit2minor $((32 + $unit))` chmod 444 bktr$unit tuner$unit vbi$unit ;; tun*) ntun=`expr $i : 'tun\(.*\)$'` unit=0 while [ $unit -le $ntun ]; do mknod tun$unit c 52 `unit2minor $unit` unit=$(($unit + 1)) done ;; tap*) ntap=`expr $i : 'tap\(.*\)$'` unit=0 while [ $unit -le $ntap ]; do mknod tap$unit c 149 `unit2minor $unit` root:network unit=$(($unit + 1)) done ;; sysmouse) mknod sysmouse c 12 128 mknod consolectl c 12 255 ;; jogdial) mknod jogdial c 160 0 ;; snp?) unit=`expr $i : 'snp\(.*\)'` mknod snp$unit c 53 `unit2minor $unit` ;; # dufault@hda.com: If I do much more work on other A-D boards # then eventually we'll have a "ad" and "dio" interface and some of these # "labpcaio" ones will be gone. # labpcaio: D-A and A-D. # labpcdio: Digital in and Digital out. # labpc*) umask 7 case $i in labpcaio*) name=labpcaio unit=`expr $i : 'labpcaio\(.*\)'` all="0 1 2 3 4 5 6 7" offset=0 ;; labpcdio*) name=labpcdio unit=`expr $i : 'labpcdio\(.*\)'` all="0 1 2 3" offset=8 ;; *) die 3 "Don't know LabPC type $i" ;; esac if [ -z "${unit}" ]; then unit=all fi case $unit in 0|1|2|3|4|5|6|7) mknod $name$unit c 66 $(($offset + $unit)) ;; all) for i in $all do mknod $name$i c 66 $(($offset + $i)) done ;; *) echo "No such LabPC unit: $unit" ;; esac umask 77 ;; perfmon) mknod perfmon c 2 32 root:kmem chmod 640 perfmon ;; ipl) mknod ipl c 79 0 mknod ipnat c 79 1 mknod ipstate c 79 2 mknod ipauth c 79 3 ;; elan*) mknod elan-mmcr c 100 0 # XXX local major chmod 600 elan-mmcr ;; kbd*) unit=`expr $i : 'kbd\(.*\)'` chr=112 mknod kbd$unit c $chr `unit2minor $unit` ;; i4b) mknod i4b c 60 0 ;; i4bctl) mknod i4bctl c 55 0 ;; i4brbch*) unit=`expr $i : 'i4brbch\(.*\)'` mknod i4brbch$unit c 57 `unit2minor $unit` ;; i4bteld*) offset=64 unit=`expr $i : 'i4bteld\(.*\)'` mknod i4bteld$unit c 56 `unit2minor $(($offset + $unit))` ;; i4btel*) unit=`expr $i : 'i4btel\(.*\)'` mknod i4btel$unit c 56 `unit2minor $unit` ;; i4btrc*) unit=`expr $i : 'i4btrc\(.*\)'` mknod i4btrc$unit c 59 `unit2minor $unit` ;; aac*) unit=`expr $i : 'aac\(.*\)'` mknod aac$unit c 150 `unit2minor $unit` ln -fs aac$unit afa$unit ln -fs aac$unit hpn$unit ;; mlx*) unit=`expr $i : 'mlx\(.*\)'` mknod mlx$unit c 130 `unit2minor $unit` ;; amr*) unit=`expr $i : 'amr\(.*\)'` mknod amr$unit c 132 `unit2minor $unit` ;; ciss*) unit=`expr $i : 'ciss\(.*\)'` mknod ciss$unit c 166 `unit2minor $u . ..MAKEDEVconsolekmemp4 memnullp4 random urandom zerop4 io ttyklogp4stdin4stdoutstderr pci fd fd0rfd0r+fd0ar+rfd0a+fd0br+rfd0b+fd0cr+rfd0c+fd0dr+rfd0d+fd0er+rfd0e+fd0fr+rfd0f+fd0gr+rfd0g+fd0hr+rfd0h+fd0.1720 rfd0.1720+ fd0.1480  rfd0.1480+!fd0.1440! rfd0.1440+"fd0.1200" rfd0.1200+#fd0.820#rfd0.820t+$fd0.800$rfd0.800t+%fd0.720%rfd0.720t+&fd0.360&rfd0.360t+'fd0.640'rfd0.640t+(fd0.1232( rfd0.1232+) da0)rda0r+*da0ap4*rda0a++da0bp4+rda0b+,da0cp4,rda0c+-da0dp4-rda0d+.da0ep4.rda0e+/da0fp4/rda0f+0da0gp40rda0g+1da0hp41rda0h+2da0s142rda0s13da0s1a3rda0s1a4da0s1b4rda0s1b5da0s1c5rda0s1c6da0s1d6rda0s1d7da0s1e7rda0s1e8da0s1f8rda0s1f9da0s1g9rda0s1g:da0s1h:rda0s1h;da0s24;rda0s2<da0s34<rda0s3=da0s44=rda0s4> ad0>rad0r+?ad0ap4?rad0a+@ad0bp4@rad0b+Aad0cp4Arad0c+Bad0dp4Brad0d+Cad0ep4Crad0e+Dad0fp4Drad0f+Ead0gp4Erad0g+Fad0hp4Frad0h+Gad0s14Grad0s1Had0s1aHrad0s1aIad0s1bIrad0s1bJad0s1cJrad0s1cKad0s1dKrad0s1dLad0s1eLrad0s1eMad0s1fMrad0s1fNad0s1gNrad0s1gOad0s1hOrad0s1hPad0s24Prad0s2Qad0s34Qrad0s3Rad0s44Rrad0s4Sacd0a4Sacd0c+Sracd0aSracd0cTafd0p4Trafd0+Uafd0a4Urafd0aVafd0b4Vrafd0bWafd0c4Wrafd0cXafd0d4Xrafd0dYafd0e4Yrafd0eZafd0f4Zrafd0f[afd0g4[rafd0g\afd0h4\rafd0h]afd0s1]rafd0s1^afd0s1a^rafd0s1at+_afd0s1b_rafd0s1bt+`afd0s1c`rafd0s1ct+aafd0s1darafd0s1dt+bafd0s1ebrafd0s1et+cafd0s1fcrafd0s1ft+dafd0s1gdrafd0s1gt+eafd0s1herafd0s1ht+fafd0s2frafd0s2gafd0s3grafd0s3hafd0s4hrafd0s4iast0p4jnast04k wd0krwd0r+lwd0ap4lrwd0a+mwd0bp4mrwd0b+nwd0cp4nrwd0c+owd0dp4orwd0d+pwd0ep4prwd0e+qwd0fp4qrwd0f+rwd0gp4rrwd0g+swd0hp4srwd0h+twd0s14trwd0s1uwd0s1aurwd0s1avwd0s1bvrwd0s1bwwd0s1cwrwd0s1cxwd0s1dxrwd0s1dywd0s1eyrwd0s1ezwd0s1fzrwd0s1f{wd0s1g{rwd0s1g|wd0s1h|rwd0s1h}wd0s24}rwd0s2~wd0s34~rwd0s3wd0s44rwd0s4wcd0a4wcd0c4rwcd0arwcd0cwfd0p4rwfd0+wfd0a4rwfd0awfd0b4rwfd0bwfd0c4rwfd0cwfd0d4rwfd0dwfd0e4rwfd0ewfd0f4rwfd0fwfd0g4rwfd0gwfd0h4rwfd0h#!/bin/sh -p # # Simple replacement for tar(1), using cpio(1). # # Copyright (c) 1996 Joerg Wunsch # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # # THIS SOFTWARE IS PROVIDED BY THE DEVELOPERS ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE DEVELOPERS BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # $FreeBSD: src/release/scripts/tar.sh,v 1.5.2.2 2002/08/08 08:23:53 ru Exp $ # # # For use on the fixit floppy. External programs required: # cpio(1), find(1), test(1) # archive=${TAPE:-/dev/rsa0} blocksize="20" device="" mode="none" verbose="" usage() { echo "usage: tar -{c|t|x} [-v] [-b blocksize] [-f archive] [files...]" 1>&2 exit 64 # EX_USAGE } # # Prepend a hyphen to the first arg if necessary, so the traditional form # ``tar xvf /dev/foobar'' will work, too. More kludgy legacy forms are not # supported however. # if [ $# -lt 1 ] ; then usage fi case "$1" in -*) break ;; *) tmp="$1" shift set -- -$tmp "$@" ;; esac while getopts "ctxvb:f:" option do case $option in [ctx]) if [ $mode = "none" ] ; then mode=$option else usage fi ;; v) verbose="-v" ;; b) blocksize="${OPTARG}" ;; f) archive="${OPTARG## }" ;; *) usage ;; esac done shift $(($OPTIND - 1)) if [ "X${archive}" != "X-" ] ; then device="-F ${archive}" # else: use stdin or stdout, which is the default for cpio fi case $mode in none) usage ;; t) exec cpio -it $verbose $device --block-size="$blocksize" "$@" ;; x) exec cpio -idmu $verbose $device --block-size="$blocksize" "$@" ;; c) if [ $# -eq 0 ] ; then # use current dir -- slightly bogus set -- "." fi find "$@" -print |\ cpio -o -H ustar $verbose $device --block-size="$blocksize" exit $? ;; esac # $FreeBSD: src/etc/group,v 1.19.2.3 2002/06/30 17:57:17 des Exp $ # wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: news:*:8: man:*:9: games:*:13: staff:*:20:root sshd:*:22: smmsp:*:25: mailnull:*:26: guest:*:31:root bind:*:53: uucp:*:66: xten:*:67:xten dialer:*:68: network:*:69: www:*:80: nogroup:*:65533: nobody:*:65534: * ...# # Internet protocols # # $FreeBSD: src/etc/protocols,v 1.13.2.3 2002/02/27 03:39:00 dd Exp $ # from: @(#)protocols 5.1 (Berkeley) 4/17/89 # # See also http://www.iana.org/assignments/protocol-numbers # ip 0 IP # internet protocol, pseudo protocol number #hopopt 0 HOPOPT # hop-by-hop options for ipv6 icmp 1 ICMP # internet control message protocol igmp 2 IGMP # internet group management protocol ggp 3 GGP # gateway-gateway protocol ipencap 4 IP-ENCAP # IP encapsulated in IP (officially ``IP'') st2 5 ST2 # ST2 datagram mode (RFC 1819) tcp 6 TCP # transmission control protocol cbt 7 CBT # CBT, Tony Ballardie egp 8 EGP # exterior gateway protocol igp 9 IGP # any private interior gateway (Cisco: for IGRP) bbn-rcc 10 BBN-RCC-MON # BBN RCC Monitoring nvp 11 NVP-II # Network Voice Protocol pup 12 PUP # PARC universal packet protocol argus 13 ARGUS # ARGUS emcon 14 EMCON # EMCON xnet 15 XNET # Cross Net Debugger chaos 16 CHAOS # Chaos udp 17 UDP # user datagram protocol mux 18 MUX # Multiplexing protocol dcn 19 DCN-MEAS # DCN Measurement Subsystems hmp 20 HMP # host monitoring protocol prm 21 PRM # packet radio measurement protocol xns-idp 22 XNS-IDP # Xerox NS IDP trunk-1 23 TRUNK-1 # Trunk-1 trunk-2 24 TRUNK-2 # Trunk-2 leaf-1 25 LEAF-1 # Leaf-1 leaf-2 26 LEAF-2 # Leaf-2 rdp 27 RDP # "reliable datagram" protocol irtp 28 IRTP # Internet Reliable Transaction Protocol iso-tp4 29 ISO-TP4 # ISO Transport Protocol Class 4 netblt 30 NETBLT # Bulk Data Transfer Protocol mfe-nsp 31 MFE-NSP # MFE Network Services Protocol merit-inp 32 MERIT-INP # MERIT Internodal Protocol sep 33 SEP # Sequential Exchange Protocol 3pc 34 3PC # Third Party Connect Protocol idpr 35 IDPR # Inter-Domain Policy Routing Protocol xtp 36 XTP # Xpress Tranfer Protocol ddp 37 DDP # Datagram Delivery Protocol idpr-cmtp 38 IDPR-CMTP # IDPR Control Message Transport Proto tp++ 39 TP++ # TP++ Transport Protocol il 40 IL # IL Transport Protocol ipv6 41 IPV6 # ipv6 sdrp 42 SDRP # Source Demand Routing Protocol ipv6-route 43 IPV6-ROUTE # routing header for ipv6 ipv6-frag 44 IPV6-FRAG # fragment header for ipv6 idrp 45 IDRP # Inter-Domain Routing Protocol rsvp 46 RSVP # Resource ReSerVation Protocol gre 47 GRE # Generic Routing Encapsulation mhrp 48 MHRP # Mobile Host Routing Protocol bna 49 BNA # BNA esp 50 ESP # encapsulating security payload ah 51 AH # authentication header i-nlsp 52 I-NLSP # Integrated Net Layer Security TUBA swipe 53 SWIPE # IP with Encryption narp 54 NARP # NBMA Address Resolution Protocol mobile 55 MOBILE # IP Mobility tlsp 56 TLSP # Transport Layer Security Protocol skip 57 SKIP # SKIP ipv6-icmp 58 IPV6-ICMP # ICMP for IPv6 ipv6-nonxt 59 IPV6-NONXT # no next header for ipv6 ipv6-opts 60 IPV6-OPTS # destination options for ipv6 # 61 # any host internal protocol cftp 62 CFTP # CFTP # 63 # any local network sat-expak 64 SAT-EXPAK # SATNET and Backroom EXPAK kryptolan 65 KRYPTOLAN # Kryptolan rvd 66 RVD # MIT Remote Virtual Disk Protocol ippc 67 IPPC # Internet Pluribus Packet Core # 68 # any distributed file system sat-mon 69 SAT-MON # SATNET Monitoring visa 70 VISA # VISA Protocol ipcv 71 IPCV # Internet Packet Core Utility cpnx 72 CPNX # Computer Protocol Network Executive cphb 73 CPHB # Computer Protocol Heart Beat wsn 74 WSN # Wang Span Network pvp 75 PVP # Packet Video Protocol br-sat-mon 76 BR-SAT-MON # Backroom SATNET Monitoring sun-nd 77 SUN-ND # SUN ND PROTOCOL-Temporary wb-mon 78 WB-MON # WIDEBAND Monitoring wb-expak 79 WB-EXPAK # WIDEBAND EXPAK iso-ip 80 ISO-IP # ISO Internet Protocol vmtp 81 VMTP # Versatile Message Transport secure-vmtp 82 SECURE-VMTP # SECURE-VMTP vines 83 VINES # VINES ttp 84 TTP # TTP nsfnet-igp 85 NSFNET-IGP # NSFNET-IGP dgp 86 DGP # Dissimilar Gateway Protocol tcf 87 TCF # TCF eigrp 88 EIGRP # Enhanced Interior Routing Protocol (Cisco) ospf 89 OSPFIGP # Open Shortest Path First IGP sprite-rpc 90 Sprite-RPC # Sprite RPC Protocol larp 91 LARP # Locus Address Resolution Protocol mtp 92 MTP # Multicast Transport Protocol ax.25 93 AX.25 # AX.25 Frames ipip 94 IPIP # Yet Another IP encapsulation micp 95 MICP # Mobile Internetworking Control Pro. scc-sp 96 SCC-SP # Semaphore Communications Sec. Pro. etherip 97 ETHERIP # Ethernet-within-IP Encapsulation encap 98 ENCAP # Yet Another IP encapsulation # 99 # any private encryption scheme gmtp 100 GMTP # GMTP ifmp 101 IFMP # Ipsilon Flow Management Protocol pnni 102 PNNI # PNNI over IP pim 103 PIM # Protocol Independent Multicast aris 104 ARIS # ARIS scps 105 SCPS # SCPS qnx 106 QNX # QNX a/n 107 A/N # Active Networks ipcomp 108 IPComp # IP Payload Compression Protocol snp 109 SNP # Sitara Networks Protocol compaq-peer 110 Compaq-Peer # Compaq Peer Protocol ipx-in-ip 111 IPX-in-IP # IPX in IP vrrp 112 VRRP # Virtual Router Redundancy Protocol pgm 113 PGM # PGM Reliable Transport Protocol # 114 # any 0-hop protocol l2tp 115 L2TP # Layer Two Tunneling Protocol ddx 116 DDX # D-II Data Exchange iatp 117 IATP # Interactive Agent Transfer Protocol st 118 ST # Schedule Transfer srp 119 SRP # SpectraLink Radio Protocol uti 120 UTI # UTI smp 121 SMP # Simple Message Protocol sm 122 SM # SM ptp 123 PTP # Performance Transparency Protocol isis 124 ISIS # ISIS over IPv4 fire 125 FIRE crtp 126 CRTP # Combat Radio Transport Protocol crudp 127 CRUDP # Combat Radio User Datagram sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS # Secure Packet Shield pipe 131 PIPE # Private IP Encapsulation within IP sctp 132 SCTP # Stream Control Transmission Protocol fc 133 FC # Fibre Channel # 134-254 # Unassigned divert 254 DIVERT # Divert pseudo-protocol [non IANA] # 255 # Reserved + ..., ...- .... ...# # Network services, Internet style # # Stripped-down version. # # $FreeBSD: src/release/fixit.services,v 1.4 1999/08/28 01:33:10 peter Exp $ # # WELL KNOWN PORT NUMBERS # echo 7/tcp echo 7/udp discard 9/tcp sink null discard 9/udp sink null systat 11/tcp users #Active Users systat 11/udp users #Active Users daytime 13/tcp daytime 13/udp chargen 19/tcp ttytst source #Character Generator chargen 19/udp ttytst source #Character Generator ftp-data 20/tcp #File Transfer [Default Data] ftp-data 20/udp #File Transfer [Default Data] ftp 21/tcp #File Transfer [Control] ftp 21/udp #File Transfer [Control] ssh 22/tcp #Secure Shell Login ssh 22/udp #Secure Shell Login telnet 23/tcp telnet 23/udp # 24/tcp any private mail system # 24/udp any private mail system smtp 25/tcp mail #Simple Mail Transfer smtp 25/udp mail #Simple Mail Transfer time 37/tcp timserver time 37/udp timserver domain 53/tcp #Domain Name Server domain 53/udp #Domain Name Server bootps 67/tcp dhcps #Bootstrap Protocol Server bootps 67/udp dhcps #Bootstrap Protocol Server bootpc 68/tcp dhcpc #Bootstrap Protocol Client bootpc 68/udp dhcpc #Bootstrap Protocol Client tftp 69/tcp #Trivial File Transfer tftp 69/udp #Trivial File Transfer gopher 70/tcp gopher 70/udp finger 79/tcp finger 79/udp http 80/tcp www www-http #World Wide Web HTTP http 80/udp www www-http #World Wide Web HTTP sunrpc 111/tcp rpcbind #SUN Remote Procedure Call sunrpc 111/udp rpcbind #SUN Remote Procedure Call auth 113/tcp ident tap #Authentication Service auth 113/udp ident tap #Authentication Service nntp 119/tcp usenet #Network News Transfer Protocol nntp 119/udp usenet #Network News Transfer Protocol rmt 411/tcp #Remote MT Protocol rmt 411/udp #Remote MT Protocol https 443/tcp https 443/udp # # Berkeley-specific services # exec 512/tcp #remote process execution; # authentication performed using # passwords and UNIX loppgin names biff 512/udp comsat #used by mail system to notify users # of new mail received; currently # receives messages only from # processes on the same machine login 513/tcp #remote login a la telnet; # automatic authentication performed # based on priviledged port numbers # and distributed data bases which # identify "authentication domains" who 513/udp whod #maintains data bases showing who's # logged in to machines on a local # net and the load average of the # machine cmd 514/tcp shell #like exec, but automatic # authentication is performed as for # login server syslog 514/udp printer 515/tcp spooler printer 515/udp spooler talk 517/tcp #like tenex link, but across # machine - unfortunately, doesn't # use link protocol (this is actually # just a rendezvous port from which a # tcp connection is established) talk 517/udp #like tenex link, but across # machine - unfortunately, doesn't # use link protocol (this is actually # just a rendezvous port from which a # tcp connection is established) ntalk 518/tcp ntalk 518/udp utime 519/tcp unixtime utime 519/udp unixtime efs 520/tcp #extended file name server router 520/udp route routed #local routing process (on site); # uses variant of Xerox NS routing # information protocol uucp 540/tcp uucpd uucp 540/udp uucpd uucp-rlogin 541/tcp uucp-rlogin 541/udp klogin 543/tcp # Kerberos (v4/v5) klogin 543/udp # Kerberos (v4/v5) kshell 544/tcp krcmd # Kerberos (v4/v5) kshell 544/udp krcmd # Kerberos (v4/v5) / ...0 . ..1share1 .0 ..2misc2 .1 ..3 scsi_modes*t1 {Maximum Write Speed Supported (kBps)} i2 {Current Write Speed Supported (kBps)} i2 }; 0x00 "Vendor-Specific"; : # $FreeBSD: src/release/fixit.profile,v 1.8.2.1 2001/11/05 11:22:04 brian Exp $ export BLOCKSIZE=K export PS1="Fixit# " export EDITOR="/mnt2/stand/vi" export PAGER="/mnt2/stand/more" export SCSI_MODES="/mnt2/usr/share/misc/scsi_modes" # the root MFS doesn't have /dev/nrsa0, pick a better default for mt(1) export TAPE=/mnt2/dev/nrsa0 alias ls="ls -F" alias ll="ls -l" alias m="more -e" echo '+---------------------------------------------------------------+' echo '| You are now running from FreeBSD "fixit" media. |' echo '| ------------------------------------------------------------- |' echo "| When you're finished with this shell, please type exit. |" echo '| The fixit media is mounted as /mnt2. |' echo '| |' echo '| You might want to symlink /mnt/etc/*pwd.db and /mnt/etc/group |' echo '| to /etc after mounting a root filesystem from your disk. |' echo '| tar(1) will not restore all permissions correctly otherwise! |' echo '| |' echo '| Note: you might use the arrow keys to browse through the |' echo '| command history of this shell. |' echo '+---------------------------------------------------------------+' echo echo 'Good Luck!' echo # Make the arrow keys work; everybody will love this. set -o emacs 2>/dev/null cd / # SCSI mode page data base. # Copyright (c) 1995 HD Associates # Copyright (c) 2001 The FreeBSD Project # (contact: dufault@hda.com) # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. The name of HD Associates # may not be used to endorse or promote products derived from this software # without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY HD ASSOCIATES ``AS IS'' AND # ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE # IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE # ARE DISCLAIMED. IN NO EVENT SHALL HD ASSOCIATES BE LIABLE # FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL # DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS # OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) # HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT # LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY # OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF # SUCH DAMAGE. # # $FreeBSD: src/share/misc/scsi_modes,v 1.6.6.4 2002/03/14 16:18:48 joerg Exp $ # # The ordering is alphabetical by page name, as it appears in the SCSI spec. # 'i' is a byte-sized integral types, followed by a field width of # 1 through 4 (1 to 4 bytes). # # 'b' is a bit-sized integral type # 't' is a bitfield type- followed by a bit field width # # 'c' values are character arrays # 'z' values are null-padded strings # # # '*' suppresses assignment (for 'seeking'). # Bitfields are MSB to LSB. # ALL DEVICE TYPES 0x0a "Control Mode Page" { {Reserved} *t7 {RLEC} t1 {Queue Algorithm Modifier} t4 {Reserved} *t2 {QErr} t1 {DQue} t1 {EECA} t1 {Reserved} *t4 {RAENP} t1 {UAAENP} t1 {EAENP} t1 {Reserved} *i1 {Ready AEN Holdoff Period} i2 } 0x02 "Disconnect-Reconnect Page" { {Buffer Full Ratio} i1 {Buffer Empty Ratio} i1 {Bus Inactivity Limit} i2 {Disconnect Time Limit} i2 {Connect Time Limit} i2 {Maximum Burst Size} i2 {Reserved} *t6 {DTDC} t2 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 } 0x09 "Peripheral Device Page" { {Interface Identifier} i2 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 } 0x1a "Power Control" { {Reserved} *i1 {Reserved} *t6 {Idle} t1 {Standby} t1 {Idle Condition Timer} i4 {Standby Condition Timer} i4 } # DIRECT ACCESS DEVICES 0x08 "Caching Page" { {IC} t1 {ABPF} t1 {CAP} t1 {DISC} t1 {SIZE} t1 {WCE} t1 {MF} t1 {RCD} t1 {Demand Retention Priority} t4 {Write Retention Priority} t4 {Disable Pre-fetch Transfer Length} i2 {Minimum Pre-fetch} i2 {Maximum Pre-fetch} i2 {Maximum Pre-fetch Ceiling} i2 } 0x05 "Flexible Disk Page" { {Transfer rate} i2 {Number of heads} i1 {Sectors per track} i1 {Data bytes per sector} i2 {Number of cylinders} i2 {Starting cylinder-write precompensation} i2 {Starting cylinder-reduced write current} i2 {Drive step rate} i2 {Drive step pulse width} i1 {Head settle delay} i2 {Motor on delay} i1 {Motor off delay} i1 {TRDY} t1 {SSN} t1 {MO} t1 {Reserved} *t5 {Reserved} *t4 {SPC} t4 {Write Compensation} i1 {Head load delay} i1 {Head unload delay} i1 {Pin 34} t4 {Pin 2} t4 {Pin 4} t4 {Pin 1} t4 {Medium rotation rate} i2 {Reserved} *i1 {Reserved} *i1 } 0x03 "Format Device Page" { {Tracks per Zone} i2 {Alternate Sectors per Zone} i2 {Alternate Tracks per Zone} i2 {Alternate Tracks per Logical Unit} i2 {Sectors per Track} i2 {Data Bytes per Physical Sector} i2 {Interleave} i2 {Track Skew Factor} i2 {Cylinder Skew Factor} i2 {SSEC} t1 {HSEC} t1 {RMB} t1 {SURF} t1 {Reserved} *t4 } 0x0b "Medium Types Supported Page" { {Reserved} *i1 {Reserved} *i1 {Medium type one supported} i1 {Medium type two supported} i1 {Medium type three supported} i1 {Medium type four supported} i1 } # Notch page (0x0c) 0x0c "Notch and Partition Page"; 0x01 "Read-Write Error Recovery Page" { {AWRE (Auto Write Reallocation Enbld)} t1 {ARRE (Auto Read Reallocation Enbld)} t1 {TB (Transfer Block)} t1 {RC (Read Continuous)} t1 {EER (Enable Early Recovery)} t1 {PER (Post Error)} t1 {DTE (Disable Transfer on Error)} t1 {DCR (Disable Correction)} t1 {Read Retry Count} i1 {Correction Span} i1 {Head Offset Count} i1 {Data Strobe Offset Count} i1 {Reserved} *i1 {Write Retry Count} i1 {Reserved} *i1 {Recovery Time Limit} i2 } 0x04 "Rigid Disk Drive Geometry Page" { {Number of Cylinders} i3 {Number of Heads} i1 {Starting Cylinder-Write Precompensation} i3 {Starting Cylinder-Reduced Write Current} i3 {Drive Step Rate} i2 {Landing Zone Cylinder} i3 {Reserved} *t6 {RPL} t2 {Rotational Offset} i1 {Reserved} *i1 {Medium Rotation Rate} i2 {Reserved} *i1 {Reserved} *i1 } 0x07 "Verify Error Recovery Page" { {Reserved} *t4 {EER} t1 {PER} t1 {DTE} t1 {DCR} t1 {Verify Retry Count} i1 {Verify Correction Span} i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Verify Recovery Time Limit} i2 } 0x0E "CD-ROM Audio Control Parameters Page" { {Reserved} *t5 {Immed} t1 {SOTC} t1 {Reserved} *t1 {Reserved} *i2 {APRVal} t1 {Reserved} *t3 {Format of LBAs / sec.} t4 {Logical Blocks per Second of Audio Playback} i2 {Reserved} *t4 {Output Port 0 Channel Selection} t4 {Output Port 0 Volume} i1 {Reserved} *t4 {Output Port 1 Channel Selection} t4 {Output Port 1 Volume} i1 {Reserved} *t4 {Output Port 2 Channel Selection} t4 {Output Port 2 Volume} i1 {Reserved} *t4 {Output Port 3 Channel Selection} t4 {Output Port 3 Volume} i1 } # SEQUENTIAL ACCESS DEVICES 0x10 "Device Configuration Page" { {Reserved} *t1 {Change Active Partition} t1 {Change Active Format} t1 {Active Format} t5 {Active Partition} i1 {Write Buffer Full Ratio} i1 {Write Buffer Empty Ratio} i1 {Write Delay Time} i2 {Data Buffer Recovery} t1 {Block Identifiers Support} t1 {Report Setmarks} t1 {Automatic Velocity Control} t1 {Stop on Consecutive Filemarks} t2 {Recover Buffer Order} t1 {Report Early-Warning} t1 {Gap Size} i1 {EOD Defined} t3 {Enable EOD Generation} t1 {Synchronize at Early-Warning} t1 {Reserved} *t3 {Buffer Size at Early-Warning} i3 {Select Data Compression Algorithm} i1 {Reserved} *t5 {SCSI-3 Associated Write Protect} t1 {SCSI-3 Persistent Write Protect} t1 {SCSI-3 Permanent Write Protect} t1 } 0x0f "Data Compression Page" { {Data Compression Enabled} t1 {Date Compression Capable} t1 {Reserved} *t6 {Data Decompression Capable} t1 {Data Decompression Report on Exception} t2 {Reserved} *t5 {Compression Algorithm} i4 {Decompression Algorithm} i4 {Reserved} *i4 } # CD-ROM (and CD-R[W]) devices 0x2a "CD capabilities and mechanical status page" { {Reserved} *t4 {Method 2} t1 {CD-RW Read} t1 {CD-R Read} t1 {Reserved} *t4 {Test Write} t1 {CD-RW Write} t1 {CD-R Write} t1 {Reserved} *t1 {Multi Session} t1 {Mode 2 Form 2} t1 {Mode 2 Form 1} t1 {Digital Port (2)} t1 {Digital Port (1)} t1 {Composite} t1 {Audio Play} t1 {Read Bar Code} t1 {UPC} t1 {ISRC} t1 {C2 Pointers are supported} t1 {R-W De-interleaved & corrected} t1 {R-W Supported} t1 {CD-DA Stream is Accurate} t1 {CD-DA Commands Supported} t1 {Loading Mechanism Type} t3 {Reserved} *t1 {Eject} t1 {Prevent Jumper} t1 {Lock State} t1 {Lock} t1 {Reserved} *t4 {S/W Slot Selection} t1 {Changer Supports Disc Present reporting} t1 {Separate Channel Mute Supported} t1 {Separate volume levels per channel} t1 {Maximum Read Speed Supported (kBps)} i2 {Number of Volume Leves Supported} i2 {Buffer Size supported by Drive (KB)} i2 {Current Read Speed Selected (kBps)} i2 {Reserved} *i1 {Reserved} *t2 {Length} t2 {LSBF} t1 {RCK} t1 {BCK} t1 {Reserved}  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x ELF 4r4 (     F F0FreeBSD}8U WVSҍu^|=*~)}t#E F8t8/u H F@8ut R2 h" \$t$|$D$e e[^_ÐU=(Fu@v$F$F@С$F8ut hk~(FÍvUUthh3~ÐUU WVS} ?t8uj/7B pu7,F;t(3V u;tuWuCVh h-5r e[^_ÐUVS]j/S"B ޅtp,F=,Ft$3V u  v;u1e[^ÍvUVSu] uSNVe[^U WVSh h`5+r 1,F=,FtT;׍7Oh5q 3h5q ;uh5q j vUuu uÍvUVSu] hEjc v$40v,v4h8\ Fj5ĩ /v h`5p j vhFSV )ijÃ=0u-=,u$=4u=8u= u =t jjS95 thj; 5$f U WVSEEvt޿u(1Wv(jSK ƃ}: 8-ujSƃ}Sh< $_} t>u5pChV ƃVS V V t V? tEUEe[^_UWVS};=u G tg EE &  un=8tE}u1 IxvQV" E=4tL=0uCEEP=4t,E]Sh5 n @ @E uO=,$ IyA;A|ڈQj$i E u{= ^ IyA;A|ڈQj^ I IyA;A| ڈQjI=OƀvV  4%u|M IyA;A|ڈQjMe A- IyA;A| ڈQj-) vV  4%tv^ IyA;A|ڈQj^ ?t @Ë Iy A;A| t ڈ(QS. IyA;A|< tQVJ t*OyW  v0G @t$5(h8 $g @ @thj6 e[^_UlWVSx=lGEPW t5(hj6 E=sP lGuKhj`6 1t6SlGPW }hj/6 v)ƅũ55lGEP Ã}5(h7 $e[^_U|WVSjjEEPi jjj ƃ Euhjh]S ' ߰ЃPEPV3 }V |SE tt&DjV5 u1h "jV u hԗ x[^_ÍvUuu uÍvU,WVS]u EEEE3vA9$dEsE1fE1ZEPvEDvE8vijT:-uDB9uW EuWh5jx4 jSVa ǃu jjL3 1C4H $Lv}jSWZ s2 PshK5  8s PshKd5  v}C<@PEP΃ ȉʁC<@%9tNPsU҃t}ushR4 }tshU Wʵ Ãp 8thYj2 EPD V vUh5e j] Uuu uÍvU\WVS]EEQgt# ?t@Gt#9uu3/@v/< /D8u@7hE PS] uij)ËU U =<<=w%1t"jEP5<肮 EE8t85<R t @Ev5<hǿj1 v1ur;tl=w%v1tjEPS E8t)S t @Shǿj1 GhڿhD Ãt$ktuhj0 v=@@=w%1t"jEP5@: EE8t85@ t @Ev5@hj;0 vE 0 th uU 2hj. t$EPW/ uhj. =<t#EP# uh(j. =@t#UR uh/jp. E xt'PU rm+ E phj@. h6s Ãu<jhDSS* Shj. vUh`5b jy Uuu uÍvUWVS1Q.$<Dž<1Dž8Dž81Dž<Dž8Dž<iI)hE PUR ij)EU U }=tF=thjT- <u 8uthj/- v=t<t8tMEU hShG =vSh$j, GHGGGuƀG.G GG=GGv Gx/tۡGGEU EPhG Ãu& 8thGh6j+ vtE%f=@}~Fj| u=u=t)8u <t@PE 0 @PU 2 H%f=@u=u =t  v1VPE PP UWVSu]Eh fEfUE%P hSV Eujj) EUB4t tA_vt uREpŦ PUrh, E Eph+ Er} Ufz2uZ} tJj/r, ƒt E+PBUEuUruE EP$UUEPp$+uG:/t {/t/C-G=~"RhGh 3+ EvVRS G GG=GGv Gx/tۋUfz4z S=t&jrUrh( jEPURq EE vt@UB<@ %PhG }GhGh6j% vE%f=@t" hGh6j% v1=utUB z=t4PEp<(GSUR6=t4PEp 9}9thGhgU# EEp0W Ur{hGhg# EN`v)ÃSVEP 9}9uhh`UR ǃ}Ephg" E=tUREPtEUR EP thGhg?" EEe[^_ÐUS]hPs ushfvƄ(} t&hG thGh2vhGP u1Ph! ÍvUS]} t$hG{ thGh'CPhG thGh! =u1vjS]US]} t$hG thGh*sCPhG thGh v=u1vjS]UlWVS]u EfcC`KMb)ȣdC hK$׉)ȣlh`hG thGh EtEPV' uEPhG; t1eC ;EuC;Etbtss V uFss hG t, 8thGh* Efct Cf;EtQtCPV u6CPhG thGh EtCD;EtKtsDVW u2sDhGP thGhk EEe[^_ÐUh hh5P j@ Uuu u ÍvU VSuP5覙 u6h@j j=5+ Ãu5hoj C;u5hj EhTjj h,EPz ƒ uuhoj v#B tuhjl B SBЃt8 t%tth tLuhj =uhj t`tK!t2t 0 h jY X1RPRP 9S )‰P=t @  PDP轴 HUVSt 5KtNs5;vP9r;x u vJ9r-: t9r$)CSV5D= DHD DHH;Pr j Ƌ)‰У;f=tP)‰P56= e[^ÍvUS=tx5h JJ;r3: t;r&)CSP5D< DHHD D]ÍvUS] hFj S6 jhоjw hjh h v3KK=Ku=KuZj輸 U VS=uG5jj5 u5hMj hw=K u!=Kvuh`j =Xu\XhHuP5X \uPhHuP5X \ Tu5XhMj h@u<PHP uhj @\;sP軫 t PP蛫 @uhj0 @D t ` dt %h=`ukT tbP1%`EUd‰U`EEURP5\ u5Xhj| !tF1ۡvR~ 4Cvv1ۉvR 4CvUt'1ۋ4 Cv&v1ۋ4 CvjEPկ EE e[^ÉUtS]EPsC ushMj E%f=uK E%f= t f=`EPhzf@sְ ushMj EtK+E t%EtEEPhmds艰 KE%f= uKEuEK?v jjjs uu 8uKK]ÍvUVS5jjVS5 jjVS t19w9t5t5j v5j5趬 555 ugvu5hMj 5hM tt9j1RP5袳 щƒ t5hMn  v;u(tt(Hj8t+tHPPP e[^ÐU=Xu u(v=u=uKtc=HtcH;PsMtP)‰Pj HP)‰Pj5Dt PH=Hu K Kt jÐU WVS=@}t HE PUvu1 tB19s?u-@9s<8t1҅t}u5KKK K}tKKjKKRP5\ uu5Xhj/ v}tjW5\药 KKbVW5\^ Ã;u5Xhj  8t5XhMj 1߉ؙ;]u U;Pm9tZTt5Xh jD Tt)=u 5Xh@ )/vH+EH;PrPẼ=HtHPD)‰P5@x1 H@De[^_UWSjEP EݝxEx܅x%ݕxEuݝx؃RPRPRPRPhjd]Sg 0߰HPSjC  Bt]=u zuPRPhjd]S ߰HPSj׬  Bt]=u zuPRPh-jd]S ߰HPSjk -۽`jjRP }-ۭ`۽`ۭ`]Eܵx$|xRPh@jd]S 0߰HPSjƫ H[_US  [ÍvUS]%P& UWVSA j1%EU‰UEEURP5_ =4 8&5hjc v=}hhjK v=5EW55藪 ~$t)=u4=K u=KvKK\hj t+}u=5h6 E5hj_ v 2e[^_ÉU VST  jP1%`EUd‰U`EEURP5\訪  & 85Xhj =d}h(hj vTtGfEU`BRhm5\b 5Xhj= `xS=`F5P5@5\膨 u5Xhj fEE@Phm5\贤 u5Xhj v`؉9Q9`5P5@5\Ƨ u5Xhj1 ;Pt5Xh3j v`؉9Qu,9`w"`9pu 9`e[^ÍvUuu uÍvUWVSDž'Dž|$v5$(Lh9vhGvtpKvtpKvhT.|thj Ph胼 tIx=|thj /PX|K h+U REP~ ij)EU U jPx ƃjP0 1ۃ 9}%PWC9|DžxE 8|RVPrƃjP/ 1ۃ 9x}#PWC9|19}?=(LuD2uPPFC9|ƒxP诤 vtEPE 0? }-u2/2=w%v1u1Bt'H9rtU vEEe[^_UUHw rL ÉU WVS}?tf?u_+ j jw É 8thj w݈ _we[^_ÍvUVSuHvAj蟇 Ãuhj? vFVRPhS ^e[^ÐUE8%ÐUWS8u 1v߰uPh tIW߰u3{=u-<u$SWe[_ÉUVS];uC C%,1C8tSщ‰ t C Cue[^ÐUS] hj  8uPHQRhphGJ 5>]ÐUhjo vUVS]u S uV% Se[^ÉUVS]u SuVt&SV jjvV؍e[^ÉU WVSu} VuWt9VW wv# 1RP>VSWJ F;GuF;G1QRÃVW؍e[^_ÉU WVS}u WuVt9WLVC vwW 1RPBWV~ G;F uG;Fv QRÃWV؍e[^_ÉU WVSu} VuWt=V|Ws wv 1RP|à KVW G;F uG;Fv QR/ÃVIW@؍e[^_ÉU WVSu} V$uWtMVW wv Љ҉1RPà MvVW G;FuG;Fw QRKÃVeW\؍e[^_ÉU WVS}u W@uV0t9WV vw 1RPBWV G;FuG;Fw QR{ÃWV؍e[^_ÉU WVSu} VpuW`t9VW wv 1RP@V/W& F;GuF;Gt QRÃVW؍e[^_UWVSEU M]u}uvuv uv }}| v1[^_ÐU WVSu} Vhщƒ tWRщƒ uhj6 FVGWRPÃCSRPGWRPFVRP(0thj VW؍e[^_U WVSM] EUuu|1u}WV؃RPSQe[^_ÐU WVSu} V\щƒ tWFщƒ uhj* FV+GWRPÃCSRPGWRPFVRP(0thj VW؍e[^_UVSUM ]u tQREURPG 9u9t1e[^ÍvUWVS]u S`щƒ tVJщƒ uhj. KfEUCF‰UFCEEURPǃGWRPFVRPCSRP0thj SVe[^_USEU M]uuuu v1[ÍvU WVS}] WTщƒ tS>щƒ uhj" C Cuh j CSRPGWRP褓 RPƋCSRPGWRP+ thj WSe[^_U WVS}u Wщƒ tVnщƒ uhjR F Fuh j9 FVRPGWRP RPÃW V؍e[^_ÐU<WVS}WhE P\ jE puV t&hSVPO Shj vjEPjwEP u>E Eu6}|WEEGP6E؋U+EURP!}ujj hÃWE P EP ؍[^_ÐUVSu v'ہ'~'5)tPRh{ Py tmp=tP5%{ vPpy t(DX1ve[^U WVS=u 1fuZ=}t} uy];ui;r G4]4f0=? 4ut0x( ;u4=uh=Etcx[Sf<]uG;r > 4]4f0H;d=<]6)Ce$4O@<0p0p0pB0p0p0pj0p60pv0pb0pN0p:0p&0p0p"?)‰У0)<]udu`f=}} =v}0t$x 9u 4 4};r Zu*f0phs1e[^_ÉUuu uÍvUWVS] }EM3M}~}=w%1uaj EP3Q~ E8tE8t3hj v}~EEHv 3{E4 h7 j[~ v5zj@~ 3 uKM}h  ָAtRXE8-x-vRc  4%t30E}qb=w%1t Pl@Phg lB  e}u"lfy4u9=u0A =lx@.u=u@ vlB&;EvE=Du = t$lA&Pȃ@P;EvEXl@9t,fx2u#=uu u63Ѝe[^ÍvUWVS}19s!vȉډF9rȉ[^_ÍvUVSutHv{ t8vv S JxRj O [ue[^UE=Du = t P '=0uPh` vPo ÐU,WVSUfx2t8=Xu =$t&UBH4154Phc E8#UU w<=TtvEp hnt =$t6 4AF8V<SQRPRo RPUrht5 EPFPq _sUr3r,F Pr$EPh{ 0=PtsUrh F%f= tf=`u@F0=vPFPh mvF0PFPh PExt/F0V4RPEP(Rh)PhN F0V4RPUr(F=,t v=t v( vv G@P=HtFPF%f=u W Jx vRj L e[^_ÍvU WVSE1{ {@ЍD,L{t 9s,9r( JxRj =L 1Epp Sƃ{th [et$ Ix  Qj K e[^_ÐU,WVSE=<tEUB ;L~ Jx Rj -I EM9Me[^_ÍvU WVSEx<1=Ttwu hn ƃ=$t5 4AG8W<SQRPi RPuhtm ƃE@P ƃ=HtGPƉe[^_ÉUdS=L}j9 8d%L=uj. =@t=LtPIE;~$9E}=Lt=LtEPA PSjP]Sx 5S ]ÐUE=8t>%=@v IyA;A|/=vQj/;wtZ@t&v IyA;A| /Qj/ IyA;A| |Qj| IyA;A| @nQj@r IyA;A| =JQj=N IyA;A| %&Qj%*It4 IyA;A| * Qj*E 1USUfz2u B@Ph`hPN 'B@PBphhP% hPSSV u#u 0- PSh5 h SUS]=(tUE PaƒE EuhSh :vPE URPCPh& E URPShtq ]U@ H0Jy B;B| t RQ@ ؃H0Jy B;B| t vRQ? \JyB;B|Rj\? %H0Jy B;B| t RQZ? H0Jy B;B| t RQ"? ؃H0Jy B;B| t vRQ> G)e[^_ÍvUh5 jUS Uuu uÍvUWVSu] EEFpt# ?t4mt -vt%/EEv\hSV`i uijÃ;u}u HvEPX ƃuEPhj hV VH E;}tW3xW3aL }Jm 8t m 8u3yH Ph 3h 1!=\t3h u Et2}t,W3mO u3h膩 E;EPLQ U|WVS}E fEfEE;/uCE1v;u ;/{u}t&jL fE%?PL E tEPL EPWXJ tE`l 8uftEPWJ |H=\t\Wh~ IE%f=@t:t l  k Wh; Evu/C}uu EPK Ex[^_ÍvUh5[ j@O Uuu uÍvU|WVSu it ft0zntGvtblphlQlhp1hplt hVEPe Uij)E4}K EPEtdH uE%f=@t#}~ v6TP~N E|H=v6hj辥 EtSP ߰HÃt{/t /CDžMvװЍTJ;tz/tvJ;tz/uװЍH=~6h茦 Dž1APRS P6- t DžMP􋅘P1M U|WVSu} =ljWI EPVF f1ۃ=ht#=tYWh% Fv=pt#h9WhD5- jWuI tzEPWF ufEPEPZ h9Wju Pju PV} uUPEPhX5 0HyPg Ӄ t7t2HyPg  tu΃yt!Ythv5 10WVE u=tt݃WVh[ ̐f 8EPVD E%f=twSV\ u SVh du-`h螢 E G@`:;e 8uE PG tE Ph"f VjhE P5 E|S5dEPH 9r5`5dVH Ã}ZEPh" E PF tE PhƠ VnH EPbH VOH _ww EP2C t:ww E Phg  tPE Ph@2 fgGPEPB tPE Ph} c wDEPD t'c 8-uDtwDE Ph̟ GEG EEEEPE PA tE Ph臟 EP,G tE Ph""vEPtE tEPh< !=ttE PEPh 1e[^_Ub …uSju EPh=ttPhhǘ hh"貞 j? jEPR uhhvEthhEtPhL …uAjEPhhIhhM hMh" jt> jEPR uhMh:EthMh#vEu1EPhMh 蛝 Uh`hh5 j@RE Uuu uÍvU WVS] j/3(F u@ƸIuN hPSEP}[ uij)E}tc Sv5D 1&wp$\aK3%x hQS}WZ eij)Ǎ=t1b S A |;t0jz) tS) vSS5C e[^_U WVS1=|t=u=u=tu=t jPu ƃjjp C4H $vs} PshjE =t {>sC Psh蝛  v=u3s q{ %=us C4t tt?s; =xsha s: =\ 8u{=xsh v=tjss? t=t(\ 8u9=xt0sh sh蠘 V~ Ã]$\ 8thj贖 e[^_UlWVS}EEEPS9 tH=t fEkv=t[ 8Sh p=t+jJ PSh覘  ?E%f=@u&=uSh8o =u'E%f=tEPSS1=|u EtEuE$PS; ƃu`E%f=u S^8 >E%f=@uS 9 %v=tEPSvS< ƃt.=t WZ 8tSh蘖 =xtuSht $e[^_U|WVSDž} u]SEP7 !] U B%f=>jjEP PR7 =} Dž􋕜R82 uhKj̓ PhR6 E X0p4gv;u;w RPR< 9)օuw􋅘P jjjR= щƒ PjR6 E X0p4gv;u;w RPR; 9)օuw􋅘P jjjR< щƒ PhRF5 E X0p4`;u;w RPR; 9uO)օuw􋅘P u(􋕘R: u􋅔P0 7t􋕔R~0 EPhʒ x[^_ÍvUWVS}u=tWhR5 v=t8F%f=t)ju C7 u FFuFDt =|u 4EPFPH vD( à ujj[ vWP;t^PP;tPjvb Pjv P^} uPPEPh`5 0S4/ 5 HyP]U Ӄ t7t2HyP)U  tu1ytYue[^_ÐUVS1];tnj/3辒 ƒBu:.uGzt z.u;zu5Fuh蒑 Cu땃됍ve[^ÐUhhh5 j@68 Uuu uÍvU WVSu] 1?tpu vhSVxN uСij9u1;tC31 }3h贏 t3 ƃ;uVp7 UWS]߰ЍDH9v8/t@4H9v8/t@Se1 }Sh, j/S u1e[_ÐUh5o j6 Uuu uÍvUWVS]u vkhVS$M uij)Í4t@EvEvR  4%@tE͐1E8-uG vE8+uEE=w%1t&j EPui5 ~ 1ɉMEE8.u[]gfffvEE=w%1t!EC)‰uu}}~jEP j.5 Uh5諿 j 5 Uuu uÍvU1 j4 vUuu uÍvUWVS}u j/65 ÍCuxo%E.7w`$pEOE1BE16)EvhVWJ xij4)ǃh=t5}t}uthj vt}t=thj:6 ÃtCS"3j.6蘙 Ãth  CS 6( 6jWVL ǃujj7 v1eC4H $Pv=?jSW? +s PshYp  8s PshYH  v}=t S<;B u=S<;B}t<55s+ tZ=uQsXv55su/ t=usRv=tsh` Wc à M 8thdj虇 V'1 vUS];t1Sc uhSUv@]ÍvUS];t)SD uhS@]ÍvUVSuPL j EPV 4L 8tVhj E8tu Vhj谇 ؍e[^ÍvUTS]K 8u =t'=LuQ- LtShjX =ts=Luj=Lua- LtSEPj+ LM LxL;u=L}5hj Sh~ ]ÐUhh@hh5й j+/ vUuu u)ÍvUh5苹 j. U WVS}E E jjP蹔 }Rhj jjh Q/ }PhjƄ h PR5. = tQhj葅 \Tt"hT\Phj] S0E M 9vE 02 ƃU 2h@j Vh_ ׉C!CS{xK`Kd t1 jRPQ\. }Phj{ vRPQ, ;tPhj: {x(VlB1 VljؙRPP- }Rhj݂ QPP7, ;tRhj螂 Q E E 8BR+ j+ Uuu uÍvU,WVSDž1v8$8Cv4//=,Mt~,,Mv@u=,MtR,,M[=,Mt6,,M?=,Mt,,M#=,Mt+,M+hE PURNA ij)EM M =4tC=,Mu4,M(=,Mu ,M}b+U <8/tc=8th@j臁 vjc5<hahg5(M4" (MCװУ(M <C=,M%P5C規 PE 8ug<8/t]Phahn5C! Cװ(M=,M%PR- }5Chsjj =,M,M$pv}t)RfÃQS@ZvDžPhmdP$ hvj~ }t)RÃS5y S!.=4t7}u1h jM q$Ehh [ }t )hE pr uU rhsj"~ h Pu j' Qh h`7É߾ ESh`P Nv}u U ZE}tN(h SM q*Ph h`É߾ E SDžPhmdR# hvj} Q%ÍE}uh jE pmRh h`ÉߍES  uSh`P>R% U WVS]uu#EP uMQhj} ߉E=uD{t>C8/tPhhh? sh?,' ?=uC{t=C8/tPhhh`W sh`& `jsVM } tjE PV] e[^_ÐUVSu]=@t!h|%S5S$WEVǃWEVfǃ1ɉ9s f3 9rf=CShfdV }$? 8t? 8thvjjjV% E=8u)EPhmdV3 }hv{ u V~# ;u)=`?t655`?VU# ;thu{ LEEPhmdV -ShgdV }h 1e[^ÍvUS]> tRtmtSt`Sh{ h@Sh{ h53 /Sh{ jcSh@x{ jz ]ÐUSE=Ch h`P." =5Chsjx v`L>w~=`WEVuWEVt"vL>wX;WEVu큻WEVuL>w<;WEVu4WEVu(1ɉ9s f3 9rft=hjx ShedAP }hjw ؋]ÐUlWVSE x(u@(ǀ MU J(MhQo =4u[=Ch }Wu =5Chsj'w vhEP =t =j/5<! u <8A4=w%1u(MA(M9uȡ(M(M=u$hhh?B ?=u$hhh` `j5輅 ƃ}5hsjv U r(B Ãu5hsju M q(}WSy E p(WV= }5hsju V v<%Bu vt}ǾS j5τ ƃ }5hsju EPV t5hsjt v} MЋ]O(19u9v5hju U B(ы)REPV }5hsjvt V M9s9thjLu A9rEe[^_UWVSu} 5Ch,VA f wG4Lh3GPh=V GPjhGV GPjhSV h`Vק GXthgV GXthsV詧 GXthxV蒧 hV聧 w(hVp w,hV\ w0hVK w8hV7 w4hV& w UB Sƃj jS ƒ M1qA tsSj jS UfBv@M 1q(U9sXBB fBYMQ"vURvMQ vEPh 5ٓ UBB fB@1e[^_ÉU,WVSEEx(u h &Uz,u h My0uh. 5\ Ex4uhA 54 EUfzHuhS W My8u A,A0A8Ex<u ‹B8B4BF uhJjS vEP5 ƃuh]jT jjEPVh> hJjS vhkjjSV9ǃ u j h0MWBuW袊PhqjIT =4MuuPhj$T jEP58MW貐ujEPuW蛐tW3PhjS }b0thjS EP ƃuh]jS ];]r1ۋE)PVEPW‹E)؃9tW證PhjTS t4SE)PuWޏ9tWwPhjS W7EE}t E| t E0 EE0E@P! E؃uh]jR E؉E܀;u C;t}E)Pj Su XE)Pj SW x;u(|$y 8ut}t)]Cj)PSEP蝜 EPh蘳 ;]bjd Uh5 jA Uuu uÍvU WVSu] PσE$ M}MqMe/MY/NMMAM5M)MNУMh2SV H=Nu =Mt M=Mt Nij)ƍ~ojhC3.^ u D"3hHj h D@ D D5Mf }c5DhPjO 11۾dMC<2t2D5M tԅ}hdjN h MuhjN 5Mjj 5M M =MethjNN 5D5D5D5Dh۰ hhh 1ۃMzuz t#PBPr rCPh腰 C~jV 5Dh ] =Mt}MFM DNDؙ=DljD)ʉV V =Nt j =Muj =Ntgu =Mt,5N^u jy =Nt j=MUKv=Mt> { t5DL5`MhF" h` h =MuSgC~5MN=Mu =Mt5M{=Mtb=Mu=Mu =Mtg=Muhm h ` jo=Muh@ tB h  j Uh!h "hV"5l j US]hȭ u,vSh["読 S C~ S]ÉUWVSEMjhPW uh`"K G 1҉EU`MÉEEUE‰UEEEUEUGPPGPhj"۬ "?uy"PPEURPw wh"詬 G$?%PGPWG$%RG$?%PGPWG$%Rh"Q e[^_ÐUlWVS5Mu$#jV Y ǃtEPWr uVh.#jBI EЋUԣMM `MSQRPщ‰ tVh@#jJ =Mt5M5 EЋUԣMMP MuVh#jI 5M5MW# ÃtW tVh.#jmH ډ;Mu M;HtVh#jKI ve[^_U WVS]MFM=D\1߅u^D=DD)؉F V8e[^_UWVSEMEPh#^ EP =Meh# M=Mt;jV^{ }u'jh$ jeEEFPEPhE$j tEFvEPhY$I tEFv EPh_$( tEF Vuh$BI Fh$ /^F$%FEF$?SEPh$ t]EPEPh$ tEEWEPh%m t}^?$ˆVEF^F$%FEF$?SEPh% t]EPEPh(%tEEWEPh4%t}^$?ЈFEF VEPthB%e[^_ÐUh`% 5D5D5D5Fh%蜧 0=D?=D =D~h%k h &[ 5D5D5D5Dh%6 U WVS1ۉM}sVh`& uC~у=Mt }t}h&Ӧ "uh&thWEPh&8t]Cw߃h'Ct1ۉƀMC~Gw ƀMe[^_ÉUh 'tÍvUS8h`']5DSh'|tED5DSh'YtED5DSh'6tEDDDDh'0i]UWVS]{u1{u+{ u%PPBCBCB C K15D։15DC15Dlj15DBC?$ˆSs N15D15DC15D15DBK?$ˆS[^_ÉUhEP5D u$ 85Dh'vE u5Dh(D =Mu=Mu=Mu}t1P5DP Du!| 8uD5Dh#(*jt Dv5Dh@(mC ÉUSEU ]j RP5Dj =`MuB`M5`MS5D ;`Mt5`M`M=~v5`MS5D ]ÉUSEU ]j RP5D 5`MS5Dq ]UhEhedA5D t^4EFD0EDD,EDDDDDDFDDDs5Dh`(A FDDDDDDDDUWV`MMM=Mt5M 5M Mu h(X5Mjjƃu h(2MfUuM1h )@ e^_ÍvU WVS=Dt&jvh`)? {v=MǾM1+v`MMPRPÃtG`MRPMMRPZӉ9u9w1e[^_UWVuh) 5 5jdh@D u j @DװD=@DtUֿ)t9ֿ)t&ֿ)tֿ)u 1e^_ÍvU WVSu1ۉVEPh)> 50 5jdh@D, u j v@DװD=@Dt'@D@DvAt t tu1dAtBЃ w \Bv t uAt( t tth@Dh)d  E e[^_ÉUVSuU1ɺN9uB A9|*[^ÍvU WVSu ]1vR0 v4%@tCύv;;#CvR v4%@uЀ;#vR  4%t VD2C=w%1t6EjEPSt ‹FT0 ;]t ]F9e[^_U WVS}DDD1ۋu UDvW5Dh,@M=Mt5Dh *ExS5Dh*: 1e[^_UWVSuE@EMjSl NKVSF$C <ujSk EEC15Dt_5D;=Dr +D9vEP5Dh-9: DPsEPh.: 5DsC C15DD;Cwh`.9 1+s;s tVs EPh.9 s { uEP5Dh@/9 fvS[EQM~t5Dh -e9 *vF EHEP5Dh`-99 Ee[^_ÉUSE1*M1ҐB~DGMxt5Dh/8 1 H AvQ5Dh`-8 ؋]ÉUdSEPuEuՃ(t>ht8b w(; t 0h8 w(h64 = FtP4u8tw8w4h8 u th8ۅ h8˅ e[^_ÍvU WVS}jEPn X|GWEPo tWELPV u EKy1e[^_ÍvU WVS]u t>uth;tc߰҉‰UR ǃuh8j/# vVSh8EPW vVw ǃt S= e[^_ÍvU WVSEU EP8tI8-u"UCj=P1 t+@Uƿ46tU8CCh7EP! uE e[^_ÐUWVS}uh7谞 vh8E Ph8E P uEEEEJ8߹u E P 8߹u EPSEPEh7EPH ÃuEP˿ EP迿 1EE v߰ЃP萾 ǃuh8j0! 8f8GSW4 WVv WF jSh8. uCPVFSV1ƃh7EPg ÃFEP e[^_U WVSE} t\8tWtS?tNƉu*SW t>,u;tFCFuN,h7EP Ãue[^_ÐUh8h 9h`9h95S jw vU WVSEp0ƃVEnu~ou EEj=VR* t@] ;tdװЍxWRV' uы<t<=uÃ;t*U{ tUE;Cu [ +vC!v=RuVh<j v1h<VƃEP e[^_ÍvUSUM ˀ:tB:/uz/tBA:u)؃~ y/uA[ÉUtS] Sut3EPSZ uE%f=@t1Sh<j@ @0 PSh<j@ v]ÍvUVSu] u#13F*3V9 t;u=F%e[^U WVS]u1;nu{ou F1؀8tv8,uF@8uPl ǃuhi= 11؉ @Fj,P' ue[^_ÐUuu uÍvUWVShK>j/E 00 PuE R# t(Fv11EE1W2wH$d?=/E.E$vE@ hP>E PEPu%=uh`>j 菽 tjj tVjj{ vtph$hh>% Ã~Ojh>S軿 }HPEPS蛿 jh>S舿 Sk }ur轓 Åu߼ P} >t=(Ftj"jhK>9! Sh>j"jh>! Sh>j h>h>h>1}u軻 jj蛻 uh>jD jj0 jjl uh>j je 1vG(Ã}u< je 9uҿv?Pe Gj j u 8t'~˃h ?5H V0蒑 Pjj蕺 >uH?Rh_?j> U>=(FtK>Ph@@57H j蕽 UEjjEPEPh_@ uEhw@S 1ÍvUuu uÍvUVSkAj? }h}A裴 ÃuAE PEPB+t$`CRj P5/+ u8t5/hAj v=uhAj RR/R=RtRPRhBjn RRRj P5/E R8t5/h)Bj =R8h`Bj RRRhAu uƒZij)EE =RuhBjx hljY ujjE hlj3 ujj 5S)H }uEE E BR&$DIj)jD I=u~z=RthB5D VzDj@) =RthB5xD h jhB=,!S"j=RthC58D jCj( =RthC5D h jhB+Vs"&j4 @'=Rt6=Rth@C5C hDjhBh+jV@pV?C:Y+V! %j4&jVv@ (Hj'jB M}hVE 0E  Vsà thSV*M}uvGjE'jkB M}t`hVE 0E  V8sà t'=Rt Vjh8SV*M}ub"U$j2=Rt~%j$8UhDh EhEhEhFh=F5A j7UWVSE 0UNM9-wP衫 ËE t(}@Px EEujj vEU:vMuUPh`FO >ЃP ujj~ -MB6Pѷ '}uE-@EEUMAMEE80}tUM u؋U +HMe[^_ÉU@ WSEEE@EE@EtEEhPhFh`KS t7}tEEEP腁 RRHKEPhPPPz 97$JװHPhFR~ WoÃ=Rt Wfh8SP}&װHPhFR W0oÃS"3uWhF5*> qPPR UװHPhGRn Ph5t@uPhG5= hTpPa%װHPh6GR gyj.=Rt RjvװHPh>GR~ hCGh`GhGhGhGhHh@HhHhHhIh IhBIh`IhIhIhIhIh J5< PvװHPhCJR [PPtװHPhFJR uhJJ5; "PhMJ5; װHPhQJ"װHPhVJR wװHPhZJR ?=Rt"hbJ5 ; RHhtJ5: R*װHPhJRB ji+װHPhJR JװHPhJR uK=Rt"hJ5: RThJ59 R6PhJ59 [_ÉU WVS] u~=RvhK5}9 5 5uhh@Fn =@F t@FЍP>F>F t >F u H8 t8 t@Sh@F_^48u$UREPURȀ EUD#Rh@F5R8u RR=@F/u&EPURh@FEQJUJCh@FEPhKhS UREPSFFPjj@URm }v4hK57 ~tSFFEPFV)‹F4UR EUDN~uFPy [^_ÉUVS]vC; t; tu o;\uC;uhL5V7 L;'t;"t CF=C v CF8t;uCuPh#L5 7 K; t ; t;u؍e[^ÉU WVS]޿/Ltjh1LSE u4LU +;/u/LU f1LU f3LB} ҉ЍD;Erh@L5@6 j^,SU R ] ރ;t#C/u;/tF;uN>/u] ;tsCC;/t;u)u>.uNSV )uƒjhdLV& uNE @9vN>/uSV輬 뉐e[^_U<WVSuVpÃ=RuHu=Ru ;V$DžEPSVV} ʉˉЉU9u13P1EǰHfE xvDžR"ÃuQ[$RP6 uhgL53 hV#uhzLeVhL53 DžhVS{ hhFSI ߰Hډ=RuJu=Ru5;s/LsdLt}C=~hCPRhL52 >CPCPPh R SQ P!ÃRp"u(hL5!2 Q2 hPj PRZ QPitDs.;shL51 R詜 [^_ÉUVSu ]FP-Cƒ:t=Ru <^v?B:uf+SfS=Rt!HurC ^%u(t@tC *C Fw$LFPhL50 :C @6C =.C #&C %6f%u C /vC e[^ÐU,WVS} EEEME9s4;sC9E}E{ tE{ tE ;]r̃}tE}tE=Rt9Eօ~gfffvE)ƅUMTUEQ}EuEE|8}E19mEU9UPM IM܋EE@U=Rt%3MQh M5// C@EfC}t7K Jy B;B| t RQ規 fCsh%M5. }t5K Jy B;B| t RQR fCU܍;ErhL5q. S[;]}; JyB;B| vRj C;]|EE9EF;ue[^_ÍvUVSuVÃtf=Ru;t=RuJust2@J@JCGJC@PCPhHJ+& v1e[^ÍvUVSu u~Ãt1=RuHus=Ru ;u!3!u fF@fF1e[^ÐUUE prJ U=Riu=HKtjh`K A h(M]u j"ÉUVSu =R؍FusD=Rt'M}uMPhM5-, uVhM5, ؍e[^ÐU|WVSu}=RЉUE Hur&=RVhM5+ } u=Riu =R=Ru/E PhM]S ރuU RV;XE P!ÃtS#PV蠷 t$WU RV$Ãu STKEx[^_ÍvUS=R؋E Hus)uV"t`Hxt P %؋]ÐUVS=RthM5l* j Ãtk=Rt^hM5:* FsCPJususSWS|$ u;5uV? ÃVurq=Rt S"PhN5) {uSTS##SQs| KC K [uF;5uSe[^UWVSEEE HuЉUEP ǃt3Mw7ƃuhNZ9tEU RƃtM^[t9uEu_9t[}uWqSW" 8v=Rt W Ph@N5"( WbP1eEt"t F;EuUt G;EtM}E$|ON=RVWPUREP}uWRW" vWOURE PURX Ã}u SQK=RASt}u Fu=Rt SPPhO5" SMS* [uG;=uo5Kts^td{uVf{thPSQ=Rt SPhO54" S@MS [uv ue[^_ÉU WVS=Rth@P5! 1KKt0v{ts C SLS-G uӅuKthaPS&P[ ue[^_U WVS=RRu=RtIhP5>! 1=RthP5 ! 5REPKj*OvV[ÃuVhPRSMPhP5 c VNƃ;5urt!5uVhP5~ q6m5uÃuhP8RCuhQSNCtS?KcSP>1c ;=Rt 5REP-5=Ru;u!e[^_ÉUWVS=Rth-Q5 uj(Z51jME uHPME=REPvMEEPME 9EX9uv4u;us=R~uj)(4뒐u;usKPMƃ;5uv9=Ru4;5uv9=Rt9=Rtkv4MufR5uVhlRhS褈 =Rrt0=RRt'hxRhS͒ hS à hh hS Ãt&hRS% [u)S谏 hShR j}5uVhRhW =Rrt0=RRt'hxRhW hW à hh hWU Ãt&hRSe [u)S hWhR' jDžƅƅSffDž u Suut%f=@5[詬 hS [ u&90b Ph@S5 =[t5[S h[Iuhh`SJY5[R5u Ãhh. PUC[)‰S [^ÉU;.=utu%f=@tÐUWVS] S ujSEPUvjSEPU҃hEPS_ E߰Ҹ)PhSS` ߰H rr5[5[à t)sSu5[vEPhS5 t&sSu5[URhS5 5[ǃ0C=v%hCPVh T5` BvCPCPV UR3V pW5[L5[Ã5[Oǃ V[^_ÍvUVSuS ؀8/u8/t1vPV>Ãu1%3hSP t8uƉ؍[^ÉU WVSu u tbpp5[JЍx5[Ãt!C9uWVCPc ủ1e[^_ÉUWVS=Rt?}} ]9jf;tVSPVW 9r<1;u 1]=ytSh%TQ;=yt;t=yuCCC)CuS9C $9=Rth(T5 Ct=RthhhVC }RVhV5 5,b Ɲ0U PhV5 1Jvss5[[0Q~ Njs ~SPW老 uL5u5uhW5 !0T Ph*W5 0j=RukSPP uL5u5uhW5 譜0zT Ph4W5i 0j Wy Pj [^_ÉUutÐU,WVS}u jj) Ãuh?W<Mb)Ѝ)‰K{EC=[ti}܋FENMb)‰UFENMb)‰UfEFdEFpEFtE5[j$jEPt؍e[^_ÉUMMb)Ѝ)‰ЋKt 9Htu1ÐU%)=W#thWW} =S#thS>} u~ US]t;ur1'15_ѡ_t 9Xt @ u1[ÍvUVSu] t;5urVhW ;15__sC =Rt!9suhWS7[ ue[^US]t;urShW:15__t9Xu@@ P @ uShWP:]ÍvU WVS]jƃt]CB;/t ;t9r9t;vt(W6n utCu vu1[^_U WVS}j/W ÃtWH/u1~tWh Xl9e[^_ÉUVS]_C[9v7)ƃP3V j 9t#N/[S[9wʃVh"X8e[^ÍvU WVS= [t [C [1 'j$j Ãuh@X8E$CMQƃub} ujtEPhbXV8MQ}ȈC[Sjj/MQ @PǰȈCsFC^ Mt6E PRƃu h{X7M KFC^9v} t0E PthXz7SM Q6؍e[^_UVSuf~thXV4~u.~thXV3~thXV3~tvvÃuhXV39u)^S~t8vS'v[t9suFCuhYVP3V6 [F 5 [e[^ÐU WVSu} WÃuhYV2;^tVx^CFsj/W~ X6% S‰߰ȈFRV,PJ uN fߍe[^_UMQ9Ju AB/vRvRt9JuABuh@YQ$2ÉUWS]uhaYD5߰H_9t 9)$P>m ǃuhkY4SW?z e[_ÉUWS]߰J_ _[_ÉU\WVS=RthY5 =RPhYEPy7 EuC茓0YK PhY5H EPhY4jRE` ;=uwBW{Ãt's FEPC$Pj35[uG;=uvuE;=uvWÃtj$SV8 EC$EC@ F{t C@ F{t C@ F{t C@ F{ t C @ F EPjj$V}[uG;=ub1;=_s?_<u E_@ EEPjjEP)G;=_rE EuEԡ_EȋEEġuE̡uEСuE؋EPjjEP؜E@ @t:蝑0jI PhY5Y EPhZ-2EP讓 e[^_ÉUWVS=Rth.Z5 }u[u%[_jP _uhHZ1jjhcZIjjEP Ã}:訐0uH PheZ5d EPhZ81EPS(t }:Z0'H PhZ5 EPhZ0uVj2 ǃuh[0VWS&t |jEPSt }:Ώ0G Ph([5 EPh@[^0R)‰_]܉1;_}" _<t B;_|ߍK$9s]9AAyt AAyt AAyt AAy t A A $9rh[^_U WVS]uP`=Rt Pvj Zuj:S t;8[j:Sz C58[. j޿/\h1\h3\_1 uu{s0@E Ph3\h<\5* h1\hP\1 uu5-0D PhP\h<\5 jv,[n Pn SD ` uh`\5 je[^_US]u;<[~Z=`t5`uf  Pde `u h\5% jCv<[]ÐUh=Rth\5 =8[tj5`b1*=,[t([vjj5` ([=([}5赋0C P5`h]5k jR u@`=,[u=Ru[hquY ` dRhquh ]5 jh@]5 =,[tEl=Rtk```1ɍv HuI)ȣ`=Ru =Rtu ququEPhg]Lh }1N0B Phi]5 j%EH=w $[U=w$[$[B!t Rh|]5 j=qth]5 jhqu5=Rt5dh]5F h^*hq=qth ^5 j% r @u=RtPh?^5 uPj 4euh`^)4euuhh =qth^5Z jxuPj~ 4euh^ )4euuhh =yuu=Rru dÐUWVS}ud4[0[ d=,[t^}t0h^c(=Ru u@ `t j=R=,[t jY=RRt=Rrt =ut]1ۅf=du?h_h@_hb_h_h_h_h `hB`5 0hQ`5 g`fi`1ۃp`#dt/CPVhj`5Z p`fGC~hs`5' hu`5 5J 5uhV* u jv tVo Ãh`5 ;RuK dvSh`5g h`5T 5`h a58 5I 5uhP) u j$Iau (v t3P5`j `װD=8[tj5`*jj5` ([=([u-5`hOa5D RR uA `Pu2=Rt5dh]5 h_av ;Rt&Phva5 RX;uu;ut\P Pha5] hu Pha59 R v RI dd=Rt Qha5 x=ut1=R~}V/ Kd9UH)Ã=Rt$a~aPShb5A KxV Ky=uu=RuOh"b"@hqhqR =4[t4[jhe [^_ÐU=4[t$=uu5uh@bhjb  uzbuuuu=4[t4[jhe ÉU=R=R=,[thb5 jfERHE=8[tRHPj(BEPhm5([a }#ǀ08 Phb5 ÐUhq Phb5Y =qthq bPhb5" =ttChxthth8t54th c5 h$th?c5 ÐU,WVS}=uu5uFEMbFF)MFEFF)MFpEVtUvd%=`f(= Y=1=@tq&v== =tPWhJc5 v=RWhec5 v=Rt3WJt @Whxcs|v=RtWhc5c 5uW1@eDih`hE=Diu!=RtbWhc5 LjWh@eEPURWo[ PWN[ EPW*[ s=RtWhc5 =Rt=Rt=Ru W` PW0\ }m}0:5 PWhcEPURWW_ PW^_ EPW[ VW@^ =RtWhd5 =R=Rt WM_ up(PW^ }|04 PWh@d)vEPURW^ PW^ EPWZ VW] ,v=RtWhc5 =Rt K=Rt W^ hhW@ 0e|hURURPZ P50eZ hh@50e_ EPWZ VW\ v{0Q3 PWhdd5? /1e[^_ÐU=qt=qtÍvUuhhÍvU VSDžqq=quhd=qlthdn=4[uheS4[1;5 r=Liu $r P$[} 9 u wH $[PSUDž~Kuv H PSEDž|u r Ph`U ҃Hu w=F;5 r}A=Liu $rt SiF;5 r|vF;5 rghq*uI u>v5=q=Rt5d5uhd5T ~" PPEЃhq 4[[^ÐU=RuKu u50e)\ u/w0/ P5u5uhe5 UE jRP50e#] uCu>w0p/ P5u5uh@e5S 0jnÉUUDiE Di=~/PRh@e5uhe5 jRh@e] U5uhe5 jvUS] Su54e@ 4e]ÐUS] hea4e]ÉUÍvU WVS`;`}h `P`B1;u} `u DC9|=`u u`5u 1=8[tV`PvV`P5([ Z Ã=,[uC`;u}-~)=Rthe5u u`=,[tu%~iu 9t]=,[t)ޅJDt&=Rtu PSh f5 ؅} `2hGf5 u<t7 <t!v<t h^f,huf 5uhf5uhf5s =Ruhfu jqu Sj5`>R =8[tjS&jؙRP5([Y 1Ƀu ȅt3t0+ Phf5 jv=Rthf5 =,[u4R@R`PEPuvtu PWhgmhh``P h5``EP d0[e[^_ÉUS1;u}!` uv DB9|`=8[tu P5`u P5`5([V ƒ2kr08* Ph%g5' jBt,hh@gRhg5 j Ѕ} u`=RtPhg5 ]ÉU=([|=8[tk5([U U WVS]=RS{ltKs=l=yu)=Rthg5 yS [=y^ShgPhg xPhgV%1󫋅CC C CCCC fC "fC"$&(C(C,,CHTC0XC8\C@`hdPPP kuVu 1TClC(S,u uG=v@C %f=@u1=Hiu1C(S,uthg Hi=HitC(S,щ‰ȉC(S,LiHwy$ hC C(C,~LiQv1;}DA;|0xu yC3hhY=ytC$C&C0[=Rt S[^_ÍvUVSu>utt,1;}" Liu<tB@;|`d`F@[e[^ÉU WVSuzbuuuvExlt'D[URtUB;uuًEH$i1ۋU;}5ׁǤ<;t VCE;|D[URNtUB;uu~E uUBufd@#dtjIuu>utQv>/uCWÃu'jW0WÃS K/F>ue[^_ÉU WVSuF thjV9N VPSN 6tV@PǰȈF0VPSu[^_ÉUVS]1spvF@t9uuhjSsVhjhjh`idD `ie[^UVSu] =Ru9SVF }(g0v PSVhj5c =RtSVhj5E e[^ÉUVSu~thjVVÃ=RuGhSE }2=Ru)N@g0 PSh k5 =RtShk5 e[^US]{th)kS"{th@kS Kc߃SÃ=Ru5SD }%Uf0" PSh k5 =RtSh`k5 ]ÉUS]{thpkSrKc߃S>Ã=Ru4S?H }$e0 PSh k5w =RtShk5W ]ÉUlWVSu} =Rt=Ru WG }uA=RWVE e0 PVWhk}=RWVoG ÃEPVB u3}t-jVE uWV,G ÃuVE }Cd0Q PVWhk5> 1NEPh l17v=Rt&VW/l}u&lPh4l5 e[^_US]=Ru=jhS%F }&c0 PSh`l5 1#=RtShl5w ]ÐUS]{thlSKc߃SÃ=Ru4S@ }$@c0  PShl5 =RtShl5 ]ÉUS];us'S't xt@u C;urۉ؋]US]v#St xt@uKwމ؋]ÍvUS]u hl58 SPh m5 0sPhm5 {t"sjPh%m5 {t"sBPh7m5 {t"sPhLm5 { t"s Ph`m5Y ~m{uymPhm52 shm5 SPhm]ÐUS]`mm`mmB`mCthmRG C thmh`mG Cthmh`mG Cthmh`mgG Cthmh`mLG C@thmh`m1G am]ÍvUVSuV81ۅttCurVhm5 ؍e[^ÉUVSuVhm5 5&$ uHyP_ utG t/uHyP_  uu uǃytniyt1e[^UE Pu5 =Ru=hnu(h nu; jÉUWS]߰P7 dqtSPD dqh (j #B =`q| 1e[_ÍvUShn=L[h]S L[ Džxx@PjjSL[@Pw= 0tQhS5L[A ~0n| unRP5dqhnjA U VS=P[hnn=RtnP9 P[u.n=RtnPhnjSA v> PBV T[uhnQjA vj@5dqp Ãt/5dqVu j@ Cdq vT[0hnh8 ÃunhnhL[SVT[0P[@Phdq`q0}V5dqhnv5dqh o5 u E=~EE E}~%jEPhh5`q: |˃jEPhh5`q: E jEPjj5`q: }h@o EjEPjj5`qq: } hco e[^ÉU WVSu>t[Àu5vS$ v4%u_t-tWhzo1 F>ue[^_ÐUVSuu VhohS荆 H[ SVn[^U=H[uhohoCH[ÍvU,WVSu hoj]S Sho ƃ |819}0v)PEP5`q= ÃU9|Ӊe[^_ÐU,WVSu Vhoj]S諅 ߰HPS5`q= VEP5`qp= hoe[^_ÍvU0WSuhoj]SA ߰HPS5`q= e[_ÐUu u5`q< UhoAÍvUdSu uhojP]SĄ Sho]ÉUVS=H[t12vhohoz1 zCFKv ze[^ÉUSE |3PuhohS. ShovÍvUWS] ߰HPS5`q; ‰߰H9t9u e[_ÍvU,WVSjEP}Et}FuWhSSuho 2WÃEPD@ }Fu H[Vv}AtA]ډ߰ΉЍ\9v K; uEPhp-`EP? [^_ÉUjEP5`q: tEÍvU WVS}u ~< u C0vCNh@pWhip e[^_ÍvUuu uÍvU WVSu1tCƿ@tt*ƿCttƿFtEPs- ushIt EPsu~{P) ǃuh`tj sW6 EP1ۃ EPW<utރW!* G" Å1e[^_ÍvU\WVSuDžDžDžDžDžPPPV l_DH~|/tPPPV_ V` uhntj̉ j@V3 ÃS{R HuhntjB )PV2CP :QPVߵ 􋕰RI( DH~|/tDPPPV RV3 SV t$PPPSuIu@QV3 Phut蠊 􋕴RF' S􋍴Q-' u uDžDžr uhntja j:RC Ãt<Q>u uht褉 CjPjjjPjjN PEPC Ã0uhntj賆 vjPj SG tTPG t8Shs jPj.Sk% r1t u'jPjjR u1ۃRi5z, tht8 v=ztht zEEEEEfEA vPB0]EP蹱 DžDžDžPRPjhS Ã0uht v0 DžDžCQRjhZQhCjSЃ thtSa .tT5zPR3 5z uQPhug  R# P PBЃ CS@1[^_ÉU WVS}]=\[uhz'\[=`[uJj\[@P豶 `[tj\[@P蔶 d[uh#uj $,u\[Kv}uNWzPZC u+`[<t }tztfj/CP Eu}ShJshVo _;.u#{t {.u{uVS97j/S譁 EuVS9u1vE@E8.u8xuE8.u$x.uxu@/VS69뢃VS"9tЍX}ЍxD=[~uWEPFP D>!v3/WEPD3P De[^_UhE Pu Uh`uhuhu5 jj& UVSu] u#13z*3VE= t;u=z%e[^U WVS]u1;nu{ou z1؀8tv8,uF@8uPx ǃuh)v~ 11؉ @Fj,P ue[^_ÐUShvhv Ãt6u uj/ PhvS S,C 1]ÐUWVShvhv uU@8u1hvhvj萁 1hvjy 􋅈PB 1vDžz#@8#\8 S8 JhvPDj Ã;hvPj t8uPhvcvhvPi ǃt?uWhv3vj PS ƒt 8tShv|փh Ã3hPCPn ƃhWPR ƃǃ PhcP X􋅈P@ h[^_ÐUWVShvhv) EuhvhvE5zv~t8CPFP29 u߃PP9 u…u<W^S6hvEP| }tWShvz E`EP? }u/hv uhvhwjN~ 1e[^_ÍvU WVS} u- Ƌzt|VCP78 u\tWP8 uA}t'PCP)wu wPh*wy hCP3 uVq e[^_ÐUzzRG zuUE uHwPuhOwj2} Uuu uÍvUWVS11DžDžDž|DžCvǃ<,$x 5/Dž5/Dž5/f5/fu5/|PG Sv5/|P/vPPhh[5/ svhkxE PMQ75ij;Et=tuftufijE PM t{ SS% |Dž t Dž Džt tuuPWn uWh}xjGt u (u ,u$ffPhx_ǃtnhxtDhxthxjGss vPhxǃthxjGGt v|PPPL }ShxjGs j US]SN t@Qڀ:t.=w%1tC;u؀;u R! RhyjCs ]ÍvUS]S-0 t@Qڀ:t.=w%1tC;u؀;u R RhyjCs ]ÍvUVSu1ۺ<wCjEP5/ ƒt |E8tVhyj@r e[^ÉUhzh`zhz5踥 j@ UWVSE Dž\8/u Phzh`Sb EhzS` XuShxjBq vDžPDžTELvPtPP$ jj\PjXP5HÉP u\TPhzjAq vRx v4%@tCύv;cEPEPEPEPEPEPEPLPh {S 0t\TPh {jAq 1ɋTuƄ]9fVA~TTDžTEHPP jj\PjXPGÉP0u\TPh`{jAap vRD v4%@tCύv;oEPEPEPEPEPEPEPHPh {S 0t\TPh{jAo 1ɋTuƄ]92A~TTDžTEDvPP jj\PjXPEÉP0u\TPh{jA-o vR v4%@tCύv;oEPEPEPEPEPEPEPDPh {S 0t\TPh |jAn 1ɋTu]92A~TTPP XP4 ([^_ÐUVSu] Sj?# uShxjNm 1ۉڀʀvR* 43ڀʀvRX 43C~e[^ÍvUWVSu Eujjbl u>nu~ou EEj=V*| t@] ;tdװЍxWRVpy uы<t<=uÃ;t*U{ tUE;Cu [ +vC!v=\uVh|jl v1h|Vh#ƃEP e[^_ÍvUSUM ˀ:tB:/uz/tBA:u)؃~ y/uA[ÉUtS] Su&t3EPS2 uE%f=@t1Sh|j@k 00 PSh|j@k v]ÍvUuu uÍvUWVSu] DžXDž`Dž\}XEv7$~`|v`pv`dv`Xv`P\PhP]5/2`(v5/* EXh}SV)Lij)ƍth;PsWW\E}E`E }uTW;Eu$Xth~ EXtuh?~ dPhY~dǃtkhY~"tAhY~th`~jGxh dPhY~ ǃth~jOi vEP\PhPW }uh~jh j Uh5 j@u U<WVSju_w ƃPhc@V ÃuV X@)Cdƅƅ PPhcV2 ǃtV K|8uIx%Dt|Ȇ[^_UWVSu0 Eujjf u>nu~ou EEj=Vjv t@] ;tdװЍxWRVs uы<t<=uÃ;t*U{ tUE;Cu [ +vC!v=^uVhLjf v1hJVƃEP e[^_ÍvUSUM ˀ:tB:/uz/tBA:u)؃~ y/uA[ÉUtS] Su t3EPSr uE%f=@t1Shhj@ f X*0% PSh|j@e v]ÍvUuu u蕟ÍvUVSEu ~a6hʀR ր^=^t 3Ph؀, ݀;uh;4#h@h ^;t3v$ u;uvh" Sv{ tC 8tPsh5 sh@^u3h@  C̰Te[^ÐUVS]5\u;T=u} u \^=^t;Xt8t ;Xu8uSh`e Ku#=thph5-^vph@^uT5\e[^UH_hD_jÍvUH_ĀhD_jÍvUH_hD_jÍvUh@h Uhh Uhh  U WVS1}uEU BBG}hFE PEP苻t(}hQE PURit}~$E 0h` vE XHMP蠿uU 9Zt 9ZuBBE 8at=`ttH=tE p$*‹E Pt"=TtE p+‹E P1ҋE 9XuM9HtRE ppVLcE ;Xt p e[^_ÉU<WVS}>hE PEPu"E 0h E hLij h& =`>u=VE 0u=;t;vRX v4%uC;ù;uxtdvvR v4%t)vR 4CGu=tS'Ã=TtS)Ã19u =uPSV=`tP+a=u>=ht5hh萻tjju 辸ƃ5Q;uz=h=TE 409=tE 4&E =TtSt(1ҋE ;u =uRSE 4=`tP_==hhhWtmv1 󫍅Pjh E 4u u+E 4h˂_ P =7E 0谹=t7v%v=TtS'19u =uPS7=`tP^=u>=ht5hhtt ?PF;uPj? [^_ÉUhقju u4ÉU ݂tقRju uÐUWVS1Dž}uEU BB}hQE PEPzt(}hFE PURXt}~E 0h +vE HPP蓸u1BvE H)=X;t@vvR v4%uC;ù;E XtdvvR| v4%t)vR 4CFuE PtH=tE p\"‹E Pt"=TtE p#‹E P}PE p}u;}E phHZ 043vu,jE p0tf9 | DžRW1ҋE 9Hu 9HtRuE pphAh 9t P+ [^_ÉUVSj Ix vQj y 50 =tl=htc55h褴t5jh蚟5jhsvUWVS}>hE PEP襰u"E 0h"\ E hLijm h趞 :un=_PE 0苳@=gGӁvR  4%t*ӁvR 4؋Fu=tVƃ=TtVd ƃj1;u =uPh݂PVhRe =u>=ht5h:hStj5`u }TRj [^_ÉUB}t?ÍvUS=t,5=uFPhT vhh$=`uHja=t5h袶 h#j&5dP8tR5l%PhO 5İPh3 0hhh@h@h  5hP5P5P5\Ph`躵 05nP5`_Ph艵 5 =Phj 5P5Ph9 =th,hh h93"=TthhhF h^!5P5\5uPh蟴 5SPh耴 =u=XtP5XPh A 5PhG% 0=P~Ahb8!1ۃ;P}'vPhj C;P|]ÐU WVS]} u>%buCh?w] u<uhBwc] u7hoI &}t6PEPh e[^_Uhhu u1ÉUhhu u ÐUhhȰu uÉUSE] u=%t3hlvh?sP\ tkhBs9\ uRj EPs ƒ~E8tsh g\5Ph!輱 =t5\h7蝱 hM]ÉUhOh\u uÉUh\hu uuÉUhmhu uQÉUhzhu u-ÉUVS]u ~6h=l%l uSh?vZ ulu'hBvcZ uluwj EPv ÃwE8t!vh· =dt5d Shhdhvh{/ {P{l=lt,=Pt P8uhx l45dP8tR5lPh8 le[^ÍvUh7hhu uAÉUh@h u uÉUSE] ~3h`vh?sX uhBstX u ]j EPs ƒ|E8tsh2 m=%=t  %PPPhͭ =%]U}hE PEPät}~E 0hʈt bE phEu8=u,=\thWE ph)Eu dU WVSUu  B^Ft6h1Ь ~FPauvv}"vhrK LvhS. tShL; vhd$K ;~t v [^_U}hQE PEPt}~E 0ho "E ph1Du dUS}?hE PEP螢u#E 0h"U  E hLije Eh豐 ;u=t|SE 0虥tgShXCu d=u>=ht5hh>tjju lÃKEPj ]ÉU}hE PEPCt(}hE PEP!t}~ E 0hҩ ?E phʼnABu"E ph͉&Bu dÐUWVSE] @C@CՉ~3hG 31t EuE CEƿՉt"CP蚤uCEƿՉt;8|t6CPZtshOu /jjh݂ssEPU 5T E9Cts E9Et EP e[^_ÍvU WV}hE PEP)t"}@hFE PURu$E 0h@辧 vUE DEEE DuՉt2E8|t*EPtuhtE ƿc1tҀUhLijQ Eh蝌 uEwEajjEPE 4u }tP:T =u>=ht55E 0h;t5G=t EH9fEPj U9Ut u e^_ÐUWVSjjL jj: ǃ |ÅZS C~jj jj hg. u Džmj/PRF Ãuƅ-hCSP达 E޺u1t tƅ+=t P75 }~(j5 hxPW= jPP= Wh{C jm ~V蟊9uPj Wj uh~7C  v[^_ÍvU\WVS1}hE PEP"Ev$E 0hң vE phɊ=<}hъ‹E PEE ph܊;uv}Y5h 5> 5jO]S; ߰DE X EE p h;Fth *vu}uE p hK;e[^_ÐUS\\h;u&=uh hI:\]ÍvUShS$ tShN vhb@ ÐU}hiE PEPt}~E 0hx谡 bE ph!:u8=u,=\thE phɋ9u dU}hiE PEPOt}~E 0hx bE phыq9u8=u,=\th E ph 19u dU}E PEP?u E 0h& u uhXÍvU WVSuh{hPs. ƃwJvG;} }8E4^u{P)S.P'. |9vPh{7 jr9td[^_ÐU}hbE PEP#t(}hgE PEPt}~ E 0hq貞 E pph7USUE \\puP6\]ÐUSUE \\puP6\]ÐUSUE \\pьǔP\6\]ÐU=tjj5j8i=tjjjW vU=tXhٌ5=t5. `r=`u PÍvUUE ~0hތ *u@hGPh>5Uj踥=`u j&h=t   jgjh U WVS}=hE PEPTu!E 0h E p*Eu+h 5 Uu}u h,Ex u+h>5 0h t hj ƃjf Uz tM=uDhh?5 jfVj1 hVhVÃ~-)RRhd E PEHPUBЃ=t    jeVj e[^_ÐUhYhu uYÉUhfhu u5ÉUVS]u u%hWjvh u ,jvh,޲ <e[^U WVS|E,=,tEU<t~];tav11Ҁ=tB:u;U}.,$B<t:uG;U} ,FuFC;u|[^_ÐUS}u'ThT}hE PEP蕏t}~$E 0hF vTj 5 XE Ã=`tC; t j S1E Ãh5 h9 C; thSh ]ÉUWVSM1E1U@~<$t<\uRF:tX~0~>@95F:Ft(>ύD(L(A9tF:uE F:tE}t,9tA}t >tF}t9t >k}u9t E=E<[t' <$`<\X~SFHF>$F=w%1tfF>0uU:XBA:uH>ύ|+T+܉߉}E;BAE;8u>>,>]}}v>\uF>$u{F=w%1tVF>0uU:tSBA:uFv>ύ|(t/T(܉lj}];tvBAE;u >tFA>t>,t >]V>uh(vEN}t& >\u~tFF>tɀ>]u>빉F<,E<]N7vF=w%v1tVF>0uU:tMBA:u@v>ύ|+t)T+܉߉}E;tBAE;8uAF>u=t Eh[^_ÉU1=\tҍPhİu uÉU1=\tߍPhXu uXUhh`u uÉUh hu uÉUh+u2=u&=\th 3hJ+u dÉUSE] ~3hOÒ uGj EPs` щƒ|E8tshj{   uhzRPh2 ]ÐUh*ÍvUVS=Puh}h.E PEP t}~E 0h9躑 =th`jE pPP PuTchwHPN4PvPD@P4tjHyP S؈< u$P;L~JFuHyPM  tu΃t.HyP  t묡 uh.e[^ÐU1=\tPh(u uÉUVS}hE PEP͆t}~ E 0h'~ ;jE p蘋ÉփutVSE ph;= e[^U}hE PEP?t}~E 0h' LjE pEt)EP胁 P͍ PE phC蠎 EÉUE pQ}~IP&ÐUS] h݂jSutssh`8 ]ÍvU WVS}hE PEP<t}~#E 0h' E PUPwuh/ Ãu߰@P ǃuhj+ vShWu 5\\jjhقE pWh:0W 5\E U;Pt p e[^_ÍvUUE 02V ÉUWVS}HUzMy11ۋ8t[vUvR蘸 v4%@t;\CM;CF<uP5}} }ǰHU;r װH9s< :u.}CװH9s :t;sF};wr9vSRQSn S5{u VvL Ix  Qj ݼ hjEp0r UR[^_ÉU WVS"wE}Ѝpk=ktFװH9w&VREP6 u3EP&w;uEPu EP(ÃjEPHwÍe[^_ÐUWVS]j/S* uƅ.ƅAv9uƅ/ƅ )VSSǢ P u usstHS9wbHPSP4 u2SV uh j& PPuPF Ã9PF Pu Pià jPuÍ[^_ÐU,WVSuDžDDžDžDDžj/V( uƅ.ƅ4K;/u9w)CSVVҠ 3=duh P$ =tj5tsDžk=ta;uPj/S' t@v؃Pu uh`j$ vP5sPjPz~Ãqt hE vPh  dr1;ps{JH9w@HPSP1 uSPrF;rrPu PÃjPrÍ[^_ÐU WVSuNj_)ÃS7h| ƃ)ljh=E;u5;u(P4h 0 u E&54h ɝ  =uEPR0[gƃV װЍX9vC~3TvR  4%t9V D/wr$vEPh %U=th8vEPh ?%EPh %e[^_ÍvUWVSDž0Dž,}.hE PEPzuE 0havDž444;P}"j PE p. uʋ4;Pu$E phY h8P 4;0vRH v4%@tC;}̾;<$t<\CC=w%v1tZ1C=w%v1t|PΉKE9|nE tV E |7{iuJDž,C0;U}9E 4V E 0<ЍtF;t C;d0cǃuh=uh̔ t&=uhޔ=\thb05GЃ=t4t.JyB;B|Rj 8Ph cEE 4;t C;,t00;EA[^_ÍvUWVSDž|DžT1DžPEP `uhjd jh#`R) u`\Njh+`P) u`\`Qh2j j/\P+ ƃt>u URh`; Ft>u MQh j/V XtXXXt X8u URh } M Q蒘 Tuh j jh#TPb( u T9jh+TQ:( tE PhE9 T\\t \9uE PhE F/j/\RW* ƃt>t`\9[u)j]Q ÃtC\;:t#1 j:\P ÃtC=t XRVS\Qh`| tڀ:u}1lrEEtPEPR\PD ËtPtWSs P\Qh 0c P\Ph }tJStp ppǽ| |u't@tuhk N=`tt[t C;Buu`ss|PuBt@tudjjjj]WssU Wh tpp|Pż}Ft@tt|P< \Rhl OvPQі DžPTu#EPhȖ2z \RVh!vM QEPh z Vh*pPd d| puh>dRp|Pt ;d}%h\ p& ip |1󫍽|vG|9s(jW|P ? tӀ? uƅ{j |PQ& ǃGjhqW$ tWhu|1|G|9s-jW|Pq ]? tӀ? uˀ uƅ{||vR v4cujhW" tG?u?ttj WN% lj lPWP ==l8uvhhXQ[$ h}XPhN 1Džxh`\t&xxPjS h$j= x\Éju dHLHL| v)dǃd~'dRWhQ$  uȃ=tf=u]8#JyB;B|Rj#I \;5 u;v5 h|P|P螼 d====\; u9;v1 IyA;A|#vQj#q  Ix Qj I 5 dth js=\th͗xPj |PJ hP8 TtTR `Q 1h)XPh0 \Rh@ |t|P诺 TtTQ耰 `Pn PtPR/ ([^_ÍvUj|hZ 5v jh`;YvULWVSEh Xt!=t jjE@vhjQ hj B hoz hyg Dž mvDžDž1DžEU 4S uhj vjh#P" u'RPjh+R  t(PRo`j/S ƃhƘSv ta8/t\9t 8@uEU 4hʘv@hƘP t8/uDžtt8t8:t@t;tÃj:SZ ǃt=G7v;[uj]S t Cj:@Pj:S ƃK;Bt3Ft->t(j/Vy t@ 1=t(RVWSPRhVp hS1 Sh =tjj FE]Et?t}E=t EPRd`==t'=uAPRScu#Sh Y E@vjjEDEGEEPjz=dDž1=htUt>thIV t*8thIP t Džt8>t3u/EDuEEPj=dt :uDž=\u#PuPPhQ+n t*RVhchS EiEEu t.EmEPjEPjү Q)ƒt E@R E@Eu&E;E}j:EU 4z g=tt jj[^_U$S]jh+S tkjh#S tT;[u#j]S tx:%4vEPSj葀 tj:S u1]ÉU<WVS];[uPj]S t>߰ЃPCPh腅 ߰ƀ7߰HPShL ߰ƀ}1ElrEEEPEPu V苈 ÃtNSƇ PVhB u0 PVh :{thshw S{Bs ssǃ }%[uփh =tc`vRt B;Cuu`rrWlu([tW \hvssWAt~{tljjjhVssD Vh [jjjhVssD 0Vhi Wr hTssh0蝪  Dž PhWY}"hQ Kv=u7DžjPjjW }h˙ hW hW  =tuh 1=\t5hh j~C=t5d =t5J OvDžjPhhW }=t h   W蟮 1[^_ÉUjp Ix Qj 5蘎 dr=hrtjhKMvÉU WVS}dr=5hl u jWh/ u5h l 9vjWh* u5h0vl VW Ix vQj 5蘍 =u h@c 1hj衬 Íu VW5: 5hck 5$ h f%P5ƃ=drtt jӃSj e[^_ÍvU,WVSDžDžDžDžhj DžDž1;vHyP ~6HyP Sh2HyP Shhhk55 5a MGuJ}{C=\thY5 v =\=\~n5ue~`= t)tu=\u5hc Jy B;B| t RS躕 5=w%1tDCУtjt%dv!=DždDž=w%1t^Dž t#)ts@-Džv~(u Džu-ut uE9sFHyP  =\=\~G5u>Jy B;B| t RSΓ 5腈 u6)ÁvSPhz ƃt&9t1t hPj1 =t u@=drt"tt jЋ,v!Pj軦 1[^_UEU UUBRjjPj oÐUj@idrh/ 5 jhEvUWVS\EUDž=\t?}t9} tU :-tRhV_ }tMQh"<_ =`tEPU RMQ<.: vT;̰tj5̰还DžDžDž|DžDžxhUD=htj=hu=`r|5`r# `rtPj萤 |t|Rj s gQjR Qhj= h(j( u .1t  uU :|jj У |h] CSY u?Sh0UQj茣 |Pj x RiDžD"vhM Q{c uFE Ph3Rj Qj  DžEPBP |E%f=tJM Qh=a\ Pj蔢 Rj耢 􋍐Q! pEЋUԣtRPjA Rj0 |t|Qj  hOA uTtuYTuj5Qh\ 0|,'|"jRPBP }M Qh3-RPh^ft&􋕐RDžxg}t|EPURhkQj誠 Pj虠 |t|Rj | +􋍐QrMQh0tgPj6 Rj% |t|Qj  􋅐PdxQ$~jxXjj 蠟 | Tл1v)~VSBP觟 ǃڃ==t =E;hE;uE;wREv#JyB;B|Rj#蝊 \EUډEU덃56 hPAP ƃ==t ===v\; u6;v. IyA;A| #Qj#  Ix Qj 虉 5P~ }E Ph34O8 `E#JyB;B| Rj# 5} \EUډEU=t;=t =})E;E;oE;]@ @ JyB;B| Rj m JyB;B| t  RV. Oy􋅐P轸  0==t =E;E;uAE;wE1v IyA;A| #Qj#y  Ix Qj Q 5| B @tM Qh3@ @t.|8 thqjSt􋕐Rу􋅌Pe j Rj藚 Qj膚 |t|Pj i == jXvRj' Qj |t|Pj =hu=`r|5`r1 `rt􋕌RP jtt􋍐Q҃= u=v jW X[^_ÉUj[drh˿ 5y jhS8vUWVSE lDžhDždDž\\EUEt pu%EEtZ=\tQ}tKlt(}u l:-tlPhQ }tURh"rQ =`t&EtEPlREPh vDž`DžXDžT1=u E%Eh6=htj=hu=`r|5`rg `rXtXRjԖ \t\Pj跖 tp hj聖 Xh(jl \ }u&lƿ.8|jlR输oj/lPg8t7Z8 t-lRh3XPj̕ tj;ltÛtlvśP)ƃt/}9lPh3%XRj\ \Pf=uh螱8 uUhlR詓}:lPh3XRj \Pv=ts68 uilR#luM=t?lP"lu#XRjv \PvEu=TtLjj̇;T;̰tj5̰談jUR Jo t3XPj \Rjݓ / h3 Et3 t&RPh^ }t@UREPhkt@XRjF \P vURh0o hRd }l.u$h }url:|ugjj 藒 Thl@P|Hh ul@Ph0P Dž`D"FEPlReR hulPh3 Dž`EPhBP |}uEE;vX=t5 u uhǛ:ẸE%f=t jJTE tsjRPhBP訒 }MlPh3ytp `hRv1ؙ==t =E;gE;uE;wQE#JyB;B|Rj#{ \EUډEU뎃5~p 55dBP4 Ã~'S5hBP ƃ9==t ===\; u7;v/ IyA;A|#Qj#z  Ix Qj z 5po }. 8 thΛN9 lRhԛE jjhP I |e=~=MuG=(%`j`Pjj5`r{ }h=MuG=(%`j`Pjj)5`rz }hLPhL5`rz} hqt5j|Pjh5`rez }heDž\\PhL5`r2|}h*vj5`ry}h==Mu[=TuR=XuI9\u5EEEEENfE`EuL~ui~u~uFjjjj-EPPV t*F%PEPSh&NFt t9VAPPBPBPBPFPh6W }VAPPjBPBPB PB PB PB PB PBPBPBPBPBPBPBPBPFPjjh``u"=uDžX%Xt =Mu9Dž|j|Pjj5`rw } h˙13v5`rR| `rXt 8[^_ÐU0VSuE=İEPEP5`r@yÃ}+h"5`r{ `r1b5`r{ `r=Mu1EjEPjjSv }h˙V5`r踖 e[^ÐU= u=v j9ÉUj=drUWVS]drhPjz Et%=`E `#=` E`U=t#h5CP(M ƃCM  00u 󥍻󥿠u<U<@@̰DD̰THHThLLh`PP`TTXX\\jh`PK ƃpE`Ph{ jh,qPK ƃEqPh,z TMT hhPSK ƃEPhz hhPK ƃ EPhMz EPjw =drtdrjUҍe[^_Uj`: Ix Qj Uc 5 X drjhvUWVSDžxEuǹuT=tt̰u=dt=t9TtjS#j=t(ht =u'hKth1j=u&h js9TtjSyihh ,u[h'htju xEPEPhk t"xPj}u jj.jE@E E PtPhkujhrjjp jxPjt jEhrEPE Ph. tjjt hru1t t=`u j%vuu=`t j=hu6Eu&E PtPhkve=ht ju=`%PJ=hEu{E PtPhk t[j =ht jj=t xPjcs =ht j=`%P=hh|S P@ j S< *}h*=t  jj =`t jj=t xPjQr X[^_ÉUVShEP, u@ jVTÃ}h0 tjh[^ÐUWVS}j/W-EE1tj9t Ût śPnƃt/})Wh31h@1Wh`s `Hƀ`.a}0u{.uC1CKu7E}dtEC<9uE0Ejh`Bnƃ}`e[^_UWVS}=u0h=t H vhhhhkS i jjS@P2 th*hh5 5P hS P@ tGWу j P*}h*=t 0tBGبt#vhSGPo ju=(u jjh[^_ÉU$S]{uu{uoSzufz u`9BuOEEEEEEBEBfECEjPRh EC]ÉU\WVSEU DžDžhj{Šdhʠf à tShؠhd =duh۠hdhİX( \l\`he u j/1>Ãu vCÃhd thP% t İ޿u İ޿  u lhZd Pt8u P=lt$P8uh wlhbd Ãt޿gu 1ۃ@PQ ht\u @PQ ̃B$lrlr  h}qeİY/M /5Ȱ)(\\ hlPR\ ij)h`=1lrDžPPjPO@ ÃtRS? PRh~ u 豅0~= Phؠ ji `=ÅtS}ufP~t ^qP?k jN+h,jh j:0 tN􋕼2,u7 QP蟮Ph vh st jh hjg hj g F ~BP)P*h ؅t"hjSg hj Dg S7Uj)jh Uj)=tv=t/j@Pa5u  =`r|+j5`ra5`rf `r j=tB=t/j@PKa5   jjU帔ÉUWS}9=, Ix Qj Q ME< uh}hZvHyP EU} }uEP5Hǃt}ujjME<8 t=v!h躋}uWSl_ EWj5 =0fÃu h)u hʢ{ t=uhܢrv05CЃ=t7{t1JyB;B| vRjO { =|=ht%5P" 59D 5hh2$ ujjKHEhj c hj c e[_ÉUWVSuu1}E1Ek ktHA8uv:tCBA8t:u );E~ E] );EuG u E v[^_ÉUWS$@@yÃS5u݁=u7v=t+|He[_ÐUVS1ۋ5$:!t:$uuttWe;u + $ :! v < t 2< u,B;uߡ+$뼡tt   < 6,< $b<"t0<\uXB;uS+$0B;uk+$H AB;u!+$;vtr<"u6B;!+$vAB;u!+$늉tA $t*tt  1[^ÉU WVS}Ã=`tPh k&>t=`t~ t6SHrk9rȃSjSSE E Srƃu Sh/u ShK v6j he Oe[^_ÍvU FPPPPh5F j^ U|WVSDžhU%V ÃuZ߰Ѓ=v!j?1 PShf<1QSh\hS htS `uy8tShv몉hPxU }ƅj.P 0Džy!t tDž hURb h5D j.5u ƃtLPV u5)PhR u+1j.UR ƃ1PV詿 +]ShURS  t vrCE 8u/h/ U chzjGvhE 0r O/U :t2 t-P`@P[ | ?\E8h*/ Uhj蓱vP`@PZ | ?cE8Wh. U:hrj=`_v`HyPv `t t̓ tȃt uh5=PP16Àu*vS{?  4%@u8FG/`HyPu v`u t8`HyPu `V uɃH=Pu/>vPVPvPD@P4tY`HyPt ` u ~iFuu"h/hhI莱t: t5$*hSh@J5`Jv h hc~hh 5`u x[^_ÐUS`@ `?`HyPs ` Bvǃ tƒ,t"/\u'`HyPTs  `C`HyP*s v`tx"uq\u'`HyPr  `C`HyPr v`t t t t,u=u1>vC6vpr=prt h3]m t҃;u ]UVS=t5h9v}hE PEPIEv#E 0h =lt d v}~E p~) ƒ=lt0=Pt P8uhjެR5P RE p =lt>E ph ֦n=\t5Ph  XF@JfD̰TLLBABfA@VV@BfABA]aXbf=tjjE pp5\=u \hd蛥uetaEj h4 Ãuj h Ãt{.uKEhhi tEjhh蒸 uc=`t d̰@@BfABAt`Qh$ P=`t vdt(j h§h u hx5\e[^ÐU|WVSDžDž} u8PEPE PEP}1} t }= 1Df@:&E u$[OPfu E -E hPwI u h7hS蚙 ]E - } u%ÅuNPfttSEPh;vMQhJo 5jOVo D}u] MM } hu hV蠢ƒup}uh^{Euhhmƒu=uhp?hy+ƒu-u8t/hyth;=`ue1һB;P}I<uܡCf05҅x[^_ÉU WVSuЍXvhuuh ƃ C5)PPp uhЍ\~C< u;ȉE ȍe[^_ÍvUWVSu}=uE=hu=r5rl r=hu7=u5v=rh5hŨhS Sg }Sh1vPM \t \ \} t=`%P3>t,jjP6Sh >uۋ Q)ƒt t} t=`%P\h Sd rSJ =ru"uh r 5rhh u5roj rjj h襲 t[^_ÉUS]==u ShG  5+ 5hP u1{vRL v4ntat#9pu3hOqSh` ÍvU@WS]=htg}1 EPjh 3u u}u 3hEPy1!E0 EPYe[_ÐU WVS=\=u \uhupj h轰 ƒttBj EPRÉ֋E8tUvR/ v4%@u*} t=u h$p=\؉e[^_ÉUlWVS\E ME=uE\uh2}1 ]ShhP1߰ЍxEu&jhʩS> uͩE utcEPEPEPEPEPEPVEP P u9EMIM}tE vEEEP] E}u%} u =t:EPh 'vMM} t=u hnE\}u M Ee[^_ÉU=ru CrEPhwt@j`DtE;ru jÐU<WVSDž}u>jhB jPEB===5=5= SQRPSÅ}1ۃd~dSh%+PP萎  $~WٺQ)Ãh-)Ph@Sh۪+PP,  1ۉ vC  u vvB u PPQRh+P*P踍  ))É؉B}B@Bv;= uV;5 vN5 =~Dž)‰)ȉB} B@Bۅۅ5(==;=u ;5~*؃h+P)+߭-ٽff f٭߽٭uC?~v;؃h+P*P褋 jhVSOt#Ph +P)#h+P*P5 jhVSMÃ<֙R)Ph+P*PЊ  QPjB }uh"jB j :}u4j Ix Qj - 5x" [^_ÐUWVS}=\ujEP<U)‰||M)ȉB}|B@Bۅ|ݝpE5܅pݝp-݅pE@t}fMf fMm}EUm1ۅ u =v12t0QEUmt  $tp54=u=u-PRPh@d)PD.Pш ƃ0@=1=$ܝpE=;u ;+EUm-ܵpܥp}fUf fUm]]mų  )э))ÉlN<lRlӋl)PQhld)PD.P艇 ƃ VEPtPd? H[^_ÐUWVSEEEU;Bs/M<Ѝx;}~}EME;HrӃEe$}EuE]UZK1uE9]1;uEMt8tPBPFPh  ÐU WVSuFhE pXuhU r>t_Lw=Lwts3hIj ;uhR j\ hphhI'E pÃjhuU rЈÃuE phStU r{ tE xuC 0vxU zt h dvC {t&sC t8toRhz6 {jCЃvth` 1vSt E ph5K 1{tU rCЃs 3hWQU BxǹtPƒvC C PP3hhO GSe[^_ÉU WVS} }hhw贅uhw蝅Lw=Lwts3hI ;uh j hphhI 1:vVh Vh5ܵ 1E}v7VÃuyjhuVÃtS7u{ t5C {t&sC t8toRhz {tkjCЃ\Sׅ,{tjCЃs 3h0!C C PP3hh[ m e[^_ÐUjj"<jjL; jj=;ÉU=tjj;jj";jj:ÍvU=tjjA:vjj";jj!:ÉUUuh`] hP 18} t`EU`E EjjEP1IÉUjuÍvUjuiÍvUSh x=xt7v{t&C8tP3hI h ;u1]ÐUVSu }t h@hjhxv"Ãu vhS[tvh5莲 @{ t&=uh h {tsC1e[^ÍvU WVS}u=utNv~ t=~t7F 8t h hs vh` >uhH Lw=LwtJ8 tB{u'C PiP3h vs 3h ;u5;}%E 4*ÃjhuE 4wƃ SuV豁tE 4hu u E 4h)Q 1tC~ t=~t7F 8t h h vh tN;tI8 tB{u'C P1P3h vs 3h G;}tle[^_ÍvU@VS]u ~FP~/Ph`W ~F(h; 5j2]S; ؃ 8t5 e[^U=%h t=toPh 5 U$SgEPEP\-؃jj EPEP5- t"=tuE;EuE;Et d(jg]ÍvU$S gEPEP,ЉUi*t tvh# h0? Ãu6j/Sr}uv@}~jhah>PSku jPSXuhAl jjbEPEP, t$=t}uE;EuE;Etb]ÐUWV=tJj5@hG 5@+}uE p[ tjh =e^_Ujh[hdhG$j{Ujj2!ÉUSz=zt7v{t&C8tP3hI h ;ű]ÍvUjhzu||ÉUVSu }t h@XvÃuvh6vS|us C\Evh5被 1e[^ÐUSz=zt7v{t&C8tP3hI h ;ű]ÍvUjhzu{ÉU WVS}u  hAvÃuvhvS{tvh5辪 1aC 9tB3{ uPs G9C }2Rh@5r 1v vCиe[^_ÐUVSut!vVs6 u u1e[^ÐUWVS*;ts F .j6 áC;tXV"JCCV C u  C ؍e[^ÉUSuVÃtES;tCB{ts { ts  Sx ]ÍvUut@ÉUut@ÉUVSuu VhVÃuVh5ʦ FsFjrIe[^ÍvUSt-vs s {t*Ph( u֋]ÐUU }t{4@1v={t#{xt9Ptܡ{{u1Uuu1v@ ÍvUWV=35h5H }~E pG ]t\h` tPh tPh >D=tu h!h =thv tPh%S t/tPh8 hI P]PhY 5 e^_ÐUjhGhthXO ÉUUBt u B Bv1j.hPBPJ ÍvUWVS] Dž\DžXDžPDžLDžHDžDDž@Dž<=t(5h{ 5PC }y``fCh 5߰Ҹ)P߰_P G `M;TM3h3q3uMHw3uMm3uMt;D&Pu PLu;LMvTPh^}PtكD}1EEEpPuVjDWÃuEpPVjWÃt^S-PDPh55 M20 PDQh5 pCt5Sh 9uh t1e[^ÍvUWVSuU 1ۉEFVV‰V [^_ÐUUBH;Bs B@J)ȉBÐUUB;t1vÐUE@ÐUUBE ;B r+BBBÐUSUM t`zt+Z)É؅|9|Z)ÉB9}B;B r+B J;Bu ;JrBB[ÍvUU;BuB;BrBB )ȅ}BÉUU;Br uB;Br BJ B )ȅ}BÉUUztB;uB;uB;BvBJJ)ȅ}BÉUUztB;u!B;r uB;BvJ JB;s J J)ȅ}BÉU WVS} utSEP9|EPSWEp SEP )߃ ue[^_ÉU@L@H%ÐUu u5L Uu u5H UÉUU8w9u g919w9u=t9ސ?:֐0w9uth#;뺐:w9u :막?w9u 7듉Xu/5w9u S7s3w9u 7\vÐUjht@PÍvUWVhji w e^_UEHwx$8wk9wc0w[3wS5wKw Bw1UWV0w^_ÐU1tjSjB/jS]ÍvUS]<t tu t tJtA=t7%=t $$T$tjSja."vu=t ]ÐUS]<t tt 'w{$jS%%hCt@DjjR jSp  Q zv1tjSDjN-LjS9"u3jj  jj v]US]<t tu u?t6"u `$tjSj,]ÉUWVS} t8} H(wU Rx,vE E] v;|uEC;t;:uU P EEƃE}U}|t}:u|C}uK))B} tPWE PqL u U: vVEPW?t>}:E<|u CU|tE} t}} EZvUvRs  4%t)UvRY*  4CEEU9Bu,ǰuB9rU^E8u6} tU U9sB9rE8uEe[^_ÐU WVSu}׋] 9s#WEP3J u19rݸe[^_UWS==t=t5N hÃtYEPjSzuShBt(߰H(wS[) 8u e[_ÐU|WVS)‰ЃPhj;8EPEPKhhuujj hhhuV }а׍_@h D9}!SVh .GPEvh# ;t4 t:t tT"T &jw&o`;O=t2&=tI|+=t\v)PR)PRa)PRa)PR)PRj)PRc;Pt' t=4$)PRE ;8hJƒtװH+vjj#hhRjj#hhhj2uVH) }׍_0h H9}%SVh 2GPEPj>*h# x[^_U} hd ^Eh ~*jhh jhj>5*vh蟙 ÐU}  h|胙 ÐU} hg ^Eh 2~*jhh jhj>)vh ÐU}  h ÐUM} `9tuz``#}u #h ~,jhh djh!j>( hS j&"USTsCC C TrjCtC C jCtC  vC jCtC  vC 4jVCt4C b vC @j&Ct@C  vC Lj CtLC B vC Xj CtXC  vC dj CtdC  vC pj fCtpC  vC |j 6Ct|C  vC jCtC  vC jCtC  vC jCtC  vC jvCtC  vC jFCtC  vC jCtC b vC =(u' j]ÐU=(t*=(u $1Ph@谔 ÉU(tUEu( v(t PÉUh ) ~Q}t#j h5h jh7!vj h,h jh.j>k$hbד ÐUS~FjjVڊV:u؃Q9t~ufA$ 9uFFAWvA $9 F AFuA $<t A AAPAP%PE } ft je[^_ÍvUSTsrv{t^S:tU h' ]ÉUS1ۺTs.z}bztJ:t  TrӉ[ÉU WVS11E8} ujbY;] }NUt,t%u tW'EtCt UFC;] |tWjoe[^_ÍvU=Tth5T> h T=Tu.hՎ dTJTddddd'dddÐU9=dt d@ÐU WVS]=Tt;ufjj6 SjjÃu߃jj SjjÃunS#Ɖ߰ЍPt'dD;wd;T)׃WRv Tu2h! dTTd )щʉ)щ dSt dCd7…|'~=ud vddddCutdd1e[^_UWVEƿt_ƿtLƿt9ƿ t&ƿtƿu v1^_ÉUSTd)Ã}u~rddddh a9~2S5Th FCPTPj> h/ =Tt,5T dT]ÉUWVSE1EhFOE=Q$Hv0 u9u0=u'= = u OBu/FOE== (vu3 u.FOE=f=Y =u#=u jh=== =u#=u jhq=== "=u=hjh J$l#hhh#j vv=o=bjhShh#1-Shh#SShh#S$ Shh#S u ! jShh#iS jEvu+=tt=s'=s Shh(4==s(=s|hI~P}}t"EPhEE5hǃ5}tEPhf1}u}te[^_ÍvU=Du1+D@jhjUWVSE1EuH}t"EPhEE5hǃFuOE==@t(@9DE=DD.t 0w9u!@jhj:w9u!@jhjƼ9u!WVj詼@}v9t GNM‰Ӄ t u|@p=t[9uPt,u$%9t 9u FOE"WVj@}@=Xt|9uq~-u$%9t v9u OFEB=h%hj XtRu@j tv tvXt$ jh $ jh @=`u#$ jh $!$ jh a$ jh J @Vu4$jh $jh  $jh h j}tEPh1}u}te[^_U WVS1h xt2=u$u=tu th21h t =1Ƀ=luhȃ=Ѓ}%PSVRWQOà ht ÃhtJ É؍e[^_ÉUI=Pjjjj jjjj jj!jj" jj'jjG htjj#T=t 5* ub(juju8ÉUÍvU$jh [$jh D$ jh *jH jhhd- ÍvU$jh $jh  hhhd =tÍvU$jh o$jh X hhhdv U$jh $jh  hhhd& Ua$jh $jh  hhhdÐUWVSuh| 1auEE}EEEE]h )9|SVh CPWj>G He[^_U$jh $jh  hhhd=t=t jÉU$jh c$jh L hhhdj=t=t jÉU$jh $jh  hhhd=t=t jÉU$jh c$jh L hhhdj=t=t jÉU$jh $jh  hhhdU$jh $jh | hhhdU$SEPEPEEEEˆE]uE]EC]US]tjjt jj]US]tjj)t jjE]Uhhh苿t j葾 hhhat jg v?U WVShǃhÉރ ~}t vS5Ã~W=tS5j>V9u(9~$)ރ}uV5jƃ~Sh=|9ut 1)@e[^_ÍvU1u=ttt=t(u.=ht";~t `ÐUS]utP]Uj|ÉUVSuSvvS  4%t%vS 4Fue[^ÉUjEPuu uCÐU WVS]=t;t P! tR޿t?hS{ tSh諽 3Sh5PF fe[^_ÉUWVS} uEEEEPEPh5E =tM~9s.P ;u*Ph5E C9rԃE=v ~ 9s!Ph5eE C9rE ;u hPh5)E 5蔚 5肚 e[^_ÉUSMU ]=\*u+w4`QhSQht4t$t1ukvpsxt[PQh5MD 'w4hu h Sh5 D vSRQh5C ;uhPC 5F h5C ]US1ۍv<'wP4h7wP4`hPShq tJ'w4h*w4`h*Sh8'w4hFow4`hFQShTFtD'w4hb&w4`hb Shpp <'wP4h~6wP4`h~PShrp tJ'w4hw4`hSh'w4how4`hQShFtD'w4h&w4`h Sho Cb]ÐULWVSE}E=\u!9=HlE 8`}}  h E xu7h5> E PGPh5> U zu hM APh5I> 9 U Ph5> F9|g h5=  hM At t<tt&0h6h*hhU BPh5}= 9 M Ph5Q= F9| h51=  h uU BPhM AQ PAPAPh5< uU BPhM AQ PAPAPh5<  9 U Ph5Y< F9| h+59<  hM A=t2=t)|=t,vh5"h;hA hE5;  hKE xuKhZ5|; 9U Phg5Q; F9|M APhk5); 9pU Phx5: F9|Gh|5: QM <w4dhU Phx5: M D1$%t# tIvtt&:h"hh h51: U D2 tPM D1@tPU |2}Ph59 M D1 tPh59 U D2Ph59 M |1u|1uFG99U Ph5Q9 F9|h519  h M AtPU BtPM AtPU BtPM At PhEPO }tEPh5~8 U BtPh5Y8 9M Ph#5-8 F9|wU BPhk58 9LM Phx57 F9|#h57 E xtexu hU BPh57 9M Ph5U7 F9| Hy H;u h+Ph15 7 9PU K$DpkxsFM <'w4Rh6M PRh=56 ;uhPhvhD5E6 F9}@E <uF9t0M |1u&ÐM   CB9}< uC9t|tڃ)PE Pj9}hI55 ރvs;u hP#hU Phx5}5 F9yhM5Y5 M Att E PGPha hkU BPBPh55 Vvha54 M At& t&vthnhr hx54 92U ttLt't2@~M vR؎ v4%trE <"tit1"JyB;B| Rj"q 1ۋU  Jy B;B| t 2RQ: "M PP5_3 F9 IyA;A|"}Qj"Փ kE 8'w4hM Phk52 9}%U Phx52 F9|݀}t1;uhPvh5u2 ;u P e[^_UWVShuV2 h u/Là jjVj@P賢Vuu uEEUvR^  4%t.UvRuw Ã4]UvR  4%t.UvRw  49t E9u}tFEG&>uE)?t +E1e[^_ÉU WVS}u1<811] ;t$3Wt|ԅuԉ];uމe[^_U}%UVSE EEEP[x ƃVEPh' ؃V ؍e[^ÉUVSux ƃEPV5à Vʙ 1~Ee[^ÉUUE =t5芙 ÉUVSu] ~Ph`\ FKe[^ÐUuu u ÍvUVS]1=@t @uASHC@;C4s 9t.vC4D9u C9u9Ct@@uu 5@ɜut @@1e[^ÍvUVSuM UFX$tOvt\ ǃ u%PhV'hj ǃ u!PhVthj^5 LvtSu qvthjhj5膁 ,t@@@@ v1e[^ÍvUSE] @@$P[ =tDwKt=w2t6Dnt/=t(6=,tw =t"=Xt =t X%1]ÍvUUtjhja 8vt@R8<u t6˙1ÍvU5@<%ÍvUM =@t @v=@t @PEE@H)1ÉUVSMA9u 9A=@t @0=@t@XvjQHA@;A4s vA4DP5@蹗tjjjj5@o SV5@舗j5@E%e[^ÍvUVSEU @X$t`cthj4ChjPjPtK IyA;A| vQj 草 hj襏1۾JyB;B| vRj= C~1۾ JyB;B| vRj  C~̋ IyA;A|  Qj ͈ 5} + v1e[^ÍvUj5@%ÐUSEU M]@@$trtt3v<%1[ÐU WVS]} uVCHP5@t1sHVWhjSze[^_ÉUE@@$t12} tj5D.k5@U%USE@X$@\}tGtjjhP uSu h%T 5{ ,t#Ph%T 5{ 1]ÐU$ UWVS,=,tS vE 0ÉSƃ h ǃu W3Wm C\C` uj3MjEPEPjjt t j vECHCDECVh@5! jn SVh`5 jP e[^ÐU塐@$ ǀÉU塐@$@U塐@$ǀÉU塐@$U WVS}u _$h荗 jh hdPj=jhÖ hPjujjh茖 uThPju7jhY u!hPjj7thdjjkuHhjjSu0hjj;uhjj#thjVq1e[^_ÉU,WVS}u EE]EP EVSWŒe[^_ÉUSEX$Pjj蘌Pjj腌 PjjoSjj\]ÍvUEǀXDǀ\ǀ`|ǀdǀhǀllǀpǀtǀxPǀ|ǀtǀ\ǀǀǀǀǀ@ǀǀǀ$ǀÉUS] uh5D tSh5) G0f Ph5 j^ U,WVSu }UBX$Eu @t(@tFTF H tF#v}F vtWEPEPEPjUR t }tuuEPF u1%PRSN@>tjjS%{ tC xtjpSd1e[^ÍvUlWVSu} j!Ãuh0EPSx}Sh7quEt}t'E %PS|}@t5Sh@%E$%PS|}tSh`jVC\1e[^_ÉUWVS]}t E11EPhht@jztu}} tlthQ t@S8;4t-;!`tX@S8;NEU;VjjSW BCM;vVUM;uBQ)‰@v1PMq1W ECU;s%vVjjSW CM;rދUM;tVB@PjSWx 1ۋG }tlE14t/UvRJ 4vUG@6t8VuE}tw$E1FPxFFe[^_USE1ۋ@@t_vBσwJ$B2 FLujjURVHFLENXEPjhj1}utP膉 F u0hFEutPjMQ2LDž|VEPDVUR.|M t+Ex t@ x|@1PURMyt?E HEPjQtjVURm M a}ukjFP@ ЃPFHPtPUR t:rt1M I'vDžxh`tPjURKxu/M u#E @u.Etjpetjjjj*URvjjjj*MQ0l EpU P PM 1E xtp8^ U BM y t&q fE p ^ U B FX@tvLkf~LtvL] FL~tFP@ЃV] |tE PMQE PURX[^_UWVSE xuU?/t?.u6/t .u*/u$MQW#a%UJvMQW`uE%DžUt@ыQ8 E֍ vV>taF>:t>uF9sWRhhP蚮  URQH`uDžt^@P&[ ƃujjEPC;@PRVT` U r[ M qE1[^_UWVS]CLCPEs tC @uvCLPS%(w{LuCLCPjj HP hS7 *dž t'CLPS'{LS BtBCLBCPHltd@S8<u dtSjCLEEPjjsLSZ! tCLCPXv}uCP;EvE}tCPCPPsLSvCPCTCLEUCPBjRj'S@e[^_ÍvU WVS}u uw_ GLCGPCKC{ s bths jWEs {Y C {}VWB09u CB4 CBWB09Cu B0 S{ts$Y SY G Fxt5P@Ѓt%}uhsjWEvVW'VW= FX uV~Lt%vL"athvLjWD~Pt%vP`thvPjWD~HtvH`b ~TtvTLb ~LtvL$X ~PtvPX VX 1e[^_ÉULWVSu}FV trWy uDžx DžUuRtIt@V8<u )t UEt@V8<t @t2EPWZunUt@PWjvEuEtEPW_Zt DžftSEuM@XtE;BE ;CrC{tCCXt VvKXju V,u jV6 ؃u jV t1jju Vute[^_ÍvU VSu^ujjV)vju VE EMAEEUEBCjRQs@Ѓ uu hjVAE ;CuCCXt VuKXju Vjju Ve[^ÐUSE] HujjPWZu1Ryt2t!P|@x@R)‰A9%$;YjjjSPX%]ÐUWVSu} ^ujjVͥv{t*KV|Fx@R)‰EEUBKjEPRsAЃt t%+vhjV@v3EECCEC ECt F|@;EwE1e[^_ÍvUu h ju0ÉU WVSuuF~?t8FX)v9t9{uEPE PSuF9uӃ}u 1EPE PVe[^_ÍvUS] CC C,C0C(C$jjhhjZ C t1hju:KX]US] {tCP@C{ts 1 CC C,C0C(C$1]UMQBXt11z,tALB,APB01ALB,APB0jQÍvU VSu^{ wj C PsV-tuCSE jC,PC@PȽ C(EMACEE@ SjPQsBЃ t C(C(C$1hhVe[^ÐU,WVSu}^CXt1IcX{,tjV#C,uDEPEPju Vn tH} tu V EE!EPEPju V* E;C vPC PsVڀCCjE PC@Pr uuCP] C(EMACEEUP SjPQsBЃt C(C(C$1hhVye[^_U VSu^CXt1{,tjVC,{ wjC PsVttCCju C@P~ C(EMACEE@SjPQsBЃ tC(C(C$1hWhVe[^ÐUhhW5NXF(EEEN(VjEPEPvB Ѓu]H9$,}tƒjCPE PP fX1EjCPEP+ uW GdlEjCPEP EPCPuW G\,EjCPEP賹 EPCPuWk uhGX;EE؉GXG`EjCPEPc EEЍUЋEBjREPW u. vfXe[^_ÍvUEEE;EvbPEPjURbEBE;CxvPCxPstMQanCtCtECxEUuUB X;tv;w@MQ]BvPEPE;w@MQBXPEPuPV uC;uu:F FUtmz$tg1ҋMA$8t B8u~@Rjh$]SPV Ѝt:F FU1ɋ]C @t6`EPh9SÃuSV u UB @t,EPhFRNÃuSV u t,F FMA@XtEPhWQEPhd]SÃuSV uUB @t;t,F FEPhsMQÃuSV> u ]t@S8<uGEt;t,F FEPhURCÃuSV u t:F FMEP]S}u,EPhSÃuSVo uvEPhEPÃU 1uPuM QSVJ Ѝt0=EPhUR[ÃM QSV  Ѝt  F+UU]Mt\ЋM;A8vRE9s$;/tvC;]s;/u)ڋMA89w;]u]C8)K K.K.K.)މuEPIUBuSjRЃ 1}tMAt];Xtu UEP e[^_U,WVSu j/VoÃtY{uShV t8uh= t&8t!PVhhSR] jjjjSa4 u=hoSj@DžjRPP‹B Ѓu utFP‹BЃ=tKhSjEPk3UBxht @hP@ЋUBPh1[^_ÉUExht @hP@ÍvUMU E$ Ph)QuovPh@Qa[vPh`QMGvPhQ93vPhQ%vPhQ vS vÉUWVS}] u=w%1C=w%1C=w%1tu{|uoEEESE1ɅtOtCyht=QhjEPEPqhB Ѕu$Extt@HUEDEt߰H؍e[^_UWVS}u >t;vR v4%tF>ù>u E zvE@v}t&1}tUBtM;Htu UvEPx 1E}u"URZ Ev1ۃ}tMYt Ut5EEE;Ev_PEPjURXt@ECvM;KxvQCxPstEPXtCtStUCxEU$p]}Ou D>w@MQBX PEPBC:t9rF>t9r9Ee[^_ÐU<WVSEEEEUMjjjj?EP  UjjjjRz  M jjjjQT  E`jjjj3P.  UdhH tRhhS_W ߰HEjPURk tDž$ h tRhhSV ߰HEjPUR tDž =t+BBB HEjPUR{ tDž 4 =t$BBfHEjPUR tDž=t"BBHEjPURtDžMhhhS)U ߰HEjPUR5tDž v=t"BBHEjPURtDž.y= tǾ 󥍽HEjPUR_tDž&h@hAhSS ߰HEjPURtDž'vhIh]hSS ߰HEjPURtDž+Zv=gtǾgfHEjPUR=tDž2vh} tRhhSR ߰HEjPURtDž4=tǾ󥤍HEjPURftDž5=t+BBB HEjPURtDž6=t-BBB fHEjPURmtDž9&v=t$BBfHEjPURtDž<hhhSP ߰HEjPURtDž>RvM t@Q8HEJѭu DžhhSO ߰HEjPURtDž0MARQ`ЃXw DžLw Dž4E t@MQ8 UHhhSN ߰HEjPURtDžIh1ۃ=h-uvGtt-ttvjjjSMQ j6v[Ut0@ыQ8 v[PjjSEP v[Ut0@ыQ8<u_v[<tSj[Ut0@ыQ8[Pj SEP! o vC?U :tghM 90t40SC HEjPURSuE M 9u1/E hh jUR[^_ÉUu jh >vhh jS&6jjjS >ǃltd@S8 dltd@S<; t= v;ht0ltd@S89 w9djjjjIS/ jjjjISH艃ltd@S8 dltd@S<; t9 v;ht,ltd@S89 w 4v9dv)HPjjjIS} HPjjjISg1e[^ÉUh@ ju|1Uuu1UW}Шt1h ju.}US]S衘 1]ÍvUUE8t  1ÐUS]@t􍃰PtP1]ÉUE 1ÍvUW}Шt1h juB}UE8ujjjju1ÍvUS]CURS`Ѓt}wuuu S1]ÐUS]CURS`Ѓt#EP=wuuu SZ1]ÐUS]CURS`Ѓt}vuuu S 1]ÐUVSMu t@Q8H9s:H9r. t@Q8Hu1[^ÐU,WVSE} u&UB E h@jӁvR  4%t.ӁvR24vڋMA@E E t 8Pu} uMwÍ@MQBXvPEPܕPh`jURpM YE8unEPUR:uσ}uQ,vssujMQ荤 uEE@\E 9u͋UB1M AtUE}uME@M0vssujUR .EMA\E 9uɋE@EPU2MQ -1jUEEPEPjuMQ{ 1}tEpt Ut=EEEC@;EvaPEPjUR+tEAvEC@;FxvPFxPvtMQ+DFtFtEFxEUu}t)Uz}tGtWuMQ( }{tssV s}tUB}t }O) v})1EM}t1}t {%UBP1MAE 9uVtWuV +EPEPuUR^MAX;EwEAXA`iE @ E+uu1}tUrtM;NtuKUUB;FxvPFxPvtMQZ*FtFtEFxEU0vUB;Ev PEPMQEP*EuuUrrV tMAWuPw Ex+EPURuMQ@uqUBX;Et5EBXB`*vssujMQݠ u:EE@\E 9u̓WVujUR讠 u MA\11}tUBtM;Htu U EPD ؍e[^_ÉU WVS}u Ehj5k ÃujjVEGGCC {C,CxCxC|uǃtɴ f}%t&SH)t&S )t"S(tMt|W ujjShujjVO~W SV~u; SVjuSVyqu E1Se[^_ÉU WVSuN t1>t6VB9u FB FBVB9Fu B VVrVit u3~$t-^$;t3" ;uv$ ~xtFxPgt t @t􍆰Pt tPWtY t? V?V* e[^_USUZKC 9t9tC9tavC9CtTK9u AC ABC9AuCQCCA9C uK CHKv1[ÍvU WVSu]ExLw4EPURum}uEt`jUR^PE t*u}tFU2:Fuy}tE0UujR E@UuPEPjjE>Fv:\u B9uBKBAKt9uB}tE)Uu}} Ut PEPEPEPSVEPbU@t U E1e[^_UwӋMAS< t%MvUB:Rw u )<~ N9w F)SWR 9u9)u} tAPMQ P? thjUR10} u ATtP [^_ÐU|WVSjj+EPHt vUt@ыQ84 EVҿuhuhVjUR\DžjhSk&hSʀǃsjGPjjMQ*n v ?WhStpjh%S%uYj S' ƃtEWhS̀t)jhS%uj S& u%hPjEP3vEPPԹt!8u􋅜P9BEPGPkPEPoPh xDž W􋕘R.uh+x􋍘Q1x[^_ÐU WVSjj+EPt vUt@ыQ8 E||RNuh|QjEPU RDžDžDžtDžxDžDžpvjhSo#S|PhEhpR jjpQ $ ǃjWjjEPk trMvDž DžWhS trjh%S"u[j S# ƃtGWhSt+jhSk"uj S# Ãu h`pRjMQEPP蒶t'8u􋅜P/vPP EPWxt;UxtpQ*xu!jjEPљxv􍅠Ptu0jjUR蔙xQ虱 xt HtV{ Sr Et􋕄Rb vWK 􋍘Qu􋅘Pqxu!hRjMQ tC~hjEP蟘9~hjMQ{jtPE PURLt8xQ] tPN 􋕄RP /MAxPPHTuU JHX@1X[^_ÍvU WVSjjEP( tZ,1t&S>PE P׹ |4)ƅuh PP Ãu1hEPju艛[^_ÐUVS]uE HPSVo t'j S tj)@RPV v1e[^ÍvUVSu V ÃuhujuEPV؍e[^ÐUSEPh-色th@h-ju螚-u h-hZhS SxÍvU WVS] }Et 9rn=s7u V VS蒮 Åujjuƕt)PjR诱 7 1e[^_U VSMU uEPEPEPRQst}%Bv}t7;]s2U)U vBEM}t E8 t8 tЃ}uH1e[^ÉUS]j/SCt@؋]ÐUVSuFP Ãujju赔tVu S 1e[^ÍvU WVS} u]SVWUz8u !vc8"uE8u v1e[^_ÉU WVS} u])SVWU8u 5v8"u&E8uU:u 1e[^_ÉU WVSE0~VtKss sVЃ;tCBSs T SK _luTtLJLJ Wt@%PjVQWVUV t!ujvLVV<t4@V8<u 4t@t@V8<u t@FTSj:FxPV: FTujjjVSiu,FTt hV誟V- jtjP襭 VxzuLJLJvBBLJVt TFTujjjVhu)FTtFThjVT|E01e[^_ÍvULWVSE@E܋UUM܋I|MăytA ]܉Au@t,ELP}W+uGPEtU@ Mċj3jȃQP u V}W9 EF1~%vUċB uMB /vSo  4%tuFNuEăx:u"vUJBB:tMăy"u4]Kt CC8 uuċF8 hFNVEăxtIvUċBvS視  4%t MAIuË]ă{uJtuu }t.EPb&U܋R|zMf}ytyuA8t ]ĀEPuV}WT}A~tDUċBvS躕  4%u:u MAIuE]ă{C8|8 PhT tsuCKz}ċ}EăxtCUċBvR  4%tMIAyuuċ^+]uh j}W&U$pM&EΊ:uAEE:t9lt9pt9+t9-t 9^t9#uk}ċG)ȉOG$&ljE@0"EMvRZ4uS}W'UĉB uSu}ăt!GEH@xt UċB9tMċA+EP]SQuVH3&}ā x%u E@(/Uāz (u MA(]ā{ (u uF(}ĀKE@ (UR( x`u#Mu@`YLCXdAPuĉFh}ĀEt@MQ8<u]tuĀN} }ĀEt2UċB @ u}t MċA 0h@j]S܈vuċF @ }uEE}ċGG ('t @'t (t  +|Eăx@8!uUBJJ}BBMăyv]ċCvR  4%tuNF~u}ăG8+wGOGEEȃUċBt tA[vwӋMAS<t#=uF:Rw.SV[u}ăvEOGG,vS  4%uE@EUJBzFMċA+]ȉ]؉Auā~ `%t~ 't ~ +un}ċ}vE@EUJBMăyBA\u*yv$x uEIAAuA 뭐 u}ā )t  ,EEăxvUċBvS  4%tEMIAyuuă~|!s~ )t }`}ăSG8 GEH@x2UċB8 u"Māy )ytC]ċCvR"  4%tuNF~u}ċGvR  4%u UċB8|u+}ă$)}G(Ԃ $G cUăztXBBJ]ă{t>uċF8\u~v FNv}ċG9uJEH@xtuEUăztB8 ȉM̋]ċ[]uă~}ċGt tAvwӋMAS<t#auF:RwRSVDXu@}ăv7G@E t|uCEUB EԋMIA] t|u ]ĀuN}G}EH@x,UċJAMJJ]ZBB)ʋE@)‰ЋuĉF~ (*uMt}?\uEHuUċw tV=MċA`: t/]C` tBEPuV>g}uCd}GLUĉBdMAL]ĉCduFP}ĉGhvE@`MċAlQpˉCdShuă~`t}ă`G`Exu Gl!vEălPURufM tyluAd ]CduFpFh}ċG`G`ExLuX tOEPURe5}uGlGd&vMAL]ĉClCdvuFL}ĉGlGdUBPMĉApAh)]C`CdShuĉFlVp}ă`6Eāx H%@`UJLAHdJL@t8@]S8 ȋu8}ĉGlUBPGpGhEPRd<}tUM;QLv Gl9vWl]C\C @ E8u>!u(}ăG8!GOO}Eăx.vUċBvRF  4%tMIAyu]ă{uF$}ăUvUċB<^t8<+t* <#t45v<-t )v]K\6uĀN}}O)EĀH}UJ)MĀI}]K)uNF~k}ăvUċB<.t,<+t2<-t<=t<<^t,}vMĀI| :v]ĀK|@.vuĀN}"v}ĀO|vE83>UĀJ|MIAyu#]ċC8+t8-t 8^t8#uj1uV }ċG=w%v1UċBBQBJJ|EMċA=w%v1u ];+luċF8+t 8-X}ċG8-uO|UċB8+uJ|j EPMqEP }u ];0 uċF})lj)FEFE8auFlVpMĉAdQhEAdHAl E]ĉCXuĀN|v}wwWEP'EPEPEPURMQ w }d }% }tu]SP` EuĉFT1v}ăt+ `%%PwwWEP% 9UrrRMQ]CKuċFEE~}ċGt tA_vwӋMAS<t#AuF:Rw2SVOu }ăvOGGUBU8vS˂  4%2MAM]KC{>E+EPuuV}W#~IUċBvSJ  4%tMIAyu]ă{CEE{vuċFt tA[vwӋ}GS<t#=UB:Rw.SRHNuMăyvIAA]u}OGEqE+EPuEPUR"NMqqQ]S'Eu>NЉE~ou }$UB$;EvM9w@]SBXuP}WKPUċB 0hjMQx E];uă~tI}ċGGvS_  4%tEHu‹UăzuhMQt!]ċC phjuV@xav}ċG`lu2uyEu udjjUr MQ ]sluV \u7C|u jjjVEP}Wh\EUĉBlMăydu3uR]u u=jjuv }WEpdUR~[ujjjMQU]uu@}}G`tNUBLlt ;Glu ~twMċQlu]SLCP؃PPRSFuFL}ădt ;Gdu 6t/EċPduMQLAPȃPPRQ]ċCCCCut/}GLEUGPBjRj'WPt6Et@,Uztu R]Mf}Q]{t>t5uTu)u y H%uj}WU܋|ЃMĀ]ċC SuV@Ѓu+FTujjjVLu-FTt!}TVEGUt RyMy]ă{\} C\9ALwjhjQtuFLЋ};G\s jjjVUċB\MALPQXuh@j]S|tvuċF\}GLExxLUĀz|}fb|Mtfa|]C|%6uLuu@t@V8<u v}tE@tt&UBLEE@QPPMQR[{ }]tu؋}Ȁ|7tZgvE؋UȀ|wT]CS<t0=uV}؋MȊD9:Rw$PVGu]KCCuċF+E؉F}~WURPh @MċAAAA]11ۋuF@|aUBPwH$ uDhjMQvu(hjuVhr v胍 vEċEąu/'UhuvhijMQr5vh]sjuV2vjjj}W PjjEP UăzzMċAAtt>PwӋuFS<t#5}G:Rw&SWEuEăxv H@v t|uUăzvB MIl]ă{uE܃耋u9F|thj}WqWe jEPhNth@jURpEEMǁ]Ee[^_ÍvUWVSu] EC`{C2'$t~ ClPVT{l%CdCpChC`15~tPC`t5t @t8FLCdFPChC`"vClSpCdShFLClFPCpC`C8;u9C`tt )t!胊 vCdFLCh ClFLCpFPCKEPEPEPSVz E8Y}tqC`t)t Qt3IEUCdShC`3vEUClSpC`vClSpCdShEUClSp1C` tvtgFLCdFPChC`jvjjjV wjjjV gjjjV WYjjjV ?ClSpCdShFLClFPCpC`{`u!Cl;Cdsh@jVmE1e[^_UWVS] EUMyu:CPh@tjjjEP UC8$ME@PURQCMj EPsEPƒtRj]EMACU)‰)CECM{uhTjEP_ljMQC@PEPaiCC{vCx/t)x?t#hnjMQlECKC8/uxMALMMAPMAptpPEPssEPPMQ҃ uCU)‰)CECMEUBPMAzLu-QROt E8t UBLM{vaC@=w%v1t8C+6CvR}r  4%t CK{u1{C=w%v1uC8+t8-t 8^E8uUBLMBPA{CvRq  4%tCKuʃ{TC=w%1uC8+t8-t 8^C=w%1uBC@=w%1uC8+uFvNKCC8-t8^uCK1j EPsEPƒuC}}}4);E(!~}~);Ert Rj\vt+uvuCM))CECaE8tEtA}؋U;v/hSU9sjjjMQ=U21e[^_ÐU WVSEPUvEp|9u'UTv F=~3FP^tFBVV~ FHFVL RQP= FLFCUBLFDCFP t1e[^_ÐU WVSExvCPtVKƉ91uAC@AB9quC<QQP~ K<9uƃsH;~ ;tCBCS~ _|9sG|@1e[^_ÍvU WVS}1ۅt_t Ut.1EE@;EvMPEPjWs1E@;CxvPCxPstWMt_CtstCxEUE0Pu VÁ hVjWui 1tGt;ptu U vV#} e[^_ÍvUS1ۃu u]t=8&t=`+u؋]ÍvUSUE |!t1H1ۃPRt =x+؉؋]ÐUWVSH%=H%t0U:%M:uΉ׋M u ;u1[^_ÐUS]U MEt4rtt&jj}vhnhb{uj1tPSgwb$h .EPSsHu;}t uh@hjSc~ v2hjSuc]U WVSU Bxu5jjEPѶh`jUR/ctF~ U BtPTvRj  4%u*U BtP|_thjEPUvU Bt;t9vRXj v4%C;uȋU BtxpEvRi  4%u;_uE1SvRi  4%u{_u9}u^CNzjjE PtBpB0p0jjUR`u7UBT1+vhvh jURaae[^_UVSuE @tFTtjs3VHth` 3jVNev1e[^ÍvUju u2Uju uUju uUWVSUE@E]{ujU B 0Smv] {dExLBwtOuHU zdt?jփlVӃdSjEP !jVSUR  ] {S[vօt > tFKu9uuIEt)Ѓu:.u Ft`KS)PRWGjUR@ t"FKujh WGjEP@ uhstU rE XUEjPU􋂠Ѓt#j] C 0EPbvU4th Rljh ]SmPSl h SlSm E @}u5U t@ӋS8<uEtU<t4@ӋS8<uE4t@EE@E@QjPUR5]$ssWGjEP? E9u֋UzLujRAt ]CL1e[^_ÐU WVSE xxu&Uz(t B(xuh!jM'E thxxuJMQ(zHPrU RMQiE PUR<M QEPvjU B|%%PMQ*E xxU u6z$t0Z$;t3t ;uMq$t E@(jU Bx@P MA$ujjQ9\vEX$U rt&p0MQ#tŃxuUB$B(0Rt1ۋM3UB(pRjM@tH  M A}t$RjPEP-tUB(M1e[^_ÍvUVS]u EPSst juSuHFt0u ƒt F}$%PjRuKt jucu1jVS‹EP$P(EEC1e[^ÐU WVS]u C(;C$uh!!jSEZt3S(zHPrVSWupVS9ijF|%%PS*'uCC(pS t- F}t$RjPS3uC(1e[^_ÍvUVS]u {$uh@!jSlYjjF|%%PS&uGC$C(0SR t/ F}t$RjPS u1ve[^UWVSu~$uh`!jVXEEE^$;v;HM;^(uUF8H9ErUEh|!}tEh~!V1fE!;^(u!P3!;^(u!Ph!VeF Tu+jjjVh/u FTu ;5h|!Ve1e[^_ÐU WVS] tCxj@P EujjEPWut4u4}HPEPEPqt:1=[t'vp0EPCtփxuEe[^_ÍvUVSEu C$jPf CFtC$Fx1e[^ÐU WVSE}uVP. S$CVW0s S$CS$CpC$CU BtC$Bx1e[^_ÉUWVS}1ۅt_t Ut:EE}w[hEPuWݿE9{xwhCxPstW豿tuCtCtECxEUEuEPEPEPuuuE PW0t91҅tWtE;Btu Uvuqm v}tX]u9s5vR\ v4%tC9r9tuuE PW51҅tWtE;Btu U ul 1e[^_ÍvUWVS}1ۅt_t Ut6EE}wahEPuWIt(EC{xw&hCxPstW!u yCtCtECxEU!E!EP]EjEPEPEPSuuE PW0jj4Wpzijj5WXzQ|tt@W8tE];tcvvR [ v4%u2vRZ  4%uC;uEXuxt&NCPEPt~vRZ v4%uCvRRZ  4%uPEP&uCNutt0]EuSF;*uEPE PW 2EPEPEPWF tuuE PW<Ã1҅tWtE;Btu U ui ؍e[^_ÍvUWVS}EEUvSAY  4%tEOu̅UuEME t tAKvwӋMAS<t#-UB:RwSRX%u vEO+vSX  4%u EEOeMQEP1MQ$AMHMA}tgvE t>tGF>wMAS<t+*EP:RwPUR$uFFCMuMA$oUBM AtB$Ax1e[^_ÍvU,WVS]E 0U$EEE}kU<# lu8EPVB#t }uGlGdSE0EPGlPGdPWV/!UVL tFPFPPRV脨 vEFPuh$VK1e[^_ÉU WVS] UB@Xt)C}u#B @8/th`$jR=vCxt thvh$W ub&]PtƒtztB8uh$jMQ>=hRCt ?X vP]u 1+v{xCt:/xu :.xv!8.ux.ux/xUHt@@ыQ8 E@vF>t>:uF9sjQRh$hWx W\u/hW h$WjEP5@V>xh%RjMQ @[^_ÐU WVS}8u!E PW(t  v8U Btp~4vRC v4%@tNC̅]~7vvRB v4%@uNC̀;t;0vRB v4%@tC;ũEPuh@FjW:SU RW@Ѝe[^_ÉUWVSuh_F[T E }ЍX1t~t Ut/EE;]vVSEPjVףt"E=v;_xv"SGxPwtV赣u GtWtUGxEUCPEPURV EE8tPU RVQhkFEPu1tFtU;Ptu U EPTQ 1e[^_ÉU|WVSuEU ZxHPVRUR7E 9Xxuh6FURCU 9BxtjVEPZU Bt0EPVTtVjEPz8fE%f=@uVhoFVhzFhW臢 EPWCTtWjUR!8 DžoF!j/VUt ЍX7PjǃujjUR7G4G_ SVPT EGWEP ujRWEP.uOBtBxxGWURtjWEP1W#O x[^_ÍvUlWVS} hFwhzFhS  EPSR uЃFPM G,ujjEP63vjjP;Ã|Vw,SX 9t0hFPjEPu:SMX S?X G,1ҋG,8tv8:uxtB@8ujBPG(tnÃhFw,vhFjXfu1Zw+G,jj‰W(t G,1,tw,kM G,[^_U$SDžBRr|Pr}hFjEP/]U Bt;vhFjMQ4tV xtpV tV xt pmV vjQjsQ jsQV V EPU rhFhS0jShFhFhF hFSjMQ7jpNU U PM Q$ hFppU B BhFpM A1U,WVSE~uhFjP2vEE96urj jEÃXUZ j,jEHMAUZ9Y uQ MAUPEMAAEPuUR9ǃMI ME@LEURPUEy}M ЉUE^trv MGPuhGs s I4 EPWSEP_t(}tURI WMQl]u}uhGjEPp11IGGU B|%%t,PwMQE@EPwUR96u%M1q9vuN vUPMEw9vu~x>wWUR) }t/MQMA BEPALB MQMAPBUBMHBUP MAUP}tMQNH }t EP9H e[^_U WVSu ]JvR7 v4%tFύv> VvRr7  4%E!G=!Gt'!G:tvEE8t:uU:uQh!G>w@MQBXvPEP@Ph@GjUR /vNM~tAEvR6  4%t EU:uNjM9uhFEP51U:"zzu}RvR16  4%t2MQvRF"4 vEPMA@t8Put@PUxv}ЍxG#PjÃujjUR-tBCCC SSCB OKCWURPI CD8K1e[^_ÉU<WVS8j VtVE phGjUR- M qhVPPhkGVpVuvE phV>j V\uCvU BHyrjvM A5 u+1\vtS t Kvt+AװHvRŧF!hGP:uzmϰЍXPPPRM QEP uG u Dž1ۃD0Pj1ǃG(Gt+PDG W/BGRRP G GOt#WBW _$CPPRF UMA G9QuyUB 8My EBU RMQ1ZjjEP)AU B@ t gM qhFjEP-jU RMQ[^_ÐUlWVSuE x(?trUR7hzFhS蛓 EPSWEu4U?HEU ;B%U?u[^_ÍvUuuÉU WVS}u tQ>tLVÃuVhGW6fs3hGW6s hGW5AhGW5C=Ct!s3jhGW5 ;u1e[^_ÉUS]uTOPjS]ÉUVSu] Uu9~Yv@t9uuRh HjV'{ts h{ ts gjEPs;tCBS{,ts,c? {(ts(O? SC? 1e[^ÉU WVSu} {th?HWVt1e[^_ÉU WVS}xuhAHW64+XtssVhYHW4 Fu1e[^_ÍvUWVS]} u~ u(vS u wj@vFEWEE@jjv$v PPSBm twjS2u ǃUSLCPCPPRS:1e[^_U WVS]߰ЍpC=Ct#vV7Su ?u1e[^_ÉUVSu] CHysc Ct >uЃujSVl>CHys\c>uC9u CHys*c bC9N1e[^ÐUVSu] ~ujC 0V$ejClPCdP1C|tCQPV1 ujClPCdPVuCdFLEPVuFL;EvEFL1e[^ÐU WVS]U BtctV btstktBtx0HHSBtx wm0HHu\SgBtxwE0HHu4S9?Btxw0IHu SGj B pS賭e[^_ÉUVSuF@u! uh IjV"!vF@tyvC=w%v1uJC9CtjSVFTjjjVuFTuF@toC=w%v1tBC9CtjSVZFTuAjjjVCu FTu"uF th)ISV 1e[^ÐU WVSEIU Bt8IPEu7M ywA@MQBXU BPMQ`PhWIEP.U z_wNtw;w@MQBXvPEPPUR.MATuLjjjQ!uUBTu*CshhIMQl.?E 9Ye[^_ÐU WVS}U Bxt tA_ t{}jWNÃ1ENU Bt0WÃ1EU Bt0W v: vE t VSPWgZU B|%%PWu2E%U B}t PjSWu1ve[^_ÍvUVS]uEPSs`t juS"u6}uEE @}$%PjVuat\juyubevUCBE@Ep EP C @fBUCLBLUCPBPvjS‹EP$P(EC1e[^ÍvUS]E {uj@ 0Sը?tEPSt @dEuhISa+1]ÉU WVSuU ~ujB 0VcBxt}up^ Btr0V褈ǃu`{|sV~sl5 {c?KFjV rVЃ S8 vjvLVz$1e[^_U0VSEMQMQ9ujj4EPCt FEEEUBE} tR2Z} hjJuEPZ}hjJjMQWhoJuYEuhqJjEP,/EƃtvhxJjUR }tu> Extp> }tMQ5\v}tu= Exp= v}tjuA9j]s.9js!9 }tuq= ExtpZ= uL= uA= j/Epth@MQ8 UhP-u.Mpth@Q8Uh@jMQh~JPEpth@MQ8 UhPَ hJMpth@Q8 UhPjMQcj5}tu3< u%< E Hwy} uu< jEPEPURhJMQ- tEEUB\} M9u EUEMvUBHXqWÃt tBhJjMQEub; uT; ESu9; hJuV u j3jjjURMQPhJEP,P3u: } u URMQ,t?E6jEPEPURhJMQ}, tEEUB\jjhJSMQD tE}uH} uBjEPURjMQ ujEPURMQdt E"E8v0UR uM UB`X1ۃj1} uM%PEPVURCu}t؍e[^U WVS]u jjuw,SI u@EPVSu+CTujjjSuCTtF @thJjSVPW1e[^_ÉUU B}PRuÐUju uUu^EujjPavU@uojPjjRb tE뻃jEPEPEP)PVMQIb uEǀUBLEUMAPBjRj'QMhjƃujjEPOFtFBVvZ+ VQ+ 7EPURaEEdEPEPjWMQ EEEEEjEPjuEPƒ t t}%}EPRURi^@;]tG9C uC Zjj茾ÃujjMQ;{ {EЉF@CU9Vt1uuJ|UWVSjjhKEPEPo v!uhKURMA@|xt Q}EhK( ƃt1jjHPVhKUR hK;( ƃt2jjHPVhKUR hK' ƃ>hKVhKh@Sw jjSEPMQ2 ttrtOkhKVhKh@Sw jjSEPEP u+SURv@PMQMUB@|xt R>|MEt@MQ8<uEjjhK@PUR4 r tMjjhK@PMQ u\@;Eu D;EtFhKEP"@;Eu D;Et"hKUR9t vMA@|xt Q${1([^_ÍvUWVSu dPjjjjj6lSݓ HPVEPS)SEPÃu>0W" jhOSEP VC @jhOSEPUurC @uljhOSEPUuTC @uNSEP.u:C @u4S_@t >0.vhOEPjEP13=0S$@=0hOEPjEPe[^_ÐULWVSuE~ujU B 0V U BdRhẺUЋU BlRpEĉUȍ}1EEE];]w }䐃WjjSVA u:C;]vMU BTE܍UBjEPRjEPV: t Ev]+]]ԉ^LFPEP艪Ee[^_ÉUtJC4Ev4vEPHE4F4 uEG>u}t EP e[^_ÍvUSM4t"A4S4RjQǃ41]ÉUS]M {ujA 0S{GvCLEUCPBjRAdP1A|tAQPjSK,uECLECP1v]ÉUVSuE @|%؃SV褾uSVGztt1e[^ÉUWVSu} FEGxt trEovGt@E;!uFCHEEdt\@V8<u .\t#j G E v v~u,jVۢjjPV)}}WxUjEPSWV hU;Wxuj G pJGxHE{ts> GtU0PCujj}t' t_GtU0hRVqXAv tGtU0hRV&hRV~Vut-jVUЃtjG KjGtU0EPjGdPWV @UVLtFPFPPRVZX1vF @EEPSWV Gx~ tv vOtQEF @%f=u[rA0VXÃtF pg F XF `?F H VjF pVЃ0URV+jGt0VwhREPÃtEPCPthRURjV뱍vE%f=t&f=t S,hRjV{|jCPjjVܻ uEPhRjVGjEPGdPSURV4tGdFL}tFL EGdFLЍh[^_ÉU,WVS]ESUUEES0MAQ9uYCTjjjSu CTup}u$uPWSUh1uEp,VjSm UUFEEPEPSsDUB @RZ+uw}tUE}u_EPE PSǃUREPWh SjS0}t*1tCt;xtu UvW 1%hRU RjSEP* }ujjSUhЉe[^_UuOÐUVS]E Vxxt @t1PEPS诤tt EC1e[^ÉUMU B|% t t t%1 j B pQ t PrXQ;ÐUWVSuFEX9uhSjVvEEErC xHMUF8H9ErUEhS}tEhSVC pVwEE9t3FTu`jjjVտbFTRFTu-jjjV袿u FTuhSV1e[^_ÍvUS]E uh TjS(xxtPSduSu1]ÉUVSujj4V@UhÃujjVf-C CCCC\Pj uhTTvc`cdCTPhht@ju hTTSvCTPC\PCPCPCP` u h^T"$t tLKvhbTjV{ts {;s +vjhgThmTjhrThyTp jhThTYjhat s s  js jsjs s pth@V8hj/Sau@jhTPSYhTSjV jBV'uFT 1e[^UWVShSȑpDžxxFUlB VjjSlA@PS t.u)hTjEPhTjURp)¸)ЃPpQlp tu&hTjURmvhTWvp;p;wMAS-vEP:RwPURv1t uFtPMQI+)PWtjEP {C;p]9vp)SWVȈމp9pDžxx@PjjPlB@P t.t%WhTjMQQp)ÉptPEP=u#SpRtjMQ tEP SPURX[^_ÐU l{C9s9)dtPRWMQt tDžllFh]SOhB VjjShA@P 0u-dPW\RҀ\d>dQWEPt vdRW||jMQ uD|UBLdtdIJP E@PjURU`1}tMAt\;Ptu U\Qm`H[^_U WVS}u{ ts 6FP'C ujjW{ tVu s |sC 1We[^_ÉUWVSE} uX9rPH tMtA9u)t;vAKt49tt+t'GNt :utGA8uNKt ut1}tE0[^_ÍvUVSutpVk{ts#{tsjjhT3V( s Sdž1e[^ÉUUJQA9tt T 9u怡TÐUWVShT,Et@EET=T3UT=TpjjhQ`ƃu8tEPyPhhh hHjjh_à tYU2E }thUR}tEPjS}tURhgtS16V?G?EE8e[^_ÍvUMU zxtB prtQ4tjQ1ÐUVSujj4V1t pth@V8 vhPhUhSw@FjjVЃ 􋆬4PjSu V/à VjF pVЀ؍[^UVSuEXjj4Pbt UtXjRЃt#jE @ 0MQ`vjjEP\ЋU}thUMQ t!VEPhUUR MQet t(vhUjEPvj/Upth@ыQ8 UhPPu.Mpth@Q8Uh@jMQhUPEpth@MQ8 UhPH hUMpth@Q8 UhPjMQ jjjURPMQe[^UWVSu ]v8jEPVtЋE}t C; t; tEPSEPƉЍXU}}UPEP`PUvUPV؃vPhUjUR } 1}tUBt;ptuUVEE}C; t; tEPSEP,ƉЍXEPUvUPV؃vPhUjUR0}tA1}tUBt;ptu U!VhUjEP1e[^_ÉUM1ҸU9u@#vBvQhXj(h@;@ÉUju uUju uULWVS}ujU B 0W[t@W8<u" uh`YjWTjE lPE dPjWmv uM AtEE/t@W8U ]EE8>t̀88"uEu h(Zuh;ZvjjVGU BlBdDBlPVE lPVUDžtvDž<<@<@TADž3Dž'@EEE8Bu utj U B pt3t*uu thZrDžDžDž DžDž4DžDžM IdE @l 8PEPjRV  O1ۅt^t Ut<DžDž449884Pj8;CxvPCxPstV?*CtKtQ1ۅt^t ;CtuLU8;CxvPCxPstV){CtStCx4U7v8;4v&P4PQV),8uPUDž8DžDžDžDžDžDžDDžHLDžPQDPj EPEP <  DžD HL PDžL@; vk=s u x ujjV2> E  O$ȉ,,DB$LH8u@B$B;8r 8HB,B;8r 8IJ,FL0FPjV7 jjhZVPV&jjEPVf  Er EPV菙vj$P,PE PVc d$P,PVUBhjt<~tvvPtH@V8<iHZPtH@V8<u HutlPtH@V8<u MHtD7PtH@V8<u Hu AGMuErvU1ۅt^t Ut-EE;MvTQEPjVt E;;Kxv"QCxPstVu CtCtECxEUU :EE]<[z<*p<.hv<\t<~|v}MG<t6<~t8,v\\ \\BfCBCPtH@V8<uHtx~vPtH@V8<H\PtH@V8<u ,Ht#S=v~4vPtH@V8<u Hu\CCGM@EU )ËU1e[^_ÍvUWVSUEM91ۅtZt Ut0EE?;EvXPEPjR1t#E??;Cxv#PCxPstRu CtCtECxEUU ut&|;/t|;?uOt|;$u OE Et ;/t;?uCO;^u^CFOt?;\u{/t{?uCOvPh\K3t\FCFOuÃ}t$FEM )ƋU21e[^_UWVSM1ҋE E]]tE8 uBEMuE]E +B@ҍ\Z]1ۅtYt Ut2EEU;UvZREPjQt%EAvE;Cxv#PCxPstQvu CtStUCxEUM M]^G\󥤋]EEtPU: u߾\󥤃*vUPh\1t\CMCEMu߾\󥤃$CUE )ӋM1e[^_ÐU WVS}jh\WE P#&ƃV谿à ujjEP胨*VSWE P%Sh\jEPc Ske[^_ÍvU,WVSEEUUM ME]ЉE싃HEvF&t \tBUPtH@ӋS8<uyEHb}MAڃO$ ]FUPtH@ӋS8<mEHY1F]<u |5]|u | M|)U UlEvUB:RwPR+{}}t$w}t#v}tj}tkvEӁvRA 4%ӁvRVf4VEӁvR 4%t6ӁvR 4 vvE@;Evc=sE}uMQ込EPURLEujjMQ~}JEEEUBUEE\vFEvFEvFEvFEvFEsvFˀwӋMAS"UB:RwPRy1t M;uuP葻vUPMujjQ@EuǀMM E}}t$w}t#v}tj}tkvEӁvRm 4%ӁvR肗f4VEӁvR 4%t6ӁvR4 v+vE@;Evc=sE}uURMQEPxEujjUR誢}vMMME@EEm~MU E]MU 1e[^_UWVSudPjjjjj:lSU* } HPE PEPS*SV?u1H[^_UUE PRÐU,WVSuU Bx{ts蚹U Bt0譗CujjVZt@V8 vtJCEǰH9v/E&{uh^jV vt@V8<u 4t+U %PsVlEu (sVE EE9uxj jLEǃxEx j,jdLEUBUzE9x uP vUBUPUEPP~ FLEVPUEt}E uEU B|%%t'PEpVvPUrVh9u%EX9[uC vUPEUUZ9[uS vUPEpUBp$Bp V }t)EPF BEPFLB EPFPB!vUBxBUP UBUP1>}tEP螶}tUR艶EPV e[^_U WVS}9ujjW yC0C9uh^jWVE @|%%PVWt +sCtVSWHwsv$v W 1e[^_ÍvU WVS}9ujjWo xCpC9uh_jWcUE @|%%PVWDt +sCtVSWvsv$v W 1e[^_ÍvUVS]u ~uvSOFtNF;C u1GjuSiu+j jvS"Qu1e[^UVS]u ~uvStOFtwEPSsu`juSARtjEpu3Z+F;C t4ujPuvPtJjuUu#jUCBE@UFB EP C @fBFpjSC‹EP$P(EEEC1e[^ÍvUWVSE96ujjP%MvU Bxt t 6u U BtEj EPEPռ‹E8uD9t J9u URh@_jEP谚]}Ѝx9tQ;t>C@@Ej/uuEv@WPUR!t ]9u9uh_EPjURY4;u 1*/vU B|%%PEPURVe[^_ÉUM9t%E @|%%PBpQjjQU WVSuU XC;F uC FLCFPTjuVfu-SC BSCBF Hj jsVMt 5vSVHu;] u98u PV,1e[^_ÉUWVSEE9ujjURMy8"wh_jQ苘EE0<v^!;^uURh_MQ h_EP軥{u SU C@E}ҍJvMDPjjh_EPURjjh_MQS 9^uh_EP:;^uY~tSMQ8BvE~ЍHB9vvQ`9^u_Ph`URܤ h `MQȤF9E6UBTu+jjjRnuMATu ;u1e[^_ÍvUWVSEEE U29EPVE P$^mvEPSU R9^u UEBEUUE@ BUB9BuEB EP EEUP F9uE8UGB9?u E WEEG6;u7EXt?EPSU RouTEUG BW EEG u‹Ext-pڋGujjU R脕1e[^_ÉU WVSjqÃt,ߋu E puCtE1jjue[^_U WVS} tw!VÃujjuΔ1vVWS5CCC CtCCE1e[^_ÉU WVSu ,~t~-~ tF$|8WmÃujjuA0WVS詰~tC(C~ t FC@C E1e[^_ÉUSE] ;t CBCB SsثSϫ1]U WVSE] KC9t?ƍv91uAC AB9quCQQtK9uƃ;t(9;u CG CB9{uSS41e[^_ÉUUE Mtr t!/vh `hZ`jRܒh`QjRvÉUWVSEESUREXuu u>t1vR/ 4%+}jJÃujjURvGPCujjEP{uSKWURs<CCUB CB Z FE>tF1e[^_ÉUVSuPV9uvPVFCu{t s?1e[^ÉUWVSu} U=w%1t.W!EuVu EPjfE]ChjRWSSV tHj(W t)hjRWSSV tEPjV<1u džUVLFPFPPRV1e[^_U WVS} u];vvR蠗v4%@uC;ù;wC;jvRTv4%@tC;ù;+; vR v4%@uC;ù;C;vRv4%@tC;ù;E;vRtv4%@uC;ù;tO?t;t*E8tS艵~ 1e[^_ÉUWVS} Ӎ{C Pj::ƃ FFF FF~SU RPQE P`}t`Ph`hS0h`SReYװЀ| uװDR  u鍅PPPPҋЍD,Pj 9ÃC(CPHCC@C P輰VF C 9Vu^F ^ RhPnP#fF9Fu,h`U RjuMVH뺋FF1[^_ÍvU WVSEE} ӍsC Pj7ǃGGG GGwSU RP1EXt/U RWSEPtKvcuҍG9Gujh`U RjEPZtCUZt9Ct,Cu&‹C h`sjEPKuȃWߢ GG1e[^_ÉUWVSjjE pE}U B EPMQ<u'jjEPjjuj茧t u&MU B MQAFvtEЉEPtRMQxEPxRMQCx xEU9s8 tvEM9MsE8 uE9EeE8 Y]CxUx12vtt #|p߰HEFh`EPÃuu(}t"tuЍXEPURMQŘEEPE pUR謘à Suh`jMQ蘈 }t11҃}tEPtE;Btu Uuu}1}tUBt;Xtu UuS;cv|QEPmEPEPpRM QEP# EED0Pj3ǃG(G}tuuPWE/EEUBGRpRPEEGG@G _$SRVPϣUMA G 9Quy UB 8My euЋtPJth`jURMQ th`jEPˆ1X[^_ÉUlWVS]E;/uVS蚢tqj/U rǃtXSE ph`hS/ VSGu!U BUǰHU[^_ÍvU WVS} u)89sGC< u>vVSEPuމ)89sC< u9ue[^_ÍvU WVS}] u9s5VSW5utv9s C< u9r1e[^_ÍvUSEU ]: t: }B;@B8t9s : t: uӀ8u19s: t: tv[UlWVS}EE 9t*9u{ wU R0 C@vj jjEP/ÃU S9RuZU XE UBL@CRUTt"\SCt%@SjjEpLP莔 kWURSEPlEjjEPUR'[4EH w$HaEEPEPH`C@;C vPC PsUR:CEe$taER t{tSC|\3tSSB9SuJC|.u@E 9u CU CBE 9CuU SS.+vj jjEP-ƃSBVt^}u3VučEPjEP uc VsSjURђ EWEPVURE U BC9u U BE XC;CEC;CE1;ss9CvR4v4%tF;sr;su;CCUC@ JRj Ǝ8{.}t}tpvC@9CEECvPEPjUR'Essu CEEEC@9CEjEPU|CC1C;CdSEP_ 7vjURU|WEPSUR} @t>UvR臇 4%t} t }KSE CEve[^_ÍvU WVS]} u@tuhaZt?t@S8<uvtwhasZtwwhaUZ5De[^_U WVSEt@MQ8 EUt@ыQ8< E11ɋU ;rs)BEU< u1)FAE ;HrN1)119w1)G1)9v)ˍD;U ;B v%PЃ PrMQuMU B;M AAtM QA AOutE P@ U BKu1e[^_UVSuFLEUFPBjRj'V{uQ^{X| KXC4C4t$rFuIEPV,kuC4/vEPVgt"C4 vvEFLEFP1e[^ÍvUS]h`bS蘊hbS芊 hbSyh cSk hYcSZ1]ÍvU,WVSU BxdBtEvR 4%tBEUvRoƒv4M EH%=H%tAE0=H%Ht;t"U2;Ju;t }t\C uV}t4MvR7ƒ 4ME0phocUR誈IsshcMQ萈+t++u ++sshcEPOH%H%uckC tbE[vRhv4EEE]PUpMt vFAuu3sVj hcUR談 ;tDMATu5jjjQuQ>UBT+ v1e[^_ÉUVSuU Bx3Btxtj B pVBBt~a[t]uBt@9uH~u3 t@V8<uvt0 @lxuFTu2jjjVvO{FTk v1e[^ÍvUWVSuU] 1!E <@Q(zt5A,A0Bzt 8u+A(HPh'djQv1UVS]sjSЃt sjjS\ t@S8 vC4`tX@S8XC81e[^UUE M $8gPhAdjh`dPjRZyrPhdRPhdJu h e}1vE xdw‹Bl@PVkSuME xxtatN;>uI{>uCM;t7vvRvv4%tC;űU zxt;uEPj߰HPSU RVU Bx~ tv菉vE HtQ:F @%f=u[rA0VRÃtF p3F XF `?F H VjF pVЃ$WV<jSV|URWE lPE dPV-e[^_UWVS}EMURU0 M}tE UEEEh};uvMAQ9upUBTjjjRjDuUBT}$u1}uPEPURUhEEPEPjVEPK Wuju;EE OxوvWj y uEFE;uWnuQEPGPu"E%f=uGPuWJu13vUB@Xuhhu jRoW}$ujjEPUhЃ}tUE UE؍h[^_ÐUMU yujB 0Q"vjBlPBdP1B|tBQPQÍvUWVS}u ujF 0W'F|t^X(ltd@W8 vdKEEFdEF|%%@t~t' tRM==B1E9Ev U)‰@FdFdFd!v9]v E)@FdFdEEK9]v E)؉Fd vFd]^lGLEUGPBjRj'WgEK9]v U)ډVd vFdEHFlVWqhiWSwUUVdVlVWp chiW$wE@FdEHFl%vtEEEFdEHFl}t&EPWMFl;EvEFlVWHp}tUWL1e[^_ÉUhjjuhÐUhjjuxhÐUVSu] EPC PCP3VF t }thjjV.h@v{ ts s`tCCCCSC1e[^US] Ct$vC PEPj3uF t CwvEC{ ts P贖tCCHCCCC0C H9Cu CCCSC v3v1]ÐUVSu] {ujSvLRnIISVu{u/SvR`nv4%u1e[^ÐUVSu] SV~t@{t{t܃{u,SvRm 4%u1e[^ÐUS] {C$j;t~C PCPj 3uD tv{ ts stCCXCC HCSC?v{u;u C(CvKCSC v_v1]ÐUVSu] SV t@{t{t܃{u,SvRl 4%u1e[^ÐU,WVSE@E @1tPU}@t}*u(Mf|jjQEEUUvRl 4%t.UvR)X 4vUMA@vt 8SuuIj}wE@MQBXEPEP5PURRMEs C9tNCu9>tjjhCkjUR7 ujvvjMQ7 uv9uE @1t-phEkj]S\jPSjUR7\1e[^_UUM AwN$kR8QR,QR* QR&QR}vÉUVS]U BwZ$kvSVRS:RS*RS6RS }vЍe[^ÍvUVSu] SVDt1K@{,t C,@ u C t}u|}uVWdEHC8EC1tSM9Mv E9u9MtJuE)HC@CuGEtEPV,u!U RV0u }u1v Ve[^_ÍvUVS]u jEPjsLS&4tCLCPCP;Er}tEH1CPCLFDCPFHf0N0 1e[^ÍvUVSu^{uVu5EPVSu juV% tuGoUC@BE@UC@ B EP F @fBELPum9ExLu@LvEEF1e[^ÉUS]EPEPjsLS`3 t{LujjS@}t*jjuujSHu!CC1hjST]ÉU WVS]} CxuSguSCPC;Bu1FsC@@CEPSX8uwwujS4sse[^_U WVSu^jVnǃtDCPVSu/jjWsuC@`X1sQe[^_UWVSE x#u@+U z+t&z-t jB(pMQhE @1t#x}jURՐM IMEEPEPEPE p4UR0 t }h됋M I8|;MQvE|vRY 4%@t||;Er|;UM ;Q8tEPPjP1u+|E|<0|Xt |xDžx|E=w%1u EPh`E||Xu4pN8p;vE|<0u]vXDžxG=w%1E<8t}<9tw<pvt`E|<+t<-uKDžx |G 0pE=w%1tLiDžx |,pE=w%1"hmjUROx xtvxE=w%1tE<8t <9E<Džx ,psvE=w%B1>E=w%1u&EPh`u ivG;}+|1ۃ}tEXt Ut?DžtEE2;EvcPEPjURCt@E2;CxvPCxPstMQuCtCttCxEU;}u/V|EPtRtt |Ex j jPEP蠹UE x-uڃ}~~+E9}}}+E9Uup;0u ,pupPjdEP~ƃxRjPEP蕸M y+uE;Es EEU9Us M)MxuuVpPjdEPƃ |RutQ+VEPt|S +|lE)PEPS|E+|+l‰UutRM q4EP/à PURNtt51}tMAtt;Ptu UtQc؍X[^_UUE tr9tt-fvhjR|KhjRhKÉU WVS}hjƃtRE džudžHt^HbDujjWJvHDDRHH|t:|HP|E P薵|u'1e[^_ÉUVSu0t0bDtDb|t|ataSadž1e[^ÐUSME ]2t? &t zItcqXtP@Q8PPS-St@Q8 vPQE0Q1]ÐUVS]u EPjjv4S' u}t EHv1CPSt+@u S/VSe[^UWVSu} jWV]džW4VLEPEPEPRV&0t}uMEv}tFP@9EtFPFPSG1tGPjjuujWVL9e[^_UVS]u CPCPPv4S tASt+@u S.VSe[^ÐUWVS}u jVW5LJV4WLEPEPEPRW%0t}u7E}uSF1tFPjjuujVW:8e[^_ÉUju uUju uUWVS]u j VSmǃ{Lu4EPS*}uEE1EGCPSt+@u S-}u:jusLS(u_EPEPjsLS$ uBSLBJjusLjS& u EPEPjCLsLSi$ t ,vSLJWF1tFPRjuujVS6e[^_ÍvU,WVS}u f0N0 V4;V"  1ۅt_t Ut5EEE9F8vVv8EPjW̬E7F8;CxvPCxPstW覬CtStUCxEUv8uEP3 EURFKss4V|‰S@{,tMC,@ tD;S8u?Vjt{,t"C,@ t{8uVkOvC@C8;C@s{,t)C,@ t K@C4S8v{,t C,@ tK8C)t? (t(‰p E<H M A4EUEPEP|E9uG E;EuOtHEPURփ}tʃ}t}uօth`jMQ7EU BF,@ t5~8u,uF4PEPbN4N0vN8~4sEPEPjWUR QF1t^ۃ}tuuat EKE~8tGEPEPjOWEPx }t}}tuuatKEE8 u K뎉E8.u}zU|:bMv:Auz u}tB:AuKtO:u1}&uu` KtELv~M9t6U:Bu"y u}t UA:Bu Ku~<5v9ũEPEPjOWUR uF<F@~8uf0N0@N4N0N8FEPEPBuK G4;EdG8;EX}ujtKEPEP~uÃ}UvRv4%o}u.KEPEP胰\K[vETwL$Bt<5u 1u1)u KuEPEP!tVEPEP藮}G4;EuG8;EujEPpDvEGvE PURWMQÃs9vu^XC8}GLCGPC}tNE* tUJ)@C(E+BHC }+{{ E) tEpSUR*&E(t1} t+SjjM Q}W CC!vE(tC$CC vCC$E*@tKSE CCC$E(t$SC CC jsEPԡDžDžE+@Ut@ыQ8v}tEP8+FMt|@Q8 }| vDžDžHDžDž(0TtE*%(DžE+tDž(e*Dž Dž$E+t ƅ;ƅ;DžDž DžLE*t Dž@ Dž@CUBLCBPjRpM A1 }䉽4@j4PUR7LMu~DžLE,\;A4s Q4)‰EԋMA4E܋,LJ\LJXLJTEPQFjEP蘄 4BH wR$vMEP}WjjEP|9D 4RMQy) u?E+u94 u-,DDž(e*M+7v 711E)ttUTtL@׋W8<uOELtCUTtL@׋W8 UL4G 9uE*tvEt@}W8<uPEtCUt@׋W8 U4G 9uutC;C$u C8uLPSEP4BtL~DjMQtthj}WDžDžE*B),;Hv/PHPDMQSqL,D+Nj,D4E+t*+,D4tDž4x 44B  t up@E*t@ u&4AwDž KC(2 uDž 4 Dž ~J4B =w$%1u"Dž SMQ%4GH $4E)tbE*t jsEP%UtjjhjR$ C;C$C8(u{E+uu0TtfHPDPE(%P4 PS}W( Dt$E*aD)Jv(t Dž(@tE*t@PSURE(t { tKK CC4CC0CjsMQ蹙VC,{({ E+CsvR v4%t FC,uƃvR v4%FC,OCsE t@MQ8<uBEt6t2vR$ v4%tFOuDž9B PRVEPhƃUxMA|F9QxuqxUB|0Mq|~ ~(C@FE($uTVuEPjQM 1҃}tMQtE;Btu U1vuVsSj}W .Dž$FFtuxu ptFxp ;F vPF PvEPk FxtpPXFFPJxtpFtFxF(pF Dž~(uB~ u u}tEE1)EEEFs}}u 9]11;]w 1)G1);EvU)ʉUM +A9tO)ӃQ)‰PV)P:M )Y)Yqr  Fsmr  FmsEe[^_ÐU WVS}U Euu;uFvEPEPjRW( tv@E]}t5vRv4%tCMu+]tRF;F vPF PvWXtF~tvFPP%^Suv^1e[^_ÍvU WVS} uM^9uAuhjEP6xS4S{(u{ uC C C !9>u FG FB9~uVVjC@PEPu1e[^_ÉUWVSEt@MQ8< EUt@ыQ8 EE11U ;ZseM A< u 1)BU B<w@MQ]BvU BPMQCE ;Xru}t1uE)EME1u)UE}tU B$B9BuEM A;A$v*QE H@(U B;B$vR| t| t11M ;YshvU B< u 1)BM A<w@MQ]BvU BPMQCE ;Xr;urE16vE1)E1);EvU)ډӃ}t E؋M AE }tuvjVU RMQ MuE tujVE PUR Ku1e[^_U WVSDž EU zuDžJuvDž] sN{vR 4%uU ;rt;r$tN벉M Q)֋A@;A v"Pȃ PR]S:T4} GE p21*jjjjjjS9r S]S@PWPEPt9]E tt) }GWd]װH9[֋@ NEP0 uE%f=@u  UBRdMPS}WiE@E9Xs @1;s?:u$]F;s:t{EtLt+CGt!u׃tU )BB(M y(t.CGE H(@x(uӃM Q)֋A;A v"Pȃ PR}WPU BM qyyy tq PPUrCBs僽EPE0E%f=@M y(ukQ)֋A@;A v%Pȃ PR]SPu^} GE px tp R@P芋M A v] K(} G/Dž 1[^_ÍvUv?w@MQ]BvPEPܶG?u;uvuKEE%܎@EEUtEEEM;A8EPUMPEPQNj] vK~!WhˎURMTtڃ}t,1}tUBt;xtu U W MTlYvEP8J1uE9E vE 1uEt@EEE]1;uEPMUPMQfǃWhώEPE }t.1}tUBt;xtu UW7MT];] s3hҎE+EPhӎEPjUTugF;uIh׎MQETu=E܋U9U h׎MQyETuUR MT}t E1e[^_U WVS} UB5WE< uEPEPwRMQp GWE<w@MQ]BvGUPEPͳE9]EG;G v&PG PwUR~Ku GM)ى˃ t w GUBREDP__(Ewƀ> u؉Erbv FsTWE<w@MQBXGUPEP]r BFsWE$jwURue[^_ÉUVSuE XvKSVuu^LuFLFP@e[^ÍvU WVS] SC MSJC1v;StC;S$t>HJG8upt/BjjV(8uvSCM `SCM S)S){CL{(ts(CCRPD{ ts CCC(RP"1e[^_UWVS}u Et~(EN(~(2FEE8 u4VE EPEPvvWnVE 8U:w@W]Bv]PWذEEbN(VE< uEPEPvRWm AvVE<w@W]BFUPW`EE;Es E)EEF;F vPF PvWH"FE])ÃF F(PVE@PUDP范^^(VE< uTre BsXVE<w@WBXFUPW贯MEVBr ABsE}t ~(}t0F+EFt%F F(EPVEEPUR轂}tdF@;F v"PF PvWFu RvFF~ t0~ uNVD vF F(PFFP@PPNV] F1e[^_ÐUWVS]} u{4u E #~wG4W8GDWH VF|\u|\FVDP|tt@S8 vtPdt~t VF|\t G4W8GDWHVN:D u$t| \tG4W8GDWHM!WFE􋃜SMtG4W8EU@vGDWHEUHV:/uPjFHPBPGDPEPSR"PjFHPF@PGDPEPS^% u7GDCLGHCPE CujSFUt xM Su㋃FM;t(jjS1uCjS1e[^_U WVS}E EtEPSWEsssWnuz}tjsW#ou_sdvEtEPSW vEssVjW u}tjsWnt FGx9u1e[^_ÐU}t}uրw EGSW親PhjWu1E9uF뙐E;EuNuE;EruE;Er͋EGLEGPjWRu j@\tT@W8TPjWPe[^_U WVS] sN{EvRpv4%u";st;s$uENOE뱐OUJEB$EK )J C(B(E)CUtEC(S D)CC vEC(C )CC C(vRv4%tKK;st ;s$tON뾉M1e[^_ÐU WVS]}{(E 1Mx9us vB,BƋ9u9sU);{(v{(jEPjU pEPD u(CCUWRPC())CC({ e[^_ÐUhjuÉUWVSE X4p8@1trxm}uOM AHV7;ErEP))NjE PHT71BM AHRVuuSMQ t WtC1tBEPEPjSEPF oujjMQ vKE XD1e[^_ÍvUWVS}u ^4EPEPjSW u<}t?F0u ;^t'EDU;Sxv'RCxPstEP=u eCtStUCxEUEPuURkyE1uuEUDE9ӁvRZ 4%t&ӁvRB8b4RӁvRv4%t.ӁvR4F;uFt"EPURu EP>tE1}tUBtU;Ptu U EPEe[^_ÐUUE @HBHXB@4R߾ÐUSM] A,AxX|HX@4C1 ux4uP4@4tu"CDPQyvCDPQ v]ÍvUVS]u tEPSqu&;ErjjSFhjSe[^ÐUVSu] t#EPjj3V_ u(EH9CujjVh jV,e[^ÐUhBju ÉUUE t8uh`jRhjRÉUhjuÉUVSu] Kt:vRLv4%u1 FsƸe[^ÉUUM Ewr$ؑhFh3j:hIj.hdj"QhuQ hjRQhʑjRUju uUju uU,WVSu F1t~F4EF8EEPEPfP}t7}UvR 4%t[~,t9F,@ t0}t*u%=pr=~,r9~,s,EPEPWhO}tOt]vSEPf}L}u.UvR/ 4%tu*~,t$F,@ t=rt =sSxSEPg}OO1ۃ}u4UvR 4%u}_tvEPEPe}M}UvR,v4%uzu>UvR 4%n}_u@cvUvR 4%u }_(u<~,t6F,@ t-=rt=suyEPEPetbv}u,UvR= 4%tEPEPeu@}t OJ~,t F,@ u'E;F4uE;F8uF4PEP7JEFjuVXjjCDPVsjsD~jvDuF1tMFf1E܃8uPVW E܃~u3 t@W8<uvtE0U܉V(:.tD} uPwÍ@WBXPWSP$} <;G,uF(sN1 M A1 uh F1tE H1FU BF1t FM Au 몋E܋@EF1t }u]Uu F1Mt=jEPjW s} 0Et EEFN1>[t>]t >ZjEPjW #} Et U]8tb}uM܋AGE8~u0 t@W8<u t8UHljP|>zjEPjW ~} ;Et MEFF=w%1tZFPFPWN1jEPjW } Et EEF}tFU8t?M@u4wÍ@WBXPW裄PhEةt1jEPjWuu} t6Et UEFMA*Wu>}t1r}t'hjWGWd1e[^_ÍvUlWVS]C0% u2}uEPSEPjEP tz}u M eEtEEEC1tCEMc1K1:Eu~K0 UBLC4C8UMQLJS+ȍЉЉUC8+dMH U BB BBTLt:t DžP~<DžP$PwP@MQ]BPSEPEwPPwP@MQBXvPSEP-wPURlXЃ]SllЃ|xSl Tu'Dž\] C Dž`CHtsE @ \M Q`p]t @S8<u! E ud9T,MI8d]U ;M yA;A:AtY\A`RB\Dž`\U J `ZpEt @MQ8<u#v] ud9TTUR8dCDžXDž\Dž`Mt @Q8<u|] l\;tpPp u~@uuMt@Q8 ]Et'4@Uz8X14Ӊ)ZX]1)APwP@MQ]4BvPSEPsXT9Xs\\;t][8dT9X\U J X+T)Ɖ``Zp\;t#pPp @uyEt@MQ8 ]Et'4@UZ84X14X]1)APwP@MQ]4BvPSEPrXd9Xr)XMI8dOt\\;tXt.\E P X)Ή``Xpv\\E P @}t#M ];CLu\9CPr d;CPsDžhHUJP+\Ah}]8DžDDžX\;ttvpPp @Mt@Q8 ]Et'4@UZ84X14X]1)+`XNPwP@MQ]4BvPSEP}p+`X1ɋd9XrouX))ƉE XXX5] SX+d)ƉCd9Xv DžD\] Ct\hh]u DU] +؍ЉЉU]tX)EXH]Ut@ӋS8<u*vEtUuTu]H-HtK]v;8r#)PSEPlXЉ߃ Gsv>;8r&])PSMQlXЉ߃Pw"P@MQBX`"vPSEPYn`r BGs\Dž`\;td9XPw$P@MQ]B] CvPPURmM A] CCtHC<t_XUB5>;8r#])PSRlXЉ߃]S0r BGsd9XsURllЃU9v!)PR]SlXЃ|xMQl1[^_ÐU,WVSuFE?@PV~EEPEPVU苂pЋ ;}t @V8<u  t{ v{;t}u3V~tzj+ЍЉЉPVU苂3h'j W PWVU苂XЃ;'uuVU苂1e[^_UWVSuE{~ w tOW?`\*`ǃdjtPpPlPVpЃ EPu VhEjF@;F4rF4HPVЃ uEPVXЃhPEPVpЃ VlЃhF@;F4rF4HPVЃ Tv`D`\u3`u*jF@;F4rF4HPVЃVlЃ pl\`jEP贴tM))ʉ)ЍxM)щЃ=GEUtxdu ǃdhF@;F4rF4HPVЃjdgPdVXЃ hF@;F4rF4HPVЃjVЍe[^_ÐUS]SjC@;C4rC4HPSЃCjSЋ]ÉUWVSuFEt1EulPE ulPhmV蜣V臤 EPEPVUpЃjF@;F4rF4HPVU􋂐Ѓ VUlЃ} t@} ЍXًF89vÉكQU RVUXЃv1ۃ}t?}ЍH~8G9vC)QURVUXЃuuVU􋂐ЃjVU􋂘Ѝe[^_ÍvU,WVS]}E@EUUEu UTt2EtUTPdЃ ETUu3tBjR EPX9} ujjURU\ЃSWhqo} ujjEPU\Ѓ5_EUBjREuWSU RP vEPEPEPUpЃ} uWSjEP`$|; uOUz4uEPjRt vEEEP8JUE샸Xt]UXE;EvjhvPEP/jhyUPEPjh{jUR U E쉐PޅhvRPv4%tFOu΅.E싐X:;EE)Ѝ09v4vRv4%uK9w9uEU+X<]SvR觙 4%tKύv7EËE))u)~|.uK)PVU REPtjh}jURrUBTu,jjjRhuUBTu uuuEPUЃjEPUЍe[^_UWVSE@xUtMh}EPj URpih+Mpu EpvtXpЋM;A8v A8)ЉptXNMy4\uljA@;A4sH UB4PMQxЃMQxlЃ MQt\Tt\M;A@ut\Tt\tjjURyjMA@;A4rUB4HPMQxЋt\TUBTjjjRfuLMAT7tXUB@;B4rMA4HPEPxЃ} ujjMQx\Ѓ}M`EdpJl\d u wÍ@MQ]4BSEP?`ƍ>;`r1+\P\RMQxXЋ\wÍ@MQBXSEP_ƒr BGsdl2U9v!)PRURxXЃ} ujjEPx\ЃMQxlЋtǁXpE)EhSEMHhu(tXP|PURxpЍH[^_U,WVS]} CEXt*jhPSdžXdžPt$CjSЃt,ju\wHugCTu[jjjS|cu CTu<%t PWS PWS?tC9t@t jjSU\Ё\vWE\;C4s S4)‰EC4Edž\džXdžTEPSdž\džXdžT1e[^_Ut! @V8<v E  UVLM;sFP;EEPEPEPRV~[ t}=vFPU;E؋+~PG;E91ۃrGEMM؃ wEč@V]BEPVWNÃsK}wEč@V]uDjVWjS=1s8tAuuȍe[^_UEPE PjuSO }t} u}t E1v8t0@S8E 0Ut @S8E v Mu uE1t@S8<u tE}M}UEBU un}uht@S8E Mt"@Es8u܉M14 1E)/v}wE؍@S]BEPSsAUUEǃ}u;{8r} u1E1s8)U+{8M}vM MMUEBU uo}uit@S8E Mt"@Es8u܉M14 1E)/v}wE؍@S]BEPSs@UUEǃ}u;{8r} u1E1s8)U+{8}}t}u C5E}t u+uM1Ee[^_ÉUUM }t"EPjjQRLu$}tEHzTtrTQR v1UMY;s8<}F}t } u1+s8mu؃mMUAM ur}ult@S8E }t&@EC8E܋E؋M}14 E1E).}wE@S]BEPS?=;ur%U+UU;uuEH9vOKvEBvE؃}u)M;K8r!} uE1s8) v{8)}؃mEHe[^_UWVS} ]Eut u$ujURNu uGM;8U;8tr t?n[vMQt]ujjSrV}uEC]ÐUWVS]} s{4uSlnEPEPSpЃrPStЃjC@;C4rC4HPSЃ SЃuuSЃ s1e[^_ÉULWVS]}u8uit @S8<u uxu-Gv;ujSԄЉUȋCD;C@M;K@s}苰SumrfvEPEPSwu}u1t @S8<u' u}t}umsujjS1 jjE PS0vEtEPSStE}y8u>t @S8<uQ v uCxt1S7PCvjSMQW+wFvjSEP=ƃC;]s;uve[^_ÍvUWVS]u CE{4wjhjSIWjjS迾{4}t vj@P‹ujjSUIu CL@@CD;C@ЉUC8F8E}uVEPSnu7U)‰ЍЉЉ@9s uE}toC4)F4CHFH{4F4CHCFE9Cu UrC0sV4C@)Ѝ@PRR5~4C4)C4CHFH^E9u Ep p3{4tC4HC@~4tF4HF@}tj}tF4)C8 4   G  49 < 8 4 v  49=< u   < 8 4 ]STSc  @uS$ P= }EPj8 $ EP1vW39 4%u_uEPW8G~WvEPbEP`=0 uPv, 0,  0 ^uB=0 uPPv, 0,  0 E vE[( E = ]4= t tD u 1uvWӃt VWG~݋Eԋ װ, H, װH0 )‰У0 u*Pqu, U,  0 EԸ Uԃ<\u? t6=0 uPu, 0,  0 =0 uRt, U,  0 -=0 uOPt, 8,  0 ]u , 0 \u? t6=0 uR;t, 8,  0 =0 uPt, U,  0 E܋EܴfE܉EEڴfE1]EE޴fEރEPEP9EPEPSV}= vV,5v4%t&SvVA!]4NvV4 4%t0SvV 4PFuԃ]5}]S S$ P8 = vV4v4%]SSV vV3v4%t*EPvV:4*EPvV舐v4PEP24 %CF4 e[^_ÐUS] P;P|6|ȋP҉PP;P} PRp ¡ P  HP @w$ܜ L  @L  L ;B~B]ÉU=H v`=H T=H tH=H t<=H t0=H t$=H t=H t =H u5H A=H u@;H j`=H thoH hÐUVSu @ D=|= ~== }4FP@#FPÃC)ƉPDe[^ÍvU WVS}u 19}!v ;@ 4C9|e[^_ÉU WVSZ=H   pơ x)=D }h k=@ uhR;@ }UVW2h ) C;@ |.vVW h h C;D |TH 5H 9H H e[^_ÉUvh ~=H t=H  t =H }US]=H  u=H t h vh =H  tċ]ÍvUSEU ] , ( 0 4 8 < = uh%l H CL j'=H th9lC PUh H { t h2C ]ÉUWVSu} 1;^}T؉ىTC;^|FG[^_ÐUWVSUM 1E;x}.;sGE;x};r];{};u L1Ӊ΋E@;x}!ULtGӉ΋E;x|[^_ÍvUWVSuEEFEU;BM ;A];E Mϋ];v]ߋT~TC]hUM ]؋};s^TىT7v^U}TىTG}N] }D DG}FEU;B}@M] ;KG}$^U}TىTG}FE;x|֋UM ;Q}-v^} }TىTG}FE ;x|[^_ÐUVSUM u1;^}:;tC;^}-;u;^}!N;^}DT ىTC;^|[^ÐU,WVSE}ЉU}ȉME}] ;{}Kv]D1EC]9|EE};G(_$UM; uf} G;DuZD 9EuPD 9EuF1U<FM ;q} UB$T8D;Du;tًM ;q1EE};G(sUB(‹M;A,|1|A,9}]C,}G,Pw$hG$UB$M}<U BP ‹MA$TA$P} W UB$ML B$UT MA$DA$DA$D1;wP]]}<}EEvU ]C <T}t @u vt}t ux}t @u t}t uYuP}t | v t}t u1u(}t | )v t!}t u t }G$MT}_$M| uDU G D 0vM ]C <uC$UDC$DF} ;wE@(Ee[^_ÐUWVSU BP-E1M ;y}EGU ;z|1 EEM A <<<UTEUuMQUTRPEM<tOU}M A w6$H&EU} G0};|}/אUЃMQVSUEE H0U;T|ԿGM;y}Wr7e[^_ÉU\WVSE UB4BPE؉EMAPEԉE uFPlE̋FẺEFPNEЉǃ FP7EȋFEȉEFPEE E;F}UċMBUċu;V|UBPEjMquF0E E;FUB Mċ$`vuuEE7UBEMMu1;_EEURMA0PEPEPJU މMME;|^|&vUM܋UBH މMU;}݃ދM܋PދMA04EދMA0M ЃUB0PMQC;_AuF Uā< >MA/uFEEEGu1;_UUMQUB0PEPMAHEމUUM;|^|&vEU܋ ɉ UBH މMU;}݃ދM܋PދMA04EދMA0M ЃUB0PMQC;_Au~t UBB MAEEu~t GG:vGuƋ_KxvMًTމTKyGEGG1u~t=~%/MAAMGG1u~u~tUBU{MA UEuā<%EEEEU2M1BAEj/‹MA0EċuċE;pgEUċM;Q]uF }ā<~<t <~nSUB0MčPuVSeN0U }ċD;B}BP4‹F0UB0MčPSEċuċ};w\EEEċU;B}-]S}ċu<7WVsEċ}ċE;x|փUREP1E;u}3M]v}ċD%T09tEċE;C|֋UB,B(jMA$jVEPQ uV!1}W1 EP1UR0 MQ0uV0 u0e[^_ÐU(WVSDž=DžddvdP% 4d%u d_uhdQdd~h$ PPCDžd] S$ӋEEd;tx\vU Dd ؋\u F <w\W4V8M A <\SPdu V$}| t|# u\P$ P] S$u| t@u7u/Dž(( ! G(v苍] S$u| tu8u1Dž((!G(v拍E P$]| t u8u/Dž((C~E Uz8u R11] EH@UE4CtP'e[^_ÐUujQÍvU WVSu Ѝx];tWVSu C;u1e[^_UEt PbUVSut%1ۃ>t4=C<ue[^ÐU WVS]E P$E uSEU 1;t vE P4uvG<u1v<t,4U RuF4}O9uPSÅt"E DU R@1e[^_ÉU WVS]t} tjƃu1~;tq1PE 5{tC:AuB<t: t9v׃PAPWutWSVoƃtC;ue[^_ÉU WVS]t} u1:1FE <t(װHPRS ÃuΉ؍e[^_U WVS}t} tjƃu1VEE8tpv1U :tTE 4UE4uÃtSVƃS' S{tGU <uEEU<ue[^_ÐUSUZJB 2]ÐUU؋B 8t"Mqr]؉CUԋB 8u M؋A]sEpU؉BB 8tC 8tPr M؉A m]؋C f|utq~VzFVkN VFN VF@BAjv 6d tEEU;B}tMj NËU}P-C URP>MATCYTuE]E;XY]44` tQtE t 6EUM;Q~Ve[^_UUM :t9u B:u1ÉU,WVSl Ep U=x}99E+EU+U9~@U19}.E+EU)‰UM}UF;u|U)U6}+}}19} MEU<<F;u|EEU9U~ }9hx+p l p [^_ÐUS]xp l ` h8h ;-ud C7;+ud C$=h td  vd ؋]ÍvUt>=u]E"}u]EE vEE;tJ` )PR3H{u؉+` ;H9u]UUE}tR}uL=|txM 41hӝ5V` װЍD` J}UUx>Myt F5,=|tUxU Dx-uM12h5ʟ*E0xU DP2h@5螟` ߰ҍT` UB +vMyE9x}xU xp=|txM t1h5` ߰ҍT` UB ?M9:H:>v` װЍD` }tMU Ex4UB v}t1xM x-t ` PEP=|tVxU x-u5` 2h5+5` xM P1h5` x?9` ` PEPC¡` 8uxt:uY=|t==h tPU 2h5fPM 1h5Kã?:Wz;EEEE` 8uVE9xu@=|tPU 2h@5Ҝã?M9:$:xU x55` F>t>=u]E"}u]M؉M vEE؃;tJ` )PR3vu؉+` ;H9u]U؉UE}t^}uX=|txM 41h5֛` װЍD` x?v}VU܉U؀>tcMytF5=|tE0U 2h5U` װЍD` ?UzM9 x}xU xd=|txM t1h5՚` װЍD` ?U:::v` װЍD` }tM؋U ExtP@ 1vUB ` Wz:z:u` 8uih` 8uQM9 xu;=|tPE 0h@5љã?U::u:vxM x` Íe[^_ÐUjjjuu uÐUjuuuu u}ÍvUjuuuu uYÍvUS]E t'PPS5h5S5h5՘]ÉUu ujUS]Stujhǡv]ÍvUSE] tSP vSctujhǡe]ÍvUU:t< vB:u58‹E 1ÐUVSE] HJ9wA;tR3u vRt15Hօt H)É1e[^ÍvUWVS]u=Ht88%15HUt H)lj=4cHuIHE= sE UU15Hхt H)EEE4 8U9r6%;4u!A9rh,P0ujhǡ=dt+hءS}`ujhǡ0D<FPS tH'0hڡ= uF %f=@u1=duF %f=} tLPu]EP)PS(Љƒt9u;}vE8Gt;Uu=pt9sEPWSue[^_ÉUWVSu] EURSV+ctl= ucMA %f=@uQ=dt5`: Vtt0SEPS111ۃURju18u =05nvE=hu =lt =hu:@ D)P1}uP5@tE}t=hu 1ElT@)D9vM8KtK9vE8Cu5D)9s>SRQǃ=t SVt=t =pX1ɉ; }C;@v;;tEA@EvJ;UvE8Bu; };@v;u;t )ӡ@ D))=xt REPSu18u =05{v@=t@D)‰9}tHDMD5D@)Pǃ=t5DE))llЅEtt5h蛸e[^_ÐU WVS}u1vjWIeƃ8tޅuN= uEE PWt0W^XE PWSF=uك= u7 t u-ĉE PWLuU B %f=@tSW덍v=E PWV0Ã} v=t9=tt:P5h:Sh,)؍)9u P5h=dt5`*.t*Vwtc8tV0W؍e[^_UWVS] EtNB;Cu@B;Cu8=u"h0EP5hI5gvuC41RPUR7EuA8t'='0EPCjh^}HEEtU|/ЉUEu]t=u@t>tqӃUDPEPhEURPUE/ VEEPރEPUR!E >ut=uHt}tEPURsEh[^_ÐUS]t65h55h55hq5h@^ hNhA h@1h$ hh SvUS]=t%S5tjhx]ÐU WVS}1̇=̇tKv4WnuЇ$ԇ(Fv̇<u1e[^_ÍvU WVS]u 1vvRdv4%@tCύv;ugv}tE4G/vRv4%@uCF<\u ;t FC;uF_ve[^_U WVS}}P+EjREPU: ËU PƋE U2VEPUR4ue[^_ÉU,WVSE t+j/PRtj/5{R@8zudEEE EEhjE PEPh P $MTBЉUUv=h5ijh@R=Kh5-jh@=t/EP5jh@vEh`?hf3hl'E5|qlWv5qu .5vu 5{u jh=ӃU\sVMQE5EPE u zƿthءP v5u05!}t E@9vSURUE}EC9EuSMQ2EF u!VE@)‰PjEEPԇ;5t V;}ME|  AMziYl5lxlvpd5hu he5ou hA5u hjhjzjhhu u6ƒ =}E=}E=u =t^hȯ5hͯ«h߯赫 h襫h`蘫 h߯舫jb=t j}t}u 5pGvM?vx;U}%E UxװHE jF5Juh6uURMQ$СxU)‰Ѓ~ =t}t tx;E}WExU h ޿1t 1҅tR!Exx;E|h jE5 u 0hU=uEPU WVShHÃhd`h\ jjS"C, ߉ދC S)‰Ѓ }j S.F y9y uI(AA Q!ЉA Q)ЉEq)Љ9U~q A A{0tgC0@C0@C0@ C0@C0@C0@C4C8ǃ<ED S1e[^_ÐUWVSEEP0UMM Mm]]}Љ}EDtMMDE M]]ExEEEtTU:W tDMЍUE<]:_ sE?E@Et]:_ uÅ uC S)‰Ѓ}jQi{ q9q uI(AA Q!ЉA Q)ЋY)׉9~Y A AtyGuC S)‰Ѓ }j Q C q9q uI(AA Q!ЉA Q)ЉEY)Љ9U~Y A Awu GG@GUPG@ G@GJAHG@]_ G MEU<u M8]Ux}E‹Mx u:u]ЉЃ<0uH M@ MsUMЋ x t̃}WE]<u UH u"EM<*]@ UM@ tCV)‰9C~C[uv \G0p t(VF;B~BFF;F~FFv u1ɍA~PG0p'Dt)1ɍ<vA~)v1ɍ<2A~ꋗDt$1ɍw<1A~v1ɍ_<A~1[^_UWVSEx4u E ;}u"UR<PM QHvp<<UJM@EM 9EE EEG)E;MvA0A0хt`A0A0A0хt>A0A0A0хtA0A0;MvIA;Eu79ȃUC9)؋U)ڊ:t9tM4U UUA0E)9fEEA0uEA;Eu99(ȃU:uC9)؋U)ڊ:t9~)UE)9~1e[^_ÉU,WVSUEE;P4>M<ME;uw9t>vMƊU<t;urFNU<ue^M>v}tK E܊ K B:H sv@t:H utP:t]Uz;] w}uE)971UUE+EM;A8~ EA8EEE)FU<uu^Mtc;}tK E܊ K B:H sv@t$:H utP:t ;]w]Uz;] w}KuE)9m}tU U EBUBMAE[^_ÐUVSuU E]~,u2Du)PRV…ttSF4C SPRVSe[^US]1PRS(]ÍvUVSuM U]uu^EF JVf(F(t Qv$ 6FЃFÅućЍCFF FCf(f(e[^ÉU WVSuM U}]uu~EF JV^$N(F(t QS 6FЃFÅućЍCFF FCf(f(e[^_ÐUWVSuFEFV )‰U] \d;}F(t Sv$SFЃDžućЉ~EG;FF@~1MIx FDIyE$URv$F Gv1;M}WFA;M|E9FuF(uUBGF(uRF ЍGFEF f(e[^_UEU v@t9s9r%ÐU WVS]} S&rC(t Rs$RC ЃK(t9s9:r΅t{ {CStsve[^_U WVS]} S&rC(t Rs$RC ЃK(t9s9:r΅t{ {CStve[^_UE1ɋPt)RuÍvU5h1補5j  5ȇUWVS] uuE( uSGEuEPUUEx.ux ‹B%=.ttU+U})19 u89v49v9tSURTƒt[+EEUEPEPg @EURENEURuEEPUR41e[^_ÉUju1UVS=te1۾vS 4%t&vS赭4؈3C~1=tP `ujh_e[^ÐUWS=424tK;t?d{HPs5`tjPv[u4tFv;u7{HPs5`gt jP[u5`_t jPe[_ÐU WVSh P5h { h@E PURgt jP9=u =E 2PEpM=tq=t}uf}ЍXE؃U RMQP] =t}߸f=t U}߰Ѝ\jhSURjhM QuVe[^_U WVS5Hu(h?P5h&vhP5hy h@E PURlet jP=u =E 2PKEpM=tfA=t}f}ЍXE؃U RMQP@] =t}߸f=tгUfҳD}߰Ѝ\jhSURjhM QuV,e[^_U,WVSEUU Uu9v=`EPE)PV5`Uƃ|E)PEPV耍EuEE;uvU8VtvN;uvE8FuUE;d*EPjjRVh; u EUsEEPjjURVhƋE E)PEPVnjEuUU;uvE8FtN;uvU8Vu}|%\hE)PjPVh@yDà 88)߃=u=-vE)9=t5TvR 4%uQ|_tJE)90vRʺ 4%u <0_~- \@hSD;PVh@Eǃ FU)9t7C%\h)PSRVh@ICá8)߃ uFE9ET1EUU9s@Ue[^_ÐU WVS}+E 48v9s: tM 9vC9s; u)PR5`t jP 9sC9r5`t jPe[^_UWVSEuU 29*ЉEvEPE)PV5`ƃ}=t-;uv U8V7;EU8=;]v3SvR誸 4%uh{_tb;EshvRpv4%u<_u4EPOWV5`Ë}tfF;u1:]] 7)PEPRBuڋEN;uv~ ue[^_ÉUMU vABuAÍvUVSu]u 1ɋU AJ9r9tȃ[^ÉUWVSEEEuӳUPU@E }}t@CE9s2E8uEPSVTu)]1u}}tQ t EH<0 uE}t8}t,EH0E8uEPSVuM}u}u[EE@PURoÃuEP1av]EuVPUUEUt*1}tEEPUR+ƃE}}EPUR6]ހ>E8tCF;t~U8u;tr{tl1ҊE8CuUE8CuEŠE8CuEŠE8CtE8CtE8CtUtCCFCF;o}HE} tUE Ee[^_ÉU WVS=hhu_j.h5ƃtGVװPRhYR'QD7 RD1PV9RH=uE D0E|:u{Xh*3P~`=)E)9wJӀ<3W<3.u8Ch*3P~؀<0u )ʋE)9%FE)Pj.V{ƃt15hFP1uǡ|0e[^_ÐUWVShutSEƅsjSމH j TSWDžXDžTPPSjV{ u Pxu5Wj"jjtװHPRPpp` tPhF5W5jj hI2ǃtPW4ukju]S(ju EP jVEPEPe j,SW>,tEURPW)W8[^_É$FreeBSD: src/lib/msun/i387/s_ilogb.S,v 1.7.2.1 2000/07/10 09:16:28 obrien Exp $v u %UE]EÍvUEU щA uNu~AvH҅5v ~&HɅv~ U=u?EEUB jjEPhjRmu ÍvUU:t2v:%uB tpuJ:$uz%1Fr8$pN*`c Q)Ѝ(h Mb)‰)Ѝ) F;u=t EMvMAMtUEEUfEE\F9~FIu`u`> gfff)Љ)‰})t<3WEP}=ЋUTUE)~!]EvMAMF>tFEE;&P5]}t65EP=ЋUTUMe[^_ÐU WVS]} uStVWS WVSٖe[^_ÐU WVSEPju v}+xHy8t0Pq8<B%uxPB84x@t lx@xLt@Lx@4t 4xBxtAxt;j*Bp -t@Px1҅t x@ fPDxBtFt=j*B,t@P1҅t x@ fPFx@(t (u8xPt't(x@ǀx@,t ,ulx@t[tRt u@x@t u&xP,x@ǀxP fzBu$fzt@ttBfBBxP@t"t>uZ)xBx8tCx8t=j*Bp8+t@Pv1҅t x@ fPHxBtFt=j*B*t@P/1҅t x@ fPJ}t=+thh+EP虖Ee[^_ÉU WVS}=xt\5x1F9}J+~F")‰Љ)‹F v@jPW(u F CV9|1e[^_ÐU WVS}=xtlx1C9}Z&~C$)‰Љ)C"‹CxjPWM(uC fɡPtQ.PPJy B;B| t RQ~Pxx@DtDфPB9x|jUR9\M];uPGt ۀ3Ph@utx@xu j=EPURPxtOPMt]x);VSQEPURz tf^Ph@utx@xu j"=SMQPxtOPutxjEP9}SURMQ]SuVvu}UM;ut tNO9~;]|Ph@utx@xu jU<EPURPxtDNPMtUxSRQMQEP' 9\UUM9}MCEܡPh@utx@xu j;URMQPxtMPEtM܉xM)١x@t9~x@x|t6t-P UЉ)U97Yx@tP)9 /v?B$MQCP]SuVEP )PUDP9KMءPh@utx@xu jd:EPURPxtSLPMtE؉xMC)x@t 9=x@xTtP)9v?BMQCP]SuVEP tg]CPh@utx@xu jo9SURPxtaKPMtxj]S-PU09ht R 9)PP@;E~ +EuU ]PRQe[^_U WVSx@xu xuxtPlt40u+hx[ jjhPZx@xux@xtQPU09ht R*8x@p~PǀxǀtxBxPǀxǀth@u tBxu j7jjPxtIPǀtǀxU09ht RU7x@p}x@xPǀxǀtU09ht R6P1fxUh@utx@xu j6jWPxtHPtǀxx@p|GPB9zPU09ht R96P1fxh@utx@xu j5jWPxtGPtǀx1fxPBH9tu!BH9xuEP<v]x@xt }~u0ۃ`P09ht RJ5ɡPtQ0PPJy B;B| t RQnuPxx@DtDU{PP9x|FP@9GPB9kPh@utx@xu j]4jjPxtPFPǀtǀxP1fx~Ev1fz~*D@(M FP@9|GPB9|e[^_ÉU WVS}u xBhx[ VVBWP'zx@xt ~u0ۃ`P09ht R@3ɡPtQ.PPJy B;B| t RQfsPxx@DtDMyN@Avx@x|&p|yvx@xt ~u0ۃ`P09ht R@2ɡPtQ.PPJy B;B| t RQfrPxx@DtDMxx@t+xNx@x vx@wx@xt ~u0ۃ`P09ht R1ɡPtQ1vPPJy B;B| t RQBqPxx@DtD)wx@twNe[^_ÉUVSuxBt'hx[ VVBTPv$19}x@pTvC9|e[^ÉUuovuU WVS] uM}xxB99MPh@u tBxu jp/jEPPxtaAPUtǀxU09ht R /hx[ jx@>}xBxX9MPh@u tBxu j.jSPxt@PtǀxU09ht Rg.hx[ jx@pXxB99MPh@u tBxu j-jEPPxt?PUtǀxU09ht R-hx[ EPjPx@xB9MPh@u tBxu j8-jSPxt,?PtǀxU09ht R,hx[ URjRx@6QPesxB99MPh@u tBxu jd,jEPPxtU>PUtǀxU09ht R,1;}hx[ jx@rG;}|xBxX9MPh@u tBxu j+jSPxt=PtǀxU09ht RI+1;}}7vhx[ jx@pXqG;}|vPl0x@x1;}])Ph@utx@xu j*jSPxt<Ptǀx1fxPBH9tu!BH9xuEPv]x@xt ~u0ۃ`P09ht R)ɡPtQ1vPPJy B;B| t RQjPxx@DtDoPP9x|8FP@9G;}l1e[^_ÉU WVS]uM}xB9u 9Ph@u tBxu j(jE PPxt:PU tǀxU09ht Rp(hx[ jx@O}xB9Ph@u tBxu j'jE PPxt9PU tǀxU09ht R'hx[ jx@vxB9u 9Ph@u tBxu j<'jE PPxt-9PU tǀxU09ht R&hx[ EPjPx@xB9Ph@u tBxu j}&jU RPxtn8PU tǀxU09ht R-&hx[ EPjPx@uJPlxB9u 9Ph@u tBxu j%jU RPxt7PU tǀxU09ht RT%1;}hx[ jx@kG;}|xB9Ph@u tBxu j$jE PPxt6PU tǀxU09ht R$1;}}7vhx[ jx@jG;}| Pl0x@x1;}] Ph@utx@xu j#jSPxt5Ptǀx1fxPBH9tu!BH9xuEPv]x@xt ~u0ۃ`P09ht R'#ɡPtQ1vPPJy B;B| t RQJcPxx@DtD1iPP9x|pFP@9G;}l1e[^_ÉU WVSu] }x@uxXtx@uu *vPh@utx@xu j!jSPxt3PtǀxU09ht R!u$xBxXthx[ jBpX6vxBt.hx[ VjVBEPg-v19}$hx[ jx@pXgC9|ޡPh@utx@xu j jWPxt2PtǀxU09ht R u.xBthx[ jBgkxBt*hx[ VjVBDPf/19}'hx[ jx@fC9|1e[^_ÐU WVSu @ x@xt ȋ@% ‰U}RVjEPU RMQǃ x@x I}u ux@tRPE9tt H9tu8xBt&thx[ jBehx[ jURM Qx@p ECPtet%hx[ jx@PevPǀxǀtEPURM QRQEPǃ hx[ jVjx@p BPdPǀxǀtu5PFtURE+E@PM QEPǃx@xux 9uy9uxBxtx]+]Ph@u tBxu jjSPxtu/Ptǀxj v1;]u)ޡPh@utx@xu jjVPxt.Ptǀxjj ]C;]|\vURVjMQE PEP_ǃ x@x 2} tTPM 9tt H9tu8xBt&thx[ jBbhx[ jEPU Rx@p \@Pbt$hx[ jx@gbPǀxǀtMQEPU RPREPWǃ hx[ jVjx@p ?PaPǀxǀtu9PFt"MQE PUMDPPǃx@xux } 1yE 4Ph@utx@xu jjVPxt,Ptǀxjj CE9{t>UREPE PMQ5Dd EPU RMQ1ve[^_ÍvUPǀhH@Plu"x@t=`x@t `x@t_x@t_x@t_x@t_xP\t3`t*@xt \x@`PP_ÉUÍvUPht jPltt0ukƀ0hx[ jjj:Pƀ0jPBHPxtF*PPJtǀx jj ÍvU\WVS=Pt+Pduj"jh9ucUuVnjV,n jVn]SVje jSnǃu'VonjVm jVjTe ]S@njSm ujSmjEPjeE]ȍEPmE uVSjdjiPh jVjddTjEPjde[^_ÉU VSu=F]EP_mEEjSVd Lty=Pt=Pxt2@@PPtPƀPǀx[ S =PtPǀd|ujjULtƀx|uÐU$S]EPjSKcu(}t u}uju S%c1]ÐUSE=uhh=tjhjbhk Sj+   Sj Sj  Sju ]ÉU WVSEPPphPB DB$HB(@$,D؍e[^_ÐUS]t!3s S^]US]L=Lt=9Lu|L(v||t9|u狃||s Js$J s(Js,H s0: t ](t(]t]t]sg{t0{t*sGtz8 us^]SR];Pu<DH@P]ÐU1ÐU1ÐUÉUÍvUÍvUS]EjEPSfƒ}u]v|x@ HЙE E8t8;tEE8t8;uE8;uEE]ÐU WVSu]E fEhj_PPL|LjVOPxPfXfXUfPǀtǀxǀ|ǀǀǀfǀ\ǀdpǀphr]P %Ƃ0Pƀ1Pǀ4ǀ8h ]t?h ]ƒP4PR*ƒ P8PRPǀHǀL\ ǀPd ǀTl ǀXx ǀ\ ǀ`ǀhǀlǀpx@ fx~F¡Po@с<x@ f@x@ǀH=PDPƀGPƀFPǀtǀǀjjEPPUGHjjEPP3GD_P HJ$DB ǂd AD@1=x}ۡ8};jP@)PuVSFHVQ@=jjEPSqFJEPQBСPfXPf)X G8t 6jjEPP@PE‰@tPP(JJ1e[^_ÍvUUu13=<s U P@ 1ÐUUu1vu }PU=Pu ,PǀdP\JU WVSP+T+L+H+t+p+x+|+d-|X+\~l_ +$:8'<#oP<L>XvT^@#D#`#`-h-<>*!fx@ltlQx@Htw1ۋHЍx9sZ xvAH}u89uEt t vtE PEPWRx)}c@t3xBt!E PjBM%=xBtE PjB=PtPEt:t2xBt E PjBM=PtPDt4t,xBtE PjBL}u }9*}tEx@ uU RjEPEPEPEPEPEPEPEPEPx@ |)0PK}u }9u*}tt Et t~tE PEPWR&_v@t2xBt E PjB K=PtPEt:t2xBt E PjBJ=PtPDt:t2xBt E PjBiJt:xBt(E PjB3JE0 }tKu}tA9u#}ttEtttE PEPWR%@t&xBxdtE PjBpdIt&xBxhtE PjBphxI t&xBxltE PjBplJIt&xBxxtE PjBpxIt,xBtE PjBHt,xBtE PjBHt,xBtE PjBHt,xBtE PjBLHt,xBtE PjBHt,xBtE PjBGt,xB tE PjB Gt,xBtE PjB|Gt,xBtE PjBHG t,xBtE PjBG@t)xBtE PjBF}tM =PtPUh E1e[^_ÉUhx[ uNU1ҡx@xdt@x@xhtx@xlt x@xxtx@tx@tx@tx@tx@tPltÐU VSEu u @BZEÀ;);${<j>SF;>Eˉ=w%1tЉEE\;*u uEI;.uCC;>t==w%1tЉEE]EC;>`]Pu  PۀE]C;E}fUf fUm]Eme[^ÍvUSu uk@BtPIșȋ]ÉUxBx t$P@HPjBp !PCÐUx@xptpp}CPǂxǂtptpǂpP=ÍvUS Px~_Й P ǀjx@p4¡Pjx@p0¡P jx@pH¡Pjx@p8¡P jx@pD¡Pjx@p,¡P jx@pL_¡Pjx@p|=¡P  jx@¡PǀxBt#jB¡P PxPB(uB<jjjPP¡Pjjx@PP¡P jjx@P¡Pjjx@lP¡P jjx@6P¡Pjjx@p P¡P jjx@PK¡Pjx@p¡P jx@p¡Pjx@4_¡P jx@pT:¡Pjx@¡P jjx@P¡Pjjx@P¡P jjx@{Pv¡Pjjj x@FPA¡P jjjP¡Pjjx@p P¡P jjx@PáP;~ڡP9~ЉxBtExpt?Bpprt$x@ǀx@ǀ]ÐUjP@HPjjPpt j7x@t<j &<U\WVS] EDžDžUREP9]Dž@BxBt:MQB(P}Wj tP9]ME)؉xBt`P9}MSBPEP}WP tPx@x,P;EPMQjPx@1@,ǰHË;BkKdQWu7+]xBtZP9}GSBmPEP]SP tPx@xLP;EPEP%Px@1@LǰHË;Bs*K~(QWu־@B@BUEBEBEM9MDž@BxBx tG]SBp PEP}W,PC tPE9EU)‰xBt`P9}MSBPEP}W裿P躿 tPx@xD1hPPc~g;}YuPuGP@$P(MI]%=w%1tƅ1;}c PA$P(][U0;hvF;}.PC$H(URU0;htƅtp1;};MI4P@$@(Uڋ0C;|Ӌ)PPx@@DǰH;s+N~(RQ菽uֻ@B;PEP]S5PLmb}+}xBtZP9}GWBPEP]SPؼ tPx@x8hPS7Px@1X8ډװH;s0v~"SP uӾ@B;}-PEPURʻPt@Bu@B [^_ÐU,WVS}u;}u 9u u1PP9|әM֋ PA9E ] CؙA9C)‰)xBthx[ jB3# JxRj -K} ~\xBxthx[ jBp3, JyB;B|Rj 9-E CP@H9~ǡP@H9E~EDžDž@BV]SPPhPEP襹PP tPP} ~'@9})yډ+E yЃ~} tNjV]SE PWhEP:Pyƒ @Bt;}Džtgx@xtYjVURjWhEP۸Pƒ @Bt%P;}Džx@x0tZjV]SjjhEPsPƒ @Bt%P;}Džx@xHtcjVEPjP@HPhEPPAƒ @Bt%P;}Dž} ~ P1ۋxB8tzxut~pBx8tgjVURP@HPGPhEPgPƒ @Bt'P;}DžthPEPH $vjV]SE PWEP x@p]SEjVURjWvx@p0]SjVEPjjx@pH]SjVURjP@HP} ~x@pEP_x@p8]SEjVEPP@HPGPS60@Bthx[ jP.1[^_U=PtP4vÐU=PtP8v1UEUS]M xBt%QjSB P@.4QjSPx@ P .]ÐUS]M xBt%QjSB P-4QjSPx@_ P-]ÐUx@t +x@u1vx@-ÍvUWVS<t)hx[ 5Phx[ FPt x@ fxP xA @,jA @P¡P(t|ơP( fx@ fx|FPx@ @$ǂl@Pc/¡P u x@E(xtEX1;=PxEUv# [uTfT [ ؅}C$)‰Ѝ@UUDfDuFxt [fDBdN [f<tf [f|tfD [f|tfDC;]*1e[^_Uft7vf}|E;}f|;}f}~M% MPU(f%tukF D]]EEE|DžxDžt1E%A>vXwD$AuGA}tE Ex1TGEK}u:@=w%1tTPЁ'~EGA?ta}t%1DžtDžx|%AA}ttxt;x}xU]l $(% @;v P  , 1҃=~ dt`=DӋU D;v PmSW=~& du`t`װЍX ;v PShv=~& du`t` Dpl]װЍP9~ڡ D;v PplRpQ P{" =װЍD FσtE܃<t$=TƀdzESF<w;1҃=~ dt`<1҃=~ dt``F<w<F=ƀd`FF1 \BF< v= ƀd`1҃=~ dt`1Ƀ=~ dt`1҃=~ dt`1Ƀ=~ dt`)щmv1҃=~ dt`1Ƀ=~ dt`1҃=~ dt`1Ƀ=~ dt`ȅtә11҃=~ dt`1Ƀ=~ dt`ȅt љF1?11҃=~ dt`ta.11҃=~ dt`u,1҃=~ dt`t=ƀd`d1҃=~ dt`1Ƀ=~ dt`!+1҃=~ dt`1Ƀ=~ dt` 1҃=~ dt`1Ƀ=~ dt`1{1҃=~ dt`1Ƀ=~ dt`9v1҃=~ dt`1Ƀ=~ dt`9v1҃=~ dt`1Ƀ=~ dt`9`1҃=~ dt`,1҃=~ dt`҃=ƀd`}uE}E1҃=~ dt`ulF1 v>tnF>th>%uF>?u@v>;u~?H؀>euӅu1F1 v>t2F>t,>%uF>?u@v>;u߅~H؀>t F> =ujj@u1v H[^_ÐUS]{t SG{t S=]UWVS} ]}E@8Et{U9Z0u 9z4|f|b}tMATS}tMA@980}t UBT8W}tMA@9 ~kEPUZ0z41]/MI(Mv]E@(EUMً]GF}tMA@9||1e[^_ÐUUE uB1ÐUWVSEx8ǃ8G8EEGuoW(UMI4\2|FG4@MQ( ET0G0fytA9~fYfytA9}fQEG9E~88q[^_UWVS}Ex8P8URE]CEUB4]{(@ f||[E@]C(4DS0)L)х}1ۋUB9~f~tF9~f^f~tF9}fNE]C9Eqe[^_ÐUS] CC0PC4Ps8[8t{8u֋]ÐU WVS}t'UB PBPB@PB@Pƃu 1 vMAfFfAfFAfFAfFA fF AHfFHA $fF AFAFAFAFAFA F A$F$AFAFF0F4F8A,fF,A.fF.Q M1FuPV(MA(MQ44V(MA(DfDV(A(DfDGF9~e[^_ÉUVSuPt1҅9quPtvQF u01Fu(V([<t4CF9~ڃv(V;5Du D;5@u @;5HuHʋ @e[^ÐU WVSu]|u|q}|k} |e}uP@)E} uP@)؉E U ڋ PA9*UA9jSVE PEPƃ u1}V{1;]}hjE PF([ F(<tĉ[ E 9s   F(9rC;]|e[^_ÍvUWVSM]}}} |{|wUU }G@9eG@9Y} uE@E EH)E u UJC)}G tVUB PBEPQM Qƅu1Wv}~4^0UBFBF1;} }-]v ][(URU^(EG;} |܋MN8e[^_UUB M)PBM)Puu RÉUE19uȉÐUWVS}u$EWt\M QtIjjӣEt3jLj轣Ãtj W詣C(uSr1ivfCfHfCM IfKEfCMfK PBfCHfs CC }uB9u B9E KCCCCCC C$CCC0C4C8fC,HfC.fCfC@fCDfCBfCF19}"u NC(IfDC(ftA9|}uGUU PA9u3K }uA9u }uK EPR9uK PtMYt؍e[^_ÉU=xtux@(Ptt1U=xtujx@(PZt v1Ux,P}t "x@0t@ǀ1ÉUxXP5u x`\1ÐU=xt]xXP0=Pt9=@t@x t jZPx u jp1vÐU=xtI=Pt-jaPx tjpNx,PÐUh 5ÍvUh QÍvUVSu] h uqVIPӉP tV ~ Pxu-S ƒtPPS%PRVqe[^ÉU WVS}E t55Ptux@x t_F1v[^_ÉUVSuU tPt FG[^ÍvUS]C=w# PC1v[UUE t<u B$ B$1ÐUUE uB1ÐUUtE B$ÉUUE uB PÍvUSM ˋPÉt%x@t#ux@tu1]ÉUVS]Ppw_9u t' t9evu]x@xPt/pP?x@x@tp@(x@x4u 5vx@p4Ppte[^ÍvUUPP1ÉU WVSu] u1<C 9u,13VusVte[^_ÐUPp,uÐUSEÄt x@dt du+x@`t`tPx4uP@41]ÉU1҃=xtEx@uux|t%tx@xTu tÐU1҃=xt6x@u tx@xXu tUVS1۸=tKv<2w'Px2@4P,PC<ue[^ÉU WVS]EfEu >=hf;tj;[{t8Cu ;빐j jlCtÉ`j jPÉ߃uGh_j j,Ãu%ht9;Su#CFuEfC e[^_ÍvUS]x@xtwS cnPغh )p~vlPtЃK=tx[ u 1]ÉU=Pt P@PUÍvUM=PtVPt4MjEP=Pt P@@PEv=Pt P@Jy B;B| t  vRQ1ÉUhx[ juÉU WVS]}tu =xuEwEx@;Xt;uEExBxuJB fx t@=PtPu)nP¡x@ @ 9|E1=w%1=w%1ttPCѐ4;.uOC=w%1t t0C=w%1uۀ;*uu C=t;;$tP]C;Sruj$׃j<׃ g1ɉ=w%1tLPCѐ ;.uOC=w%1t LC=w%1u۰;*uM C;*t;/t~1}u }ut!gfff)P;t Cyv~*}u}tgfff)P^tx[ 1e[^_ÉU,WVSu} EfEUfUNEE)9|9E)EvF([URMQ4U4K;]}])9}9)E1Fu$[EvF(MM BF9~C;]|΅]E)99E)EvF([URMQ4U4XC;]~])9~6)E1Fu![ F(}HfCEP1e[^_ÍvUPf^u Pf\uefǀ\f^u fǀ^Pf^P^f;\u fǂ^P^f`JvPf\u fǀ\Pf\P\f;^u fǂ^P\8U1UMU t A9}A(Rf|%ÉUSEt*1@u"X(HRf|t  B9~1[ÉU WVSuM ]}t| |F9~kʍ9}`F9XىMN(Ru fD fD^(R t FfD fD B;U}F9~1[^_US];DuC^+vS'u{t H@^C]ÍvUWVS}t E@ t UR fUMYHQPQPQ(E` PfUfEfXHf]Mf;HHf;XE@R(<E@MQ(Efxty@EE9E~EURfUu‰;ELUދ;t,fu fwfwf;w}fw f;w~fwfEFM;M~MfAfAfEfEUEf;PHMf;J)Ext @H@Uzu"HRMffQHfQ fQfPHMAB1e[^_ÍvUMMb)‰U)Ѝ))ȉ)эEPjP1ÐUSExxt6fnx@t l؋]ÉUS]t*SQS;xu x1]ÉUS];`u d>|.19u Aw9u닂d[ÐUSE|/19u Aw9u닚[USxXPhÃSfn=xt x؋]U WVS]3{C @tf;s}c C @u f;sf;{~ bvS_Eƍ@S(fztf9z~fzCfBNj C9w U9vS1e[^_ÐUE@ÐUEM P u@t0 %v@0t0 Љt0  ЉÉUWVSuE @u#ۃSuEx^M V uFt0 "F0t0 Љt0  Љ@V(fzu fZfZB9}fZB9~fZ CF9~BN @ff;F.~$F.fFfF~jVfFDvf^8vFEE t*  E=)E~u F.9Et F9EE 0 EF;Ev}ӉV uFt0 #F0t0 Љt0  Љ@V(fzu fZfZvB9}fZB9~fZrx@(PtY EPhht@x@(P} ] 8u S 8tʃ;E>E;~>(x@ fx~f8~@x@ ;~> PxP fBxP fx@ fx| @ e[^ÍvUEPEPj=PtPdtuudÐUVSu] j/VTt1tSPV$tSVOuE1f{tvC<}BC9|1f{ tC]vR  4%uh^t Sփu Sz1PEPSr=t,t‹ƒu$[^_ÉU\WVSEDž11t~9vl31tSFu(01Ph5kG ~!31Ph 5k u~( Jx Rj U0~1Dž, Dž;B(010‹IL,D4ƅRF[ tPR4;t-hQ30tƅu}1 EPPP!udhLÃuh[ߍu C(Rƅu>(Rh cZI;H(StQ1vNz(Dž;J(}+0Ix(A;H(|؃RQVfx(t4Ã0B(H@4Q1TH(uӃRQ TxtpKz tr 1ytq  1ҋfxt#A<uBA9|1ҋfxt(vA f }t}tN}ttvEF"EVUN"M^$F$ȉEFEV"F$‰U^&N"F&MF Eq^"F$F&19sCF4U Ru#F"V$9wF"9ȉMG9rEv1}E9sfE PF4nuE|?}+UU}t}t )}t!E,E'EvG9r}4}t_ }t}fF"fFFPv@\F^K;]VDK;]w~fF$fFFPv [F ^K;]vRV DZfZK;]w ?uvD=Dtb5А7duAhw"Ãt.}u ww7hn> ?u5АÃuq=tAEP5АUR:Ãt&= v5Аh=u#}5Аh=}M9Ku==Аu&=%P!PjhA}uF=Аu/=%Ph!Pjh!à t}u{u E_v}Ct"t "t 5АPh <h} }t~}}Ct, t*t3S]C SMA fPvS]CSMAK]S ԐfJ5ؐ=u!CEPV5А9%ƃV3S]C \w7h;Fw7h`;2}uhGq;,=u:PEt AEP=U29P:0} =umEj+M1%tE71ۋE;X(},j+[E,4%uECU;Z(|փEPMQ}v]SH EP21e[^_ÍvUMU u tu 9$uGyuAǍv:$uGzuBǍv9u :u1:u ABKv)‰UUtE EUEEPu6ÐUWUt#װuPu u}ÉU<WVSE UBu((t(0‹MA]Cu%,t,0‹CUBxu[B fxD~6@DPhhSOSb0‹MAP hC0‹]CPUBx8B fxH~7@HPhhSS/‹MAP8 Lv]Cx%uh/‹CP8#EP4t4t 4B8MQz,0t0t 0B,i]Cx)t[C fxF~6@FPhhSS2/‹MAP, h/‹]CP,EP@x&0t0t 0B,nUBx)tbB fxF~:@FPhhS{S.‹MA !vhk.‹]CUBxBx)uVB fxF~<@FPhhSS.‹MA +hvUBx xt~tutlh VS2MApS2 UBS2V_-‹MA}]Cxtyxtsx,tmx,tgh VS1UBpSE2 t3MAp,S,2tV,‹]CUBx+tx'u MA@]CubC fxJ~:@JPhhSSSf,‹MA !vhC,‹]CEP fzu@x*ufBUBxuh+‹MAP]Cx*C fxt!fxt@Ph3UBtPht'MA2Pha3 9]CuhH+‹MA]C f@UB8_8Rji8ƅt ymMA8v)Dž\8t)װH9u׃SVRLuŋzuVSh@Z2Ay3h21Ãhpƃ tuh2vSMA<u3h1FMQ<tP4C4fV]C4"1P0ph|1 fvS]C:t':$uzuvAB:uP+)V]C Fj,V*t4EP4u% t 4UBǀ MAxAuh(‹]CUB<uhc(‹MA<]Cuh6(‹CUB@t @ MADt D]CHt HUBLt LMAPt P]CTt TUBXt XuhMA\t \uP]C`t `u8UBdt du MAhhthVS+UBHS , MALjjSZUBHjkSC MA@jlS)UBDjmS MAhjnSUB`jqS MAPjtSUBTjuS MAXjvSUB\jwS MAdjxSetbV%‹]CHh -tŐEP4u"j8 9zuB9u C<u냍ve[^_UVS]1Ɋt$<|t Awt<|u縀[^ÉUWVSMtnv9tf] AC;t:t19t0vU:t:tB:t :uu1A9uӅt ;u Au1[^_ÉUWS&=uzhAÃtd߰Ѓ =wJ߰Ѓ Puh*Sh5l1e[_ÍvUW}tw赣?t 7裣tw菣 tw {twgtwSt w?1 }UEÉUlWVSE=*t+*h*@(**O t  ǐc ƃ t t t\uG t t tƃ=*:u :u ƃ.u)=ܐu Evƃ.t t tvVБv4%ub.u =ܐuTPhu:VF$Phh ^' *P{v=*i=ĐȐ(̐<,u*,\u t t tƉCƃ t5uhU'v:u:,t*:=uH*:UhhPh;&v=uvK; t; t;,tCj|hÃuЍ3h%j|hYƃ t>uhc%uЍ9s]vRtv4%@;/Ph8C9rА/vV 4%u=u _u;uCƃuC:t='#,t=3@t2y*9t h@@%А1nvO*9tV Phh$ А&v1ƉvV 4%t D/GNv]jEPSاǃ9]uhh#E8u *9tha#А=Ԑrvh&Sz*9th#Аؐ) VPh" }uÉ؍e[^_ÉUWVSuEEE_^}%É߃uhV#w)vWf 4%uWPh#" ?u'F= h!}s\[É߃u!h"P GЃEEÉ߃uha"CЃv3w%1tSh@K;/K=w%v1uڀ;.tՀ;*tЀ;\u#~^t~,uF,h,>$uO~.t>*t >/t>>uFǍvN>%u"~%uh]HEPl>%u},h,IEPEPh`HV葘u!j;VƃuuEPEPEPh|HVUtTEPEPhHV:uj;VSƃuuEP7EPEPhHVu-j;Vƃuu}W>E؃ vVtƃhHEPQEPhHV薗tEPhHV|uPj+Vt>phdF}WE؃}tEEuEPvjhNFVuhHjhEVu!E}hHEPljhEVuE}whH4FN7$I,%h,EP,%h,}WE؃=w%1tF,h,EP뻃PhH#>d1hFvhHEPjhuFZF>1u E>2u/}us}umhHEPJEEMv>2~E1bvh2F}WE؃%v,h,EPE؃E>tF>t ;u1}u\-e[^_ÐUS]fC,fC'fC fC"fC$fC&{uj,>C{ ujN(C {uhxC1f{tvCBC9|1f{tvC fPBC9|1f{ tCBC 9|=]ÉU WVShjÃtߋuEPS؍e[^_ÍvUWSU=װ׍;=wR-PE==-e[_ÉU WVSu--|1f~ tF~N <u #F DQ(1IA~vIP4[^_ÉUWVS]} P&U)؅}H)R PRPu)9)؉E DQ(v1IA~IPv4%@tC9rvRA> 4%9vR > 4%teCɍvvR=v4%@u1vR= 4%uC9r+K؍e[^_ÐU WVS]hLC$1C$C(C,C0hL0ljǃ ǃ$ǃ(C$,ǃ@DH h!L4ljC$<48\`C4C8C@C<CD"ǃTǃLj(KP1e[^_UEP$P(P,ǀ ǀ$ǀ(,ǀ@DH<\`@4@8@@@<@D"ǀLǀÍvUS]s$KC$C00Kǃ0 4Kǃ4PKǃP S]ÐU WVSu] ߰ЍPt F,;F0r#RV;tV(CF(;u1e[^_ÉUVS]u ~'C$9C(rVS&C()C(;C$sC$C(e[^U WVS]} 1E}EPST7tjS%vE< t <t< t=<t<u4C$C$C,C(iC(K(C(C,>N2~S_cE>FS(EC(C(C,S:E4vE>e[^_UUB(;B$u1)J(A;B$ry tvH;B$r8 uR()‰HÍvUS]S<C,]ÐU WVS]} t C<C,;C0r ${<un{4t80$C( $0$jSjSC(C(C8SgD v{4tJ1;s<}$v0$C( $F;s<|ߋ0$s]ÉUÉUuU1ÐUS]Eǃ C,u/hs$C$S,)‰C<Sh<uESTSd2}u1]ÉUUǂ B,B<)ȉ|R%ǂÍvU WVSuEdž@dž F,}džSvu/hv$F$V,)‰ jjЃtX1ۅV>;cjjЃtX1G;~-vGjjЃtX1ۅt>V$F,)PRSSuF$V,)‰Ѐ<tSV=tE}tVK%e[^_ÍvU WVSuEdž@dž F,jjЃtX1ۅVI=nvV$F,)PRSYuF$V,)‰Ѐ<tSV<t}jjЃtXv1G;}u}uV<u EV %e[^_ÐUS]S=S(: uJ;S$r%: u K<{<~'vJ;S$r: uK<{<{<~ )vJ;S$r: uBI~ ;S,s: uS(]ÐUS]SS(;S,s#: u K<{<~%B;S,s: uK<{<{<~ vBI~ ;S,s: uS(]ÐUVS]C$C$C,C(jSC( C(C(:C(C( C(S- VS 0C$C$C,C(VS$t[^ÐUWSh;Ã1E @C ECuCSHJ ShS SSj Sb9S= S&SECǃv1e[_ÍvUS]t|SySdJ SgS SS S9S S-&SE 3c;SZ;]ÐUS]SmS]ÍvU\WVSu} M E$l1V%11VyT!1VE9tNf1AEt]vB AuG$EJEPRVEOEPRV\EVEPRV]jE\EPRVK_REcEPRV?m:=vQA1PRVR A1PVZ e[^_ÍvUE$ÐU WVS}E uC-=uQhx;ƒt;hRhhS茋؃ hP1ƃuEbVa퐋| uRW9 ÃtÃPVƒuV5a1[^_U0VSu]SDjSJD EPSj;EPEPVT tuuVyUjEPj~;e[^ÍvUUE ÍvUEu1US]C(;C,u2;C$ujhSiM4Z0SQsu h`vuE8uhs$1uPWEPVqe[^_ÐUVS]M u< u5;\u X<u;Xu\<t VS e[^ÉUEU :uhpotRP1UVS]u u>t1"jVS(Vh se[^U WVS] }u:u@{ t&WEPt 15[ эvC{tC{t[믐e[^_ÐU WVSu} :t<~tF[{tC:u{uPCsG?~ tv lF Ftt,"t#u~tv*.vEF}t  }t *t!UFGE0F3-v~ uPNF UREPWv 1e[^_ÐU WVS}M 1:t,ڃ{tCRztoB:uzt`֋^A9u t*/v{ tFQC Pu1{ u+uCCFCSv1e[^_ÉUS]tk{ ts C sCtt+!t#u{tse)o,vSO)]ÉUS]j4(@@@ @]ÐU WVS}u ]U>uRSW1xv:uZPRƒ{ tF[ B붐~u>D"DsCPW1{t [se[^_ÍvU WVSu} ]~>C"Dh@vhvv~uuPSƒ u.D"DwGPV5vBPw V@t SwV*1e[^_UVSu] MEtmt t.XuSuRP1Pvt :t8;Bu2S5\v߻ *vhS5\v[^ÉU WVS}] uu;^C;@vvVK 4%t";^Cu ;?v$ @^u;\C;^\u;\C;\ tQvV 4%t.vVv4%@u%;\C0;C$0;C$0;؍e[^_U WVSU}] ?t] C:u^C@Cvր>vRv4%t^C>u ?$ @>^t>\u\Cv> tYvR 4%t2vRr 4%@u$\C$0C$0C$0CF> ?t tGCE e[^_ÉU WVS]h;#Xh(#\ǃd`ǃh`ǃl` hD"Ɖthl"Ɖx [ǃ|[S1e[^_ÐUS]X|#ǃX\d#ǃ\ǃdǃhǃl t+#ǃtx#ǃx]UVSE\vS 4%t3C~ɍe[^ÉU WVS}\X1ۀ>/tC<3/u~01ۀ8/tC</u~puƈ]E3t8 t1"t($Ej3PW PEPWvC~E0e[^_ÉUWVS]\XElMhǃp`S1҃M 2:M B~SjSN S Be[^_ÐUWVSu\XEddžp`VJ1҃:E"B~VEVEEE jj(VPEPV:jVM VWAe[^_ÍvUWVUE ƿu R"%ƿt Ro1e^_ÉUVSu];t{uXhPSct9t?E v9At 9u#1Phv讴 SVV[^U WVS}u M]Ȉf؈f<1"u;9hPPPhwt:ti19BuW9tc2hPPKPhPP,PhǛw觳? :u!v2hPPPhwf[^_ÍvUVSuhۛv=11ۃ\:tCPQRVكC~؍CPQ\Vchv11ۃ X:tCPQRV2كC~؍CPQXVh v蛲 hV>h&vz hV=e[^ÉU,WVS}Dž}u v\DžDžDžMQv:-B$vXvDžDžzDžnWWKt;s3h:wR ;uBPU2hBw)FM#E<uW|u3U4FPyÃuM1h`EFtXtSW;v{u<uSW"E<u3tSW;vSRWt$wvgM4PvuE0hvt'RQWPSWU:%vPRWPSWE4WMuU42hœw&t'QPW8PSW9kv{t2RQWPSW`1SQW vv1[^_ÍvU WVSu}|} t }tu Pxbx[PtGt|xt:tu߀>t F>uN9us~ tu;t C;uK9s{ t]E8u ?;uv 9vNK:tFuC]u]܉u]؋U:tjE;}s^vU:uNu;MsE9sFA;Ms ;us:tE+E܉)9}҉)9~]܉M؋UUuC;]r?tiEuU9sZE:uL;Ms;}s:uvAC;Ms ;]s:tE+E)9}҉+E9~ }܉]؉uMF;urE+E UUEEU)E+E)‰UԋE+E؉EЋE+E)EЋUBPuE}~EEEUU܉U؃}~ EEUUU+UE)9} EEUUE@PuE}}UUUEE܉E؃}} UUEEU+UE)9~ UUEEE+EUUUEE܉E؋U)E+E)‰UԋE+E؉EЋE+E)EЃuURME9Et9}}+E EԋU;BH+EPRE9EtcURWEPURWEpHE+E PU REP0])+]SUԍ4:VEPuSVEEP])SWURQSWEPc}u+u VURCE9EtP]SURBSEpHVU RP0])SWEPSWUR ;E)PWEPE+E U+U)PURN E}E+E EPEPU9Ut2EPEPE+EPUREP26E+EPUREPE+E U+U)PUR 9}u+u])9}+EPEPU9Uth)]ԅ~3SWEPURWEpHE+E PU REP0])+]SUԍ4:VEP\SVEEv])SWUR9SWEPK }|qE+EPUR3E9Et<}~UREPUR"E+E+EPEEPEPE+EPUREPe[^_ÐUVSMU u1 BAC9s:u9s  AC9r[^UWVSEPHU@$EvEF u1 ut}vFuovSK 4%tF;u~>6vS 4%u ;u~+uG;u|1GEEU;B(HWURVEP :'e[^_ÉUVSu] S&VFFFF;FH|$FF j &j &e[^ÐUVSuF(X t;F,tV3vS  4%t&t @?j^V/vvS 4%tSVMvj\V0PV 0PV؃0PV %e[^ÉUMAA1;QL}AB;QL|ǁ ÐUVSuFPtKjV1ۃ; %vSVvHV. C; ~ރjV_' VMj $ j $e[^ÍvUS]hǃǃƃǃ1]ÍvUS]`ǃ]ÐUWVS}] SWntAjSuVhu&jjjWVf ؃V1ۉ؍e[^_UEu vUWS]CD<1pu`;X%C(+C$=~ ǃ|+s$$He[_ÉU,WVS]C(EUEEU} C,D;C0 u3:.*EEC, C,u S,FC,>uS,C,p9sS,FC,9rC,SEPS tjSB%XE`'wr$vE S,EC, EdvETv41E<t= <t<vEvSOvF9C(DC(h js,Pƃ,C( S,C(C(C,9s(s C(8 t~SEC(C,S<TvPho$9vEhSEE C,K,C,;C$v8 uC,}HE]N;v>[t>]uE}[}tg;} ub=?uIt ǃ ǃS-<u SuC,C$vC(uH@C(.*C(;C$r!;C,wW@PSE<uVSDu jS袻 jS=E}t(uC,vC$C(W@PS0}uASE9tS<US(?:WSE<u=?u }:uE}t }uZ}uTEU쉓E9t Su<u /vUS(}u Sk}u }Ee[^_U WVS}ƅ.ƅ*G$G$G,G(E jWG( G(G(G(} u/v?WPW"p uG$G$G,G(8.8*hPSw.@*hSPL.* 2.F*FhPE GDG$G,G(} ujW觸<t&jW9<uWy8t&WWG, G,G,W[^_ÍvU WVSu} }u/^(;^$rKvWSu K;^$s/v^(1*^(vWSuC;t;^0re[^_ÍvUMU QDA$A,t t+vjQ5%jQy%ÐUVS]u S(MIt9uJ;S$v9us;S$r u9t:9u}tBS(@uS)1C(S<e[^UVS]u S(MIt9uB;S,s9us;S,r ;9u}tJS(@uS1C(S踧e[^U0VSu]SVS  EPSjyt tDR5%j5ִ <u5I$v5.5(1Ƀ=t#;5tvA<t;4u4VNjEPj Vjxe[^ÐU0VSu]SjS jSjS jSjS jSjS jSEPSj j$1҃=tB€:t 1BA:u苅B9rMyT󥋅UBX=~hr.MQUBXBTP>UBX@BX[^_ÍvUVS]sHSC`@HCH>@FS e[^ÍvU WVSuHF@P1ۃ;^}@PC;^|FExF@PX1ۃ;^}@P@C;^|FEx e[^_U WVS}wGt+>tv3;uVw G t'>t3;uVe[^_ÉU WVS}E ;G;GL+w~R~%W\z|tB|8th VVVr|r19}j NC9|GW\tP8tE؃zhtBh8u.h PPPG\N/P@vG\xht4@h8t,1ۉ9}"ލvh jG\phWC9|E Ge[^_ÐU WVS}E ;GGH@9E } uj [Gvu +wFv*W\zt!B8th E PPPr~3W\t'8th VVVvGPtEG%U 9t09}u j 9|E %GWE )POGRWڃ~;O\t/8t$h RRR-PbGPt؋U M 9 &;E ~j G^1ۉ9}ރj C9|E Ge[^_U WVS}u ]~ GH@9PF GKue[^_ÉUVSu] FP;^HV\zxtBBx8t:ztB8u'h SSSF\pxr,PvV\z tB 8th jr F\xt*@8t"rh jF\p_sV\z$tB$8th jr$4e[^ÐU WVS}u ]\GPR;_HIW\tS8tHz4tB48u5h SSSG\m+PSVWAW\z8tB88twz(tqB(8tih jr8o_PF KuW\z<tB<8th jr<2h jG\p(bW\z4tB48th jr4PF5 GW\z<tB<8th jr<Kue[^_ÉU WVS}u GPt'W\z tB 8th jr t19}j C9|we[^_ÍvUS]S\zt!B8th C`preS\z0tGB08t?zt9B8t1h C`pr0h C`pC\pj j ]ÍvUMQ\zttBt8th jrt|4Q\ztB8th jrU vjU<WVSu SvjS PSjVuh ƃt>uUzd1Vrd(ǃuhEpuVhUrzh MqzzUB`@PB`@@ MQ`BBК=КjSEPU;uho+‹MA`hFX+‹MA`P hV=+‹MA`P h-%+‹MA`P hk+‹MA`Ph~n+‹MA`PК =Кt*V3+PSEP ;u܋UB`x@PMA`x@EP`BMALBAHQPPEPV URjPj MQy1[^_ÍvUWVS]} uC`@C`@EPhht@s .tEfxt@f}tEEPhht@s tEfxt@f}tE1ɋS`B;uB;tȍe[^_ÐUS]M UC`~P v@PC`H@SS*]ÐUE@h?@@@ @$@@@@ D@$@(@,@0I@4@8 @<@@O@D$@H @L@PT@T%@X @\UWVSu^hsCEPhDVds CEPhHVO st<>u%EUt DPS]SͰ>Ov<>"uISWEP,EU| u D>EUt DPS]SxE} e[^_U5@uAÍvU5@ÉU WVS}hXwqrhqwar G`pphwHrãGP@tPhƣw$rݣGPtۣPhwrК_\=КtR;t$8thP3;P6vhwq >uwj !1[^_U WVSExxp@EК;t18&U3u/ãUBPtP5pMqnu8uUB`ãx tR봋u=u EhBp{nuMпGtLuUB`p5tr-n'MRuUB`pljК;t4M13Qu-КuV\;uPE0 t :uPM1h`31;tLv;%u>CMw$vG$tPhEpmC;utn t vEU:t(8t!PhMqh jVEE8t8u!Rh Ur:1ۃM1ƒEu>t(8t! PhEph jRSRPvtWh`MqkEu>t8uh EpuU2ÃEM9t8uuLh 7E0ƒEM9t.8t'uPhuv.k(vh RRSPP1[^_U WVS]EPs l 󥍃l lPp4t%=%}RPPERE 0:t9:t} E}~ERE 0:t :t} E}~ҋ! ! ! ! 9PP 1e[^_ÉUWVEǀƀxl-󥍸 @fPe^_ÉUÍvUS]Smu SQ]UEU H HJHJHJHJHJHJHJ HJ HJ HJ HJ HJHJHJHJH"JH J@!BUUE JHJHJHJHJHJHJH JH JH JH JH JHJHJHJHJHJ"HJ @B!U,WVS]9EUEfEEfE\M䋻XpulE싓hUvdMEE=EEUMEBUEE:Eu } MQEPSUM M EPQSѤUup0M }t=EPWS衤UM :EPWS膤Up@0: E E86e[^_ÉUWVS]Hw1Ps %=%P􍳘V ;t!VVc !;tt(;t ! ;xt(;t ! ;lt(;t ! ;pt(;t ! ptǃCPRPP1ɃR: uR A1:t1ɾRE U9#u}9}:9t#t A~ȃjS99PP1Ƀ RE Uv#u }9:t#t UA~ƒul Pjs tǃ1e[^_ÍvUS]u1.lPjs tǃ1]ÉU WVS]u1 󥋃! ! ! !  Pjs tǃ1e[^_ÍvUS]t1.Pjs tǃ1]ÉUC $,C 4C (SCC C c${ wcC $@K$C K$뼉{ C $TC$tc$0SwC UCU1C Vvc${ wVC $hP3)t*S 5C\CC  C SC SB9CrCC)ƃVPlj+Kt!1;S} C  B;S|KKs{SB9CB CPs >xC ve[^_UW=`u^ @1@a @@z~A @@Z~0 @@9~@`_ÉUEddÍvUS]:] u12@E @h@h@D…u E )‰Ћ]ÉUlWVSE UUЉEԋMIMEEEEhE(E Eu]s cccCC{u=;tj 38j 芵UM9f(]C u6u؉uċE9E''(vEEE}t EUЊEErU%$dvE@9Et#MuQu]S(%u‹M)@;FӋu~'FF=vFUr28Mx'9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]'$u9utEuPVu'($U‹M)@];CӋu~&FF=vFUr2<M|&9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT] +#MME:#}uu %#EEvEEE}t EMЊE}*tf]u}+tX}?tRzv}\mu9uEEE}t EMЊE}+t }?0]]E}+t E€}?t ‹u9uN}$U‹M)ȃ];CvӋu~$FF=vFUr2TM$9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR}tE@]EP}tuF.9t v.uo}tiE9Esa}tEME}t]C 9t 3v u+u@u E+E؃PEPj #EE+E؃PURj#EM‹])ÉӋu~:#FF=vFUr2̱M #9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]S+EPuV}tP"EE}!U‹M)ȃ];CӋu~2"FF=vFUr2İM"9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]SjuVj!]؃!vE؉EȋU‹M)@];CvӋu~>!FF=vFUr2ЯM!9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]Eu9uU‹M)ȃ"];CvӋu~V FF=vFUr2M( 9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ";AR]؉]ȋu‰)@;FӋu~FF=vFUr2M\9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;ATME؋E8^uE8^uE]]܋u‹M)@;FvӋu~FF=vFUr20Mp9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT] C]؉1{u]tu؀NE9Eu EEE}t EUЊEEtT}\uNM9MBEEE}t E]ЊEEЊMu2wv}]u E@9EI}t}-uHE8]}-u6E;Er Ex[t"E;ErEx[ux^tE8]uE8-uAx]t;u9E萃EPURMQ]SEPH Ez}[pE8:du9aEEE9EUvM9M<EEE}tE]ЊE}:t&}]t u9ut}tEM E뫍vEU}:E8]пEE$E*E0E6E<EBEHENET߹EZE߹<0ZtvNtcBtPHt=6t**t$E9EEU9U1ې}t,vSy 4%}t.vSG 4%}t.vS 4%}t.vSߖ 4%}t&w%1T}t.vS 4% }t.vSK 4%}t.vS 4%}t.vS 4% }t*vS试 4%@uT}t*vS 4%u$}t8w$%1tكM CEr]tEHM}uEu؀N NECvEEЊMM v]؀{tC|uuNt F|tUB‰UAM v] lvuf}E%=E9Eu WEEEEكUa$0U LMAEE;Eu-EPu蠤E]ۉ]EUMċu+ EM}t E+@DDEUu؋]+3t EUMLUME+D‹])É؃u;FӋEx"P҉Pv @vMq1谣u9tBE)؋ЉE؃}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)Ѓ;CXuFEFFuEEEU؉UEM }urA}]‹u)ƉvӋExP҉Pv @vMq1舢u9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)@;CPuFu؃EЍDPEPj Z}uUq-MEU] 4Ήuă|t LIM vEEU] t Ήuȋ|E9LȊU(ʈ‹])É؃u;FvӋExrP҉Pv @vMq1u@9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)Ѓ;CNuFFE(ЈEM]‹u)ƉvӋExzP҉Pv @vMq1uH9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)Ѓ;CNuV+EăPEPj&Eu؃}t+EPURj M؉M]‰)ƉӋExfP҉Pv @vMq1u49tBE)؋ЉE؃}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)Ѓ;CXEEu؉uCE %= E;Eu U9U ]MIu9uuE pvEEE}tEUЊEE=w%v1t.}}EuEDPЉEE9Et대},uvu9utbEEE}tEUЊEE=w%v1t}1ۍE\P뙍v} ]}|UM9]Huu7}\E9E!EEE}tEUЊEv}}t] }u!u  E؉EȅU‹M)ȃ];CӋu~ FF=vFUr2(Mh 9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]S+EPuVj I ]؃vvE ~EU‹M)Eu;F׋Ex P҉Pv @vMq1 u` 9tLE)ЉE؋E)ЉEă}t E)ЉE}t E)UEȃ}t E)ME̋uE)E;FNEPUR~ +Eȃ v+EȃPMQjZ E uVEPjURj; u؃ 0KSE)PVj VS+EPMQj u؃0vM]96 ȊEE}tEuЊ0E䐋EkU9U_Ex\?Mf>M؉Mȋ]‰)ƉvӋEx P҉Pv @vMq1Pu 9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)@;CPuFu fVE؉EȋU‹M)@];CӋu~ FF=vFUr2dM 9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]Sfnu‹M)@;FvӋu~FF=vFUr2脗M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]sfu‹M)@;FvӋu~FF=vFUr2褖M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]fu‹M)@;FvӋu~2FF=vFUr2ĕM9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]fu‹M)@;FvӋu~RFF=vFUr2M$9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]fu‹M)@;FvӋu~rFF=vFUr2MD9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT] fu‹M)@;FvӋu~FF=vFUr2$Md9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT] u@,EЈEE;EPuuu-U؉UȋM‹])ÉӋu~FF=vFUr2MT9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]CEC]ZU}t EMЊE}]D;Eur;tmE8*te8^t`ut8\ux+tJx?tD E8+t:8?t5EtE8{tE8\x{U؉UȋM‹])ÉӋu~FF=vFUr2茐M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]CC]K]̋u‹M)@;FӋu~"FF=vFUr2贏M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]u؈Fu؋EU9U7}tE+EPMQj m}uTuQ]u+3s1? 6. & e[^_ÍvUMU E BBÍvUS]M EUAAQQ[ÐUS] UJ9t IJ9uuSu]ÉUS] UJ9t IJ9uuuSuw]ÉUS]U ;Uvz\1:(u uu:|uf|t[ÍvUVSuU:\ÍB1;E s1 t :)t-t t9)tf} :|tvtt 9|u[^ÉUS]MIxU9\uIy1[UWVSU;E u vHMMQEP~1ҋEt 1ۉSURMQSo}tËUuƃ}tËMvE8}t&ËM%)ˆӉ%)C<1e[^_ÉU,WVSE@EUUMQUEEeEE1҉߉@EH`U9Uu:},M9Mu(}GU $gGEMUEUMAM$}OUBM}74G}v}FM}F$)ljsENyLU2vMF~}74G}v}FM}F$)ljrENy1 @<uUF~1 @<tMF~1}>F~E@ @u G fUBWM1Aƍ|}<?t ?.EE0@ƋUtu}UE9tMM1AƃM;EsjU;UuBk9EwJE$)ĉPuSˌ]t}}UEu4EvEH}tYEEOEMAƒMu1ME4EEvE}}E9E}UBM $bB1e[^_ÐUEU Mt`H EBEB`BBÉUEPuuuPu jjuU,WVSu] E@EURUMMM39} ;E~])}t8 u~ }t'E@uPQu yr};uUBE];u}3;E| E))M;u| E+EU }t5;]~W} 8BE<uCK;]~= }9BM<t';]~"B}<8uK;]~ BM<tE)A}t;u| +E}8U }t%M%E8tJ|;uu}t }GtGE(PU$RVMQ}WEPU RMQY tt~KFCNe[^_ÍvUEPuuPu jjuÉUWVSU$EEЋMAE̋Y]ȋqFuEEEEEEEEEEEEEeEEy$)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe}}}}}}}}|}EE9EE}9}sIEM]u}M $$$@E]9r}u } tu u}}E EE EEMMM;UU U]]uuU})U܃}~E9EU UU؋MM]]u)]؋}܉}ԋE9E@U9U}}tM9M w E E9v]9]0Ѓ}tt u9uwx}9}lEE؉EEU9ULM]u}UAM]9r!}tXuu؋}܉}ԋE 9r U9wMME]9]s)vu}UM]Fu}9rڃ} E@@uYE@sU PjM APV] C{ufN\}GuKE@U 9s@Pr褁M APq荁] C{u >t(F}8VE9Eu M+M E+EEEM Mv]urދU+UE9Et E+E)+U UEUBUЃq$] MC]Ѓ}tIu9uu}9}HEE؉}9tM]ЊC]AM؋u82MuA}9}uE9EUU؉E9tMЊAMЋ]؊C]8MuEU9M  @;Ev]9]uu9u}}؉u9tE@ @u*}tUMȀ< iv]؀; Xu~ }'}t}UȀ<u5M؀9(E]9u  @;Ev}ЀËE9EuU9UMM؉U9t}tu}Ȋ 8vE؊ыu9s%Tȃs}DEЄvEU9UM  @;Ev?]Љ]uu#V}WEPS$EMt]MUuEMU}EMUuEC;]vċUEM EUE]EUEuu4EUE}؉MUuEMU}EMUuEC;]vċUEM EUE]EUEuu4UEBEUЉUM9sJЀ8uE]9]s6E8tu9us&U:uBEBE}uJMU+UE+ED@9sjE+Ep]čD[9EE$)ĉPuSBz]}}M+UDv9r]E9w>MUuEMU}EMUuEC;]vċUEM EUE]EUEuu4EUE}؉MUuEMU}EMUuEC;]vċUEM EUE]EUEEUEEU+UE+ED@9ssE+Ep}čD9Ew9E$)ĉPuSv]t EEqM+UDv9r]U9w>MUuEMU}EMUuEC;]vċUEM EUE]EUEEUEEUBEBE}~"MM EBUv}]CCUBEBEtMMJEB/vEKvuFÃuމuUEBEUЉMUEB}t] 9] u9u}}9}EH;Eu U UJEH9u MA v]C @Ћu9uu}EH9Eu MA] @%9G}tu 9u }9}}E9EEH;Eu U UJEH9u MA v]C @Ћu9uu}EH9Eu MA] @%9cu9uu}EH9Eu UBM @%}t] 9]; u9u,}"EH;Eu } UJEH9u UB vMA @v}t] 9]uu9u}EH;Eu } UJEH9u UB vMA @L]9]uuEH9Eu }GU @=M9M1]9]uu9u}}؉u9tE9Eu UvEH9Eu MA] @EU9vM  @;Evr]9]uu9utt}}؉u9tE9Eu UvEH9Eu MA] @t1EU9wvM  @;EvE3vov}MUEtEMEUEMEEMEEM9r=MUE]MUEuMUE}I;Msă}nE9EsVMЊ<w <s < t A<u<]C]@EMtE8 E8] 9],u9u }}h[^_ÉU WVS} uEU9E<<EE@E)EE@ÃEE| tE3E| u'VE؃Pu}tl]E8tEX@ÃVEPuIt8]*UE"VWEPt 9}1e[^_UVSE] uE9sBE8tVSEP:u 1&vEE@ƒEU9]re[^ÉU WVS}uEEw<$pEVu EP>u $$uq1wE@ExMREE@EuăEE@EMEu 뙉E둉Ee[^_ÉUWVSM}u] tCF8::tIu1[^_ÉUMU E``HP5dRQ賱hÉUWS]u= Au 1}= AuChg At#$Ahg0Au%1 te8t^EEEE8_uEEPjj2etCCfCECG ;t8u)ЉЉ)e[^_ÍvU WVS}E 蓇jE 1RPE lÉփu.u)`8tE PhjEPK!WEPE VkÃ}h&jEPz9sh/E0PhjEh&E0P5uEPE PEPÃL9v舆jE1RPEkuuY8hSVEmjÃXt ] )m+Ee[^_U WVS} jE 1RP DkÉփuuƅ8t E PhjVEPu iÃ}h:jW,;]shD7Wsvh`7W\e[^_ÍvUS]0t&08t 0_0_]ÉU,WVS]jSǃuhv0EEEPS5uuE EEPS t h^jEPE)PSt h"8hSjhVuS} =u71h63Se[^_ÍvU WVS]} |hFv08u E8v}"%?ЋM@) %j1RPhuu hcFjEP`gu Et-E%U)%hu3ShWhjS1e[^_ÐUuu uÍvUlWVSEEu EE}ttjd[Ãu1HC C$C(CDCHC CCC@C8C<jjjCLCPCX}PZCT JURsTgC\9mt]>ruC\r>wt>auC\w< w ЉE,>fu E>hu E UBUFu{\{\wuFj8hEPjjjURSwƃ h@ZCHC u4zh@YCDj8hjSƃ uN{DtHC@Ԁ}}EPEP$EPUR C@{@uS{\wu2jjjjjjjj55hs@-C` SCs@l+CC`؍e[^_Uju uVU VSu|!Vhj]SVu S'1e[^ÍvUS]t{\wtD{u.CHC s@h@jPĊ=@tC8C@uu Su]US]{<tT{uCQs@h@jsDiCuC<C@@ @tC8뵐CDK]U WVSu1ۉVw;t+tFt FFX~%CvV1ÃV&ǃ utF81ۉVCvt4VÃVà rVutVtutvVtut1ېVcCv1~<tF8e[^_ÉUVS]1u {PtsP{W{t&{\wu SG{\ruS ƃ{@t!s@t;}8t{8}s8{DtsD W{HtsHV{TtsTVt SVe[^ÉUWVSE }Et\rt 8t8u 8u1vG8~EG EGjXtn_;_v_t"S7w Z]UW )_)_tw@wjEPF)GW)UEGGuG<EuF<u@{w@h@jwDGuG<G@@ @%GDjWa G8u~G +EPURwLdGLG EW ;GLt G8EWW> 8u?_wW _wjjjGL 8u<u G +EPURwLGLE+Ge[^_ÍvUjEPuuUÍvU WVS] u߅t19vN~jSEPuC< u9u1e[^_ÉU WVS} u]t{\wtrC8Sv;sv{tB{u'CHC s@h@jP=@uC@jSC8tVWsLCL+Ce[^_ÍvUSEPu hS~dB=wRSu"1ÉUEU UjURPuUUWU װHPRu}ÍvU WVS1]t{\wt C8vC?vE PSC8u uC81{u{8u{8w2@+st"s@VjsH肃9uCHC C@t1{8tC8e[^_ÍvUS]u S"us@`<1{8tC8]U WVS] Eu~8~8~\wuku+^~DuJh@PFD1)@?؃PvDEP!tb)ÅԋFu^|H~Xt*FFDjSv@|$^^u;^sMQk} T+^tI~Hu?h@OFH*@?؃PvHEP~)ÅԋFe[^_ÐUS]t{\rt^C8C<CCDjjj@CL{`tSjs`s@s@!1]ÉUjju ÐUU1t z\ruB<ÐU WVS}] 1vW%P+F~e[^_ÍvUVSuV$ÃVà VÃVuF8É؍e[^UVSuu@{\wu1jV3usLs@.ss@ VHe[^ÐU WVSU ]uСC8u òò:tst>u+C84{PtsPzN{Tʉ)POMCPsTPdZ hIJsP[VsPZCPe[^_ÉUÉUWVSM] }u 1у2Љ3 C2Љ3 C2Љ3 C2Љ3 C2Љ3 C2Љ3 C2Љ3 C2Љ3 Cdtv2Љ3 COu[^_ÉUEtxu <@@@P1Ƀz t jP@pX1US]t {t{$u 2vCxtSp,ss(C$C1]UVS]u Et 81u}8t u C{ uC AC({$uC$4Ajjs(C ЉCC@C@ } ދC@ FvSYvCpPC1҃x u0RS‹CPtSN1Se[^ÍvUuu juU WVS]{z;q1} uE EC8 L$Lv{E ECKCPtC CSB;Bv CC{iE EKC8sNB))9t CS uC C{E ESKCBC{E ESKCBC{E ESKCBC{`SKCBSBC0C C&C@uEPSCpEuC C@}uE E}E ESBPSr9Cx t C{E ESKCBC {tVE ESKCBC {t+E ESKCBC {uE`vE ESKCBSB;Bt C6C@C  e[^_ÍvU WVSu} ]]t~tF8t cEPWj;F0t CF0FHtKE)ǃSWFpR'F1e[^_ÍvU WVS}tu G8 t G@_u vGPt7w2:uBv9t1 v)ЉAKtvՉ+G_GPu"_wW_wG1e[^_ÍvUUtzt BxuBpb&Uuujjjju uÍvU WVS]}E Et:u}$8t vtsC{ uC AC({$uC$4A} uE } EߋEHw(}u"~} |}  }|}~ Tvhjs(C Љƃu ,vsEF~(F$HF,MNHFDHFLU %`VPjv$s(C ЉF0jv$s(C ЉF8 jvDs(C ЉFu~u{utСF/~3C E{ {*S(UC|Hv E{dtM BEыE))ƒCqRS{dt%F0PSF0%PSm F0{tV~u~u ;}u{u~tܡF$v~u{lu{C|@WSЉBwCtu ~umdukuS08vjjjS@0u$SDCC|@TSxTDCtCdCTClCpCXC`C@]U,WVSuFtE~dN0^pUV$9Fdv)׉} vE~8}F,EFdF0ETU EFp;rmU;Vlv~l}U V0E8E8D:B:AuBAB:u=AB:u5;Ms0AB:u(AB:u AB:uAB:uAB:uAB:tU)ʸ)ЋM9~U Vh;]}-DE U} #}ExU }9v M0;^lvFl[^_ÐU WVS]s$KlC4)ȋSd)uu uuzC$09CdrkS0VPR =)sh)sd)sTKDC<Hv9r )fvfIuC8H9r )fvfIuztVWCdC0ClPRKl{lv{0Sd:C@KPT1#CLC@{lw xe[^_U WVS]} C 9vClCdCdClKTt9rKCd)ȉClKdjST)P| C0v1PSO,CdCT3k xSTKd)ыC$9r8jQ| C01PS,CdCT3 x{lBS{l,t\{l%PSTCd)P| C01PS+CdCT3xu%1ue[^_ÐUWVSuEL~lv?NPV@NdF0D1#VLV@#^,N8F<9vЉu 11ɋEЉUЋE;uv1v4E̅u9uw9]r] +}̋M؉ ƋMEЉEMeЋE EЋMeEЋUƉUÉ;Mwu;]vN1ɉu܉MU܋M}t؉EԉڅtJU؋UԋM؉Љ[^_ÉUSM] EU9|9s19w[UWVSE}u u1Z@M v9tAuu 12p@M A9uu1@ u։[^_ÍvUh@Au ukÐUWVSu} Cv8tAuF)É[^_ÐUE Mʁ`t[! tI tgu@t,jt@ t.Tt4tvc6vb.v-&vlvsvpvwv?@tr-@}wv-@ʁ@@t' t3vt@t-vxvSvs@ tr-@tw-@ʁt' t3vtt-vxvSvs@tr-@tw-@ʁt' t3vtt-vxvTvt@ @ÍvU|WVS}u BvE]EPEEЉEPSj }WSj]S jSYuVSj ÃuWjEPj{jWjn jVjjEPhhh@0jߍuvjjVWÃu * 8tjEPjjEPj jEPjtEx[^_ÉU WVS] Dž;/u-E /@{DžhCPZhU RK)u hhE P1v} HhSPw2v6$H>녍v?rvj/RSDžu +=w)SVP)t@PGPVoU |/t!@=/@u>E Dj/PEBB+E hRE PL=XEPU Rt!8E%f= hPU R!ÃV/uU BDž9v.U Dj/RDBB+E tS|/tC=Q/DhPR=hPR,vU |/uDE h[^_UVSu虽Ãt=j=SOt"j@PSnƃS;vS+e[^ÍvU WVSu} ]=/u ȳ8u[/95ij}3ijȳ8-u!ȳxt,ȳȳ8-uijȳ ȳ /ȳ:tPS&Ou[= /-u ȳ8uij=;:= /?5 /5 Fhhx:t/ȳ8u{sȳ8uZij;5ijDȳ;:u :P=t5 /5 Fh 5r?"ij/ȳij /e[^_ÉU WVS} ut4E8SEPU҃u~E<Nu1e[^_ÍvUVS=th̳/`A/5/=t ̳hÃtŃ=th̳;;5/t@=t ̳Sh=th̳/C//{RSEDC=t ̳1e[^É$FreeBSD: src/lib/libc/i386/string/swab.S,v 1.5 1999/08/27 23:59:35 peter Exp $VWt$ |$L$tfffIutCffffffffffffffffffffffffIu_^É$FreeBSD: src/lib/libc/i386/sys/reboot.S,v 1.5 1999/08/27 23:59:43 peter Exp $<7̀rϐ$FreeBSD: src/lib/libc/i386/sys/pipe.S,v 1.8 1999/08/27 23:59:42 peter Exp $*̀rL$QÍv$FreeBSD: src/lib/libc/i386/sys/fork.S,v 1.8 1999/08/27 23:59:39 peter Exp $ǹrtÍvUH3ÉU WVS}u]!U :PWSuP#‹M 99t )1e[^_ÉULWVS=EċE8L vU:% 11E]z $\vMuV}WE xw‹BMċD|v P! ]SuV} wGUċD` Pz]SuV}  w$GtUč MčD0 P2]SuV}  wGUċ PqMQ]Sh u NlQ)RURMQ] Su}WEPU RhMQ]Sh u v uvtlNXP2}WEPhU r \vMQ]Su Vh}WEPh U r$vMQ]Sh u N*)؍@)Ɖ)ڍR9u P}WEPh&U B@PsMQ]Shu vUv}WEPhU J*)؍@)Ɖ)ڍR9u PB}WEPh U r$vMQ]Sh u F@P}WEPh+URMQ] { ~ uċ }ċPrEPURM Qh-W]SuV} WE;URMQh ] 3a"Eԋu PoPh3]S EPURSQMQ]Su Vh;}WEPhDURMQh ] Cދ^)ù$Iэ )PjMQ]ShFu FuPCCQ})ω$I)ЍH+vU ZlJMruu?Qщ)Ѝ9u)Ѝ9u nmEM)$I)))ȍH$I))Љ)‰Љ)lj}9E9MKuCQщ)Ѝ9u)Ѝ9u EnEmu>Vu}WEPh QU:gu@-MU;Ju Bu];s> @UE;Pu@tf]M;Ys{ u@uMEu;FPvRV 4%Uz_u]M;YfvR  4%u>_%UE;Pu@ti]M;Y; u@uMEu;FvR茱v4%U:_]M;YSvR> 4%uKu~_tB`EU@MP%Eu%=uEu$E9EuU9UEyMM@u%=X w+=HDw=8tG6=PI$=pw=hv=xEP|u | UUJT)‰UE)9E0MAUy NjM UP @M9tuP @EM9uUUE@AuVEPE@PURMQuV %UMD]CUuTUE@FuMAUu;uE@NuMAUuVMQ%])É@PuVREPw UE@MlMA%U\uVSQEPURMQ. <u@%=CKP%Ë%=uK뛍vEHUTEUEu+F UDEPURE@PMQuVEPMQ]ut1}uNE‹DT EUE+F uD1D1 MQuVE@PEPURMQ u uVM]L\ 넸be[^_ÍvUWVSE EEU;BtHMƋMVhVEPQU2>ƉuE }EEM;AtU;uuMME1ۃ u U@uuMAuEUX,} u M@u}u'E@u}uEUX0t(~&VMQVEPURM1mƃ Kہ}tAҁvRܫv4%uI_tD}t;UvR蟫 4%u}_uEҁvRW 4%u_uL}t<}t:UvR 4%u }_tEE{w VEPVURMQE0!ƃ Ur4M9Mt,URMQPEPURM1EUEPMr1vE@e[^_UWVSE@0EU UEM;QtBEƋMVhVEPQU2iE }EEM;AtUE1ۃ u M@uuE@uEUX,} u M@u}u'E@u}uEUX0t'~%VMQVEPURM1ƃ Kہ}tAҁvRv4%uI_tD}t;UvRר 4%u}_uEҁvR菨 4%u_uL}t<}t:UvRJ 4%u }_tEE{w VEPVURMQE0Yƃ UsMM;ut5E9Et-URMQPEPURM1EvEe[^_ÐU WVS]E EƋM}9vUBM%=Pwx=(qw/=== v=8w=0<v=@q=Hfi=xw;=`Hw=Xs>=h)=p!= w=p==t]=tn9EE}t }EE~Ev}Eyv}oEav}ZEL%}O}4E"A"E! Éс‰! ÄM)MƋM! É!с! É!сUBMT%=t'EH%NjE%=u!=v! ÉсUʋ}G%=t!! EE9E[^_U\WVSEȉEċUJ AMr$uBtE}tU EUM HM"vu uЉDEM9Ms vu~<~Dt}~Htwv<}GLT0UOD_H]}\8D;<u;]s2KJ:u9u:t )}9}ËU;]r9tnv]E9sSMQ<:uE);AL|މ׋ILt/C;]s'uV<:uE);FL|މ׋EHLu;]MUĉ urBB} z EBMJuFP}ĉG$uY }vEp$Ur²Mq$贲 H]s$蚲.uċV$V(F y׉~,F AЉF0F kAЉF4F qjP0Ex@؋U+B@;EsEEMA]SuV}WEpPƃ tփ}u UzTMăyu#@P@P]ĉC}ċ;XPw.UB@@ @C;XPvҋMyTu!]Cu}WEPVsS\UzX~8MăyuBX@P&]ĉC}X~ Eăx7jURMQV]sSYà !j}WEPVUrR.à uwM;qv!}WEPFPqQUƃ uuJUċJAM]SuV}WEPUR ƃ }=MyT0}t#]ċC S)‹}W)ƉGG }vs;]siuċ;XPw.N}TTTTT T -vUDMDD C;]r]ă{ts茯uă~tvu}w$d1e[^_ÉUWVSE E];]]U@%=Xtw =Htav=xt!UvM@u%Ɖu8U‹@MJu%Ɖu%=uEU@%=PwV=(w==8w=0tlv=@=H=xi=`xw=Xt+j=h=p&MEDEvGMQSPuVEP ǃ URMQuVWEPm 9uC]]KSURWMQuVH tSEPWURV }vEvGMQSPuVEP ǃ URMQuVWEP 9uC]]KuuuƃSURWVMQ t9u݅uuS]SPVuVEvGURSPMQuVg ǃ EPURMQWVL ;EučsuU@%\)CKMuP%Ë%=uKSEPWURMQ 9uS]SWuVEP} \U@%JE]+C D/vU@%JE]+C DD ];]dEe[^_ÐU,WVSU EU1EU9fM@u%=0w2=w =tZ= =(tf=w=`v= =E9EUBU8M9MEu%JE9EU"AEPn]M;Yu A4Eu;FHx >@-MU;Ju Bu];s> @UE;Pu@tf]M;Ys{ u@uMEu;FPvRJ 4%Uz_u]M;YfvR 4%u>_%UE;Pu@ti]M;Y; u@uMEu;FvR耘v4%U:_]M;YSvR2 4%uKu~_tB`EU@MP%Eu%=uEu$E9EuU9UEyMM@u%=X w+=HDw=8tG6=PI$=pw=hv=xEP|u | UUJT)‰UE)9E0MAUy NjM UP @M9tuP @EM9uUUE@AuVEPE@PURMQuV %UMD]CUuTUE@FuMAUu;uE@NuMAUuVMQ%])É@PuVREPw UE@MlMA%U\uVSQEPURMQ. <u@%=CKP%Ë%=uK뛍vEHUTEUEu+F UDEPURE@PMQuVEPMQ]ut1}uNE‹DT EUE+F uD1D1 MQuVE@PEPURMQ u uVM]L\ 넸be[^_ÍvU,WVSEX(P,U@0EU UEE;PtRUUpjSEShSURPE0ËU0pSEPTEUUEUE;PtEUދ}HuEE11} u U@u}uE@u Up,} u U@u}u%E@uuNjUp0t'~%vSWSEPURE0à NށtB}UvR萒v4%uG}_tA}t8UvRR 4%u}_u}t{UvR 4%u}_uIt<}t8UvRΑ 4%u }_t{wSWSUREPU2à E<ubU9UtZUpSEPUpEPS SUREPUREPU2?E UEPE<u1E@e[^_U,WVSEX(P4U@0EU UEE;PtRUUpjSEShSURPE0E0}EEU;BtUE1 u U@uuE@uEUp,} u U@u}u'E@u}uEUp0t(~&SEPSUREPU2à Nہ}tAҁvR萏v4%uI_tD}t;UvRS 4%u}_uEҁvR  4%u_uL}t<}t:UvRƎ 4%u }_tEE{w SEPSUREPU2à E<tUUUދ}Ht]U9UtUpSEPUpEPSܢ SUREPUREPU2E zEe[^_ÐU WVS]E EU9uFu%=Pwx=(ew/=== v=8w=08zv=@=HZ\=xw;=`<w=Xk1=hq=pf=w=l==tY=tb9EE}t]}NE~E}~#}nE_}YUT Jv%ƋUr}+E>8"FE vD ׁ)4 M)}MD %vT D %v<uFuT%=tSEp%NjE%=u,vD ׁEUr%=tD EAU9U[^_ÉU WVSE} u]UH 8eu9EuA(t1y w%uRSVWQvRSVWQe[^_ÍvU:-u9B;Cs1z]t+;Csz-u E-SE vEEM:MuEN fEfF=tCE:Ev j S ]E9ËN ffFC9~qEPEP~j Sl SEP(EPSËN ffFC~e[^_ÐU WVSu EEU;Bs:vRuv4%t M;ArƋE8+}v;t"WUR3-u<uڅujMQx v{ C$vӁvRuv4%tËN ffFC~vӁvRtv4%tËN ffFC~+vӁvRptv4%tËN ffFC~vӁvRtv4%tËN ffFC~v=w%1tËN ffFC~;vӁvRsv4%tËN ffFC~vӁvR,sv4%tËN ffFC~vӁvRrv4%tËN ffFC~?vӁvRrv4% tËN ffFC~vӁvR0rv4%@tËN ffFC~vӁvRqv4%tËN ffFC~Fvv=w$%1tËN ffFC~ōe[^_ÐUVS] j=uƉҋK %fCe[^ÍvUS];CrjS(;CsB;Cs:[uz.u Fvj.S=E;SsB;Cs:.uz]u  jSE]U WVSuM E;Fs6s @;FsU;VssB;Fs9uz]u;Fr jF>+}x=xt'WEP3u<t;uڃtjV 1CUe[^_ÉUS]vSov4%t*vS[v4YvSSo 4%t*vS=v4Ë]U WVS]3{E UUSEE]ES3{e[^_ÍvU WVSu] Fx8@tMӁvRn 4%t"S9tSVY'vPhV<;u FP4;@4e[^_U WVS]3{EECE^E@ @]@S3{e[^_ÍvU WVS]u }CE{~u}~B}u BM$@E))CvVC)@PhxS-EPjFPSY C)PhSC)PVS jhSjCHPSo jhVC)@PhxSC)PhSM C)PVS"jhS* jCHPSjhS E@PFPS‹EHPj_vVC)@PhHSC)PhPSJvMQVSN‹EHPEPVS6‹MQGPRS vjS e[^_ÐUUzuE BBBB1ÐUWVS}GP U@ WJME;GGGMMzuPzPGp;‹GPGxuEPzz‹GPNURGpr;‹GP1҃;U})GpЅ}BEAB;U|׋Wzt"ztMQjE)BP~vEj WWEZE}EBE}$M)CfCCC ؍e[^_ÐU WVSu UBP PUx19sˋF ff)FC9rE9u UBH [^_ÉUWVSu FfEUBP HʉU@E9Ef9Cu`9t\1;}sP"CЋ"F%9u0vG;}s'ҋ"Cȋ"F%9t;}t;]r;]sVURދUB+pe[^_UVSEu @H19svŠ"FtB9r1[^ÐUWVSE} @H119s7Š0"GtCB9r[^_U WVS] s}C{ u Pwss 8C { uj ua!vEPC HP蕄SC De[^_ÉUÍvUÍvUVSuV Jȅ}B] 1ҋF9}v<t  vBF9|1[^ÉUWVSEP Z؅}B} u1ɋEP9}v:t1AEP9|[^_ÍvU WVSEU z8xuiv<>uUVE P)tAU B4EB4>^*v<;uSVE P@tU;C~F~e[^_ÍvU WVSu~]+] t;FPVBV EFЋM MQRP5{^e[^_US]{u4C;C|C@@PSSC M M C]ÍvU WVSu}~u^uu VF ]N 9<|FH9<|C ~كF)PN RDPmF Ue[^_UEM xuP % EÉUVS]u 9s}/Ps .vuj STC se[^ÍvUVS]u CFCPs uFuj SC Fe[^UWVSEx E1ҋME ;H }"Hv| tEBE ;P |11ҋM A@Y;%=Xwk= )w.=w===0ew=( v=H=xtiw/=hw=`^=pzL=w=t}3v=tn$uCEF=MQRSƒ%;%=`t'=t =L%=`t=uE ;pL~'MMpL~ P@vE P@M ;qL~ EEqL~ Q@vM Q@~v~oBlE ;pL~ MMpL~ P@vE P@~~B1}t0)M ;qL~EEqL~Q@M Q@1%=E xLu @@kvU BL@PXqM AE H(3vU J<]RL~;%=uAJe[^_U WVSu} u X11%v%=pw@=0w==(=XtY=h=w=xt4=t!==9~1EPRV.ƒ2%4%=`t'=t =%=`t=u}Bv%=`t =9~׋U :e[^_UVSEu xuUh[oFDtAFDvVDFLA~1;^L}F< VDFL)HC;^L|e[^U WVSEu xFLPnǃuFHvFLPnFH1;^L}VHFL)HC;^L|FLX|? ;NL}3V<:t(VHFL)H;~ ;NL} F<:uIKy19vVHFL);~C9~;NL}79';NL},vVHFL);~A9;NL|;NL}|˃Wne[^_ÉUWVSE} 11xt1K_Ht Pt A9~I%=uɅtO([^_ÉUjjuuu uuUjuuuuE PuÉU|WVSu quXhoÃtBhhpt)9Pu!SEPMQuVREPc;utChhQpt*9Pu"jMQuVEPRMQkSu}1EE EEE%PhjP@PEPPu6hMà tSSLPh5 ǒ0JPh5xt?x=w'hph B1IM BDžtvuDžhnDžvPܑ8#t ~tvǑ8#uh5(蝑0jIPh5Y DK􋵬VmTPjQ\vvPp 􋍤Q!u80u 8=u Dž~uZt~LА0HPu6h5 rJ􋅬Pl~T~j"jjhh@/vvj h@/h5>j- vu8BPRFDžj"jjhh@/vv h@/h25~}u(jh@QsDžvPzFjVZnhjP5 PPQsЃ9t2迎0FPh`5{ VXv9}G~-h5>􋵘Vcr vhS։ 4 jjjSW]m0~u[貍8t)袍0oEPh5^ h5E􋵘VvP`PPnƃat t#vbb1ۃuVp􋍘Qp}6ˌ0DPh 5Dž fE0=vh 5Ov}PMQVgp}PMQVHp }PMQV&pjPV(p t,0CPu6hL5 rt?jSPouFjSjo u+v􋍬Qg/EPvtu6Fo􋅤P4o􋍬QIg Dx[^_UjuÍvUWS] }1҉ ]tt8E]E8E]`2`2EBEBEB E{/TvjjEPiǃ|7fEPWt%UW'nh[_U,WVS]u}1҉EEURURhZS5DtHuC1>]܅t&VEPM Qssu tʋ[uۃuPCe[^_ÍvU$SU] MEEEEEEUPQSjEP]ÍvUWVS}  E PuSQgDž}uh\h^,1ۅtBEPEPE P PS^ uS1JvSϊ)=xu }DžEP讀ǃwSCnhoSn iƃwfh\S+à Ve1EPPe} x]E%f=t FvEPCPOk}$}tE;Gt vEt5 /S薉[^_ÉU$S]E MUEEEEEERQjEPS]ÍvUWVSu ]1ҍ} }t }tEu?UBEB5u'UBEBFB FBF B vUuuEPRuh[^_ÍvUWVS}DžxDžt|P~t Dž|jjjhPEPU R @ƅ4j S[u0OyW u; ;#]vROv4%t*vR;4C; t; t; t;u; t; uAC; t; tހ> t,> t'> t">tvC; t; t; t ;u<+t <-t}uDžt@uKDžt|jPPђЉtvn@u7|jPP{tLovPEPU Ret&IPEPU RAt<+t <-tZ~uDžxv~@u&|EPjFPxvFPURzvt~~@u#|EPjFP蒑tTFPUR0~u6kvtt?E>tPEP~Љxttxt1&WhP&X[^_UPWS]U {uO{uI{ uC9Cu2EEEEEECE]ƅj"jjhPRS }1CEEDžPEPhZu;t~N;ivtLƅj"jjhWssO uWPp|t[u:1[_UWVS]9{$lE jjqÃ[j.S]ƃFEjh!Pu[}HP5~‰&FP5gUu*uljh.Stu E4jh:SPu E@pjhFS,WELKuR3EX'޿at޿ct΃hRS붉蛽E臽EsE_EKE7Ep#D`E^vD(EJvD܉E6v|]]];uE+u@Eu@E u@ EE (^p>w[X*o[:X,Eu!]pV8yuE.vE+tE-}teЃ@P5||t9UV|@Pc|Ev˻EE Ee[^_É$FreeBSD: src/lib/libc/i386/gen/setjmp.S,v 1.17.2.2 2001/07/06 12:41:44 deischen Exp $L$APjjZ L$T$QYai qyy1ËT$jBPjY T$D$JZbj rzju@L$ÍvUjuu u_Ujjuj_ÉU WVS]}u vVE 4%u^$tY-tT_tO.tJ+tE!t@*t;'t6(t1)t,,t'%CVXTPjSvVSE 4%u<u t/u t"u t t/Fv u"C\E@9\0 $\\Cn\Cr\Cb\Ca\Cv\Ct\Cf\Cs\C0CE<0C0v tt"\C0C$0C$0Z@u\C}MCv VC 4%t^Cu?@-CC؍e[^_ÉU WVSM] }CPWPQlu)e[^_ÉU WVSMu ]}MvvFPWRQ KwtjWPQ+Ee[^_ÉUVSutPVY|"EPV\uE%f= t 1jjjjh7|à DžllBfDžl EBddBj\PRSC Ѓu*`h\iSCиSCЃEPV H[^ÐUpVSu hfÃuXqSwkb;Fu>B@PhBPEPhU u;EuF;EtSvƒuSk1e[^ÍvU WVShPDžu1`u1ې[#ĹЅt;9v,A[ȹu BA:u[Ĺ!Cve[^_U WVS} t E }t UUEE8?1vPWqu8ȹt}ĹU v} tpvĹU _vWqu4ȹt} t/ĹE "}tvĹU  FFu "hEP[ǃ 1e[^_USj NÃuhjcvCCjPNuhj0؋]ÐUS]SB9Cu#BCP3gu KE C1]ÍvUVSutA>t3} t 1;^sv4NC;^r6NVNe[^ÐU WVSu} 1;^s$W4ouC;^r1e[^_U$S]}hB]UBEPR+t1Gt8t E}t@]ÐUWVSE NjUEuuIuIEUEXEEEPƃt t1uIuI URo?rE 8ruhuiI]{t1jsDsEI }t_jjDN}tIExt@jpD.}tjuDuH uH UtvC@PHu5*EPh[DjVAU :ruRucÃusHE PucÃuTHUZr U U؍e[^ÐUWVSEE U]t 9Cuu `vP7f}jjWssFƃu c8t߃}u  UUS=tEe[^_ÍvUVSjju赭Ã|u SƃS]Ge[^U WVS}u 1CwVWЃte[^_U|WVS]EPSF|}u}v}~bAvjjSjjujAE uҍv` tXtPf=tAf=t2f= t#f=tuЉPFB\^~%= t)=t"f= tf=N%= t%=tf= tf=uMV%= t(=tf= t %CV%= t+=tf= t  v %vN%= t%=tf= tf=uJV%= t)=tf= t v%@V%= t'=tf= t D v v 1҉Ӌ~ȉuƉuuE] CCfCCE ;tp8ugvEtUFuO]  ;tA8t:PEEP[uڋFCFCFfCFCM} uuЋUR?Ex[^_ÍvUU1Ɂ:ELFu B%=ufzu zȉU@WVS11DžhDždDž`DžXjjjEP]DutGj4̿SURC4u*SRtlPMQdB} vÉP1RPEPjjPRj= u6XTt\hD|Dd6T1ft"vT|tB9|1RPEPjjdRj< pXDž`U BBfBB` :t8uօ)j1RPMQB`)h\X\8?tm] \8_u@PWFXt3W4Xu.PTR\QS``~ ;t8u\~ `eht;`~2h@v@VP]S@9 H\XtdPXRC<TtPQTP!<[`8[^_ÉUSM] CAC=tt,!=u vC $<uQ@C;E|A/CUƒzu Bt z$AC <wI[ÍvU WVS} uMuFuFtFuDž DžF EFF] t<9sDAt{u3f~}u,f~u%7E?vWEPE PVS1 tރj{S Ãu҃WE PVe[^_U WVSM] 9tf9uf1qf>tTf>[u.f>]tf>tf>]tf>uf>uvf>{uGvf>}utOf>uuf>u"EPURPU19[t ,tQ{t;}t:كf;]tf;tvf;]tf;uf;uvrvGltOdtf;,tY9sf9rFfN ffuEPURPUK92E1[^_U WVSuf>~E@ EU |B^9s&f~tf~/tA9s f;tf;/uE 8uM(5uhcs3uEtQOu'8PPvU ROu9HU ffA9s9u9sffufE e[^_ÍvU WVSE PhSURƋE ߃?*v[!uf>tj]FP uf[!f[!uf!شff>-u^]tf-شf]uNjU J f]8E H f?)U J 9tf*tf*fffEPU RPutU 9u4B uB %=uEPU REP<4U B u(h`1j+PBBP[<1[^_ÉUUE 02SEPUR`ƃucExtRhPURu&R0PUBЅu E@ t v1DžDžUB @Bux.u Uf:.ufP;]sffBfuEPURWuf-E PUREPURSEPh uV҃tE@ @tV‹B VCE[^_ÉU WVS} U:t;~QGtPw, Pk*ÅutwQ+G멃u"~GH|vIy_UEf8t fu+EEP)ƃt3EPVEPtV* vG4G1ue[^_ÍvUWVS}] ;]L=?tX=*t=[tQ ;]tvEPSWt fu1fuvEfUftf;!ЉUtytvf;-u]=tfM:UwBCf9v05uVP軶CPV覶Evf;UuEf]uE9E(f9f?%e[^_U WVS}tBG_7Ntv;t 3(sw(Ge[^_USU] f:t"hPRet19hfC @uP=vPC ЋÐUVS] uhPutN?+vF @uSP+SPF$Ѝ[^ÉUVS] uhPuxtM?+vF @uSPj+SPF(Ѝ[^ÉUUM v9tfu1US]M UJtAu1 s[ÍvUEEEEjjEPjjEPH =t5&u%tVjjEP5jEP*H |U%l56&1UWV=uu1_;s@@U5 =@UtɃ=u5%@Ue^_U WVSu=u t{1C;sCV[PFu;s[@U5 =u5%;r1v@Ue[^_ÍvU WVSu=u tw1;sD9p$tC;s/[9t$u;s[@U5 =u5q$;r1v@Ue[^_ÍvUS]=tu5#$]U=t5#ÐUÉUu&1҃u‰ÉU,WVS}u EEEEjjEPEPjEP#E }s1rEE$1;]}Mv]jjEPVjEPD }I8-t(vFPWKDtC;]|He[^_ÉUS] =Ujjj*U|*=U~*S5U5U*U} 1U_=Ut5UU"U@UP;!UtS5U5U"*U|9UvUEU]ÉUS]=D3u/jhU$}G1"D31=UtU]ÍvUEPUWSEPxÃ}u.߰;U ~ E"vRSuEe[_ÐU WVSh"Ã; j EPS*ƒuE8txu~Ev*v@Shz9~jhZځ%h!=ڃڃWRh:jhUqUЋUHE e[^_ÐUEEUBjjEPhUjR*At UGÐUWVS] tCE j("ƃ1 EF ^$EF$tN$UR=vMQPVjhOV!EYf@2EEE8vU:HP2VfC2USK@KF$PSV fC4 fufC4}t EC]C}u]UZ]EEM9`}t}~EPURV EjhOVt?MHf@4 F$ujjhP跍F}N$?cCEP]UR9 v+V1e[^_ÐU WVSu] C&fC$GP{@Wvkj/Wƒ t09uzt&BװЍxPRC@P+f{&FCCC,F e[^_UVSu>t9f{2|$vڋCuCÃRYf{2}߃SF~tvJ ~tvvF$uGvT$t A1ۃv%tVA V1e[^ÉUlWVS}?G%7V8fF8ujVW fF4QvusF4ffwejVW fF4fG$jjhPeF }AFfF4N6vf~4tG$@tBF,;G t:F6tv $tw GfF4vtbG%tg%w Gt=vjVW tR]@FN6wt=F@Fvu*jWMGuG%1wGvPf~2u,G$uw"VWf~8tf~8uXjVWfF4fu9G$u3jjhP趉F }g?FfF4N6fF8OFP$@|/uT F@$/BF&@PF@PR苦pPf~2u"V>vV$Gf~2uG$w evF6tFG$u0v t>v "s>-vv i"'vF6uhRjvW t O% ~tfF47e[^_UUwE fP81v=ÉU WVS}] tt=7=G%f~4 u Ff~4twu O%f~2uF8/tG$tSW\GMvjjhPcƃ|.SW0GVP uV Gv1e[^_ÉUE$Ft vB:uCtBIu[^ÉUWVSE} ÍpvCvA8t uv)[^_ÍvUWVSu >=uFHEEPUR&ƒt5}AװH;EFBu*1;t vG;u`c;*u-PRÃ*`c@PÃtlPS5*ܶ*`c*D}UB:t:=u+EUDPU* u8E*BMAMt:=u=BvFBu1e[^_US]E*BuEPSuЋ]Ív$FreeBSD: src/lib/libc/i386/string/rindex.S,v 1.5 1999/08/27 23:59:32 peter Exp $ST$L$ 18uBu[ÐUEԻÍvUWVS]j(gǃ6hMƃG w$t8 t8N PV@FO WGFj8P8EEEE EEE=ԻtԻ9~؉E]EEjhXP@SEPSTn uD@R@ЉÉ^S_‰V t/XSPRFGFGW5h`51[^_UWVShPuvE[|xPjÃ}v~19}2:A9|PSxP|PPX[^_ÉUÍvUEU @$JPRA ÐU VSu} ^$juuEP;{tsCC PEPtC CFCF4vEC PEPCCFCFVfe[^ÉULWVSEX$@;Cu 1CEEjssuVfUURVkǃ tajEPEȉEEEjV@Ѓ EPVxkǃtUCBCBREEP]S9kEԃxt S@Љe[^_ÉUVSu^$s?{ts+v$~tv Ve[^ÉU,WVSu]~$jhGPS-VS tF PSuh#CS@ЉCxt S@Ѝe[^_Ð$FreeBSD: src/lib/libc/i386/sys/Ovfork.S,v 1.11.2.1 2002/10/15 19:46:46 fjoe Exp $YB̀r tQ[vUdSU] tC}utUfEfEUUEEuuEPz…tEЋ]ÍvU1ÐUdWEU fEfEEEǰHEEEqEEEPREPxi}ÍvUSu*9u9tT]ÍvU WVS}(u=t Wb G u!jjjwG(ЉÉփu u=_PwTG tG)փ0t#G<)G t?tG)‰Йփ=t W ؉e[^_ÐUSE8eX ;E{ts{ts{ts{<ts<{DtCDP|{HtsHhS\]ÍvULWVS}uEEP EȃuURhvM1 }1EEEE %PhjEP=EPEPEPE0 t(PXPh5gMEԃxt(hphc2gUcuEPjjjÃu h Ãuh 胮uju tjjpuh4/hrÃuh`hJ~ j:Mqu6R0PEph5 hU2 uJMQEPB u3UȋB E8tEj/MQNjURh%j/EPMjURMQhU2UtPRMQF00MPEPh58~ huQjÒE̍e[^_U WVS] }.u}EvP gRF~܀;}uQV‰װHRgPF~nURx‰װHYR'v}t:߰H0SEgP#vj/SXǃuD߰HSgPF~/uG/tvtv)؃@PSgP$F?/u vG?/t;t:;/t G?t?/u;u!gP gR)F~܃}t&UR 1vP€hRVP um E9}LhPgPS u&fgSC9|E U1F^ e[^_ÐUSh h`i#vPh ,t=h(h`iPh`i~ C~ vC~`i]USuKÃu1 o ]ÍvU WVSEgUg.u~~.u ~j/VU=8u~h*Ãt^muU߰Ѓ+=v ?1S8u 186EHw9$Hz9d1)d!De|; 19URVgt!VӃu1VEPEe[^_U5t8uE4t8u h`t8u&ÐUh`jjjhhtjhpju{u&=hju hj=lju ljÍvUh=pjt`jUPWSUE]CE8װHPREP}WjS |muuuu uWpe[_ÐUWVS= su qt^=Lstr s sE2j]EPhsD]E@P~ u1r8+t8-uu=uhh`svrrװHPh`sRƢ s h`ss8re[^_ÍvU,WVSu= su ZtE1Ѝx~ 1vW]EPV7]EGxPtà u3=u=thVhrÃtr8+t8-u1ۃ=su91tre[^_ÉU0VSu= suu1E3uj]EPEPt]܍E@Pà uD=u=t)Vhj]S]2hShrà tr8+t8-u1ۃ=sub1tre[^US]sLst j@s]UjÉUsLs= st sP@ s=t"P@ÍvUStjjjjSE s t #j=juShjE1]ÉUVS sjURuP@ Ѓu3uE;jv/jP5j肞ju 1vjrFCurFCujVhrkjVhrk jVhrykrFCurFCurFCusFCujVhs"kjhsV臞e[^ÍvU(E4EEMA sjEPQRB Ѓu{Eu7=dwuhdwZuG5dwT`w `w=ujjhXjjÐUWSUEPEPװHPRh5dwW u]uuhjAjEuV] hEP,thEP,u1e[_ÉU WVSuE ]}8+8-SPhn趸nEhEP-,à N(hEP ,ÃF(u9u-hS?Ht6tF^N(hEP+ÃZF(uSTFN(hEPu+Ã#F(uSF N(hEP5+ÃF( u^N( hEP +ÃF(uSV>FN(hEP*ÃF)uS>F$N)hEP*ÃtNF(@u^N(@hEPu*Ãt'~(|^N(hEPN*Ãu1)F)u^ N)j v jJÅte[^_US]EPhS`\u ,t#uEPhS4\u1]ÐULWVSu ]=dwuhdwV=`wuShShhP+PPHPVP5dwT ti=`wShhS*PPHPVS5dwS0<`w=Ls4j:HDžƅ5jWPؘCS u9ƅ2jWP薘S Mr8+t8-f.=r7rx@5dwVjP uSrPnÃC 8VC 06tC C 8u=ЍEr@PV=hЍHBjhRP@ Ѓ9%r8-x@5dwVjP uSrPRÃC 8VC 0tC C 8uЍAr@PVlЍHBjhRP@Ѓ:17:5`wuÃ؍[^_UWVS=dwuhdw R=`wu=LsuR=rt5rsEPEPhrhrV5dw Rǃ uXLs>rEPEPhrhr5rSV5dw}Sǃ StLs1vj:uDÃtiE=t;EǰЍUHBjhRP@ Ѓu:!:5`wuuEPTuuZuEe[^_ULWVSE8+Cǰuhr5aEx@Ls=@ 8t{=t@EǰЍUHBjhRP@ Ѓu @ 뜐h@ 0hrá@ Ls1v=uEPEPEPEPuuEE9r1e[^_ÍvUSM] UE8~1mt)tVt't>JЅu&PSh( Sh.Ѕu&Ph3Qh8Q]U,WVSu}}wEPw=L3Dž1hwhH~PP߰HPSLt<P5wEǃ u5EPǃmu&PEPuE PSDYEP} t"tE PGuXttV$u5}t"tEPu 0PPPX1[^_ÉUWVSutsVuuVÃt{t nCC EV8ME8(jÃjSq]E h\EP EE]h^EPƃtfF> t> th`Vw5t)H~4XS'UMSPV EUE}f#hcEPGƃVx u}t*EE8 t8,t8 t}t E81e[^_ÍvU,WVSv=w=wuhwDPP}HPURhg5wvB t/=L3wfEPhphP +uwv;#C; t; tC; t; t ; t;u)C; t; t; ;j)@FPB VPWB߰ЍpDž| uN|\u NDž DžDP~/PRPXRM VPS/tN5hWitЍp DžB URpu C=w5hP͎5H1[^_ÍvU=u t=uMjjju1M8+u:t>#t =t|\uv|\u'%vB8?CB:t ::t:\u1t:CP5  ƃuV= tM @ fÃt85  C&DLt(|t:tAB:t :|t::ujjPjE PPEP,ÍC wC[^_U WVSj=u ugÃu sjd誥ǃu KEd;?u BC$v;\C;:;<w$1tCIt ;/~;7~ZC2w?$@v 8v 0v (v vv:vCCBMu()FdPWeǃEd>;:t;t;^C;:t ;B)K}t)PWjeDžE8؍e[^_ÐU WVSj=u uÃu jdu mvd.vCBOu")΃FdPQdtǿd;:t;uB)Kt)PQdtE؍e[^_ÉUSj#u u…um:0uB:xt:XuB  1 vB< w  <w<w 9|ƋE1]ÉUVSu >:tF>:u^FPu^e[^ÐUSU}t vAzu$)ĉE UECtABu5*Su蜩]ÍvUSU}t vAzu$)ĉE UECtABu2Su0]ÍvUSU}t vAzu$)ĉE UECtABuSu*]ÐU5*u u覨ÍvU|WVSDžj/EPltEDžIE8Hh迣ƒuװЃ$)ĉu R襭8uDžЍp}ЍxD7=vBjhj=VPj+ jhj vVSPa/WDPEPaD7 5*E PP=wq$1ҋE 8t BE <u$)ĉ$D$PCPE P%a5*ShyPPu uGDžhP1@t vx[^_ÐUEuÉUEÍvUS]EPu F0S:US]uu '0SvUEPuu uUVSu]=u j_5 Fh53t(uS5~6h 5o3 u ^|Ph5M3 =tVЃV蒨UEPu uUVSu] =u j5 Fh52tuS55h52=tVЃVUE Pu0@ÉUu ux0!ÍvUEPu uÉUS] =u j5 Fh51t(uS54h 51 uzPh51]UE PuÐUS]=u j 5 Fh5G1tu S5*4h51]ÍvUj juÐ$FreeBSD: src/lib/libc/i386/string/strrchr.S,v 1.5 1999/08/27 23:59:35 peter Exp $ST$L$ 18uBu[ÐU =t Uh j:j:h3h hu胡ÐUVSu]=t VSu VÃ=t V؍e[^UVS]u 9sHr1"VsD萛t CDsH1e[^UWVS}Wawj 7C[ƃtF)ËU O )_7_ECPPWO+EUWDP7R詞]W uVwj 7Zƃu_롐F+EÃSWu)EGDUR7PHE)G7U GD E 1e[^_ÐU WVS}tME8tEǰHw/}?.ut!.utj/EP t vu@tuBu1@=@t3h }W>u@D1=8hH袚Ãte8u\߰Ѓ+=v ?Sv8u-n8t d }8T58SIhfS }WSߤhhSѤ hrSaƃu8tvVÃu.蹽8t 诽vOVvVӿst1t uS'syuSk"s~uS su Sc ~su S ^su S >su ScsuS DžOuq=@t>@ruL 5@@DEPh  vSϕ[^_ÉU|WVS]EPCPg}}S upEtcmS^XY8tLEP&SjuЋURa2t!$MQ 1uuEЉET L Et PUB0B0P P 4 4 < < D D E׃4Ӂ4с4U::  E}~NjML 8 4 ЉL u9v EPML @ < ЉL u9v EPML H D ЉL u9v EPEu8 UDD DAuTL)AL D L E9L )I~0}D; IED EMU;4 IEEu;< }KU@ UDDDDEuM;< |EUE;D }HMH UDDDDEu;D |UP L ;Ev(MQ vuVȑϷOEP u ǀL U4 u ǂ8 M< u ǁ@ uD u džH Ex[^_ÉUE@(<@,1ÐUVSM] uu P05Av ww P0I  At[^ÍvUWVS}] E~9ust/'tV~ CJ[^_UUvR%v4ÉUUv R 4%%ÉUUv R 4%%ÉUE%UUv RF 4%%ÉUUv R 4%%ÉUE=w%1UUv R~ 4%%ÉUUv Rz~ 4%%ÉUUv RB~ 4%%ÉUUv R ~ 4%%ÉUUv R} 4%%ÉUUv R} 4% %ÉUUv Rb} 4%%ÉUUv R*} 4% %ÉUUv R| 40%ÍvUUv R| 4%@%ÉUUv R| 4%%ÉUUv RJ| 4%%ÉUE=w$%v1UEÐUUv R&h 4ÐUUv R 4ÐUE@(@,1ÐUWVS]}1} t~w;M vt@0Ix CIyt[^_ÍvUSUM E]f}v.Qt ttA t 1[ÐUE@(x@,$1ÐUWVS]}1ي<}wH} ~JSB<>vB<~w 7A< w'} ~!A<}wA< w ut@0$Ix CIyt[^_ÐUVSUM u]ttt( t svt7itdtA \vOQt =v/ AAQt  vt 1[^UWVSE@(P@,L u O:vUL C; t; tj$3ƃu"18t ' E1vjEPS;]]U;0} 0EC; t; tjEPSvF;]t?]t8C; t; tGwjEPS8F ;]t}uVJO&vEL ǀP $U1e[^_ÐUWVS]1} tCL }%tu 1ɉ΋ ;M v}tE@0Pv|$~Iv CI}tEL P ! [^_ÉUWVSM] L #r Љ!;ruKL p9urp}t EJ CJL ;pu09uSL ;pu$p9us}ttEi6vL ;pMp 9us}t%=u %=u59] st$ !AKt3v%=ttA@0)$? AKuС;P0t9}P0t[^_ÉU WVSM} uuEsvu E]u EIu E5u E!| Et1@9]st3+vS~$? :J Et߉>[^_ÐUE@(@,1ÐUSM] Ut`9vvt/ tvtCtAvA%=uhtA$ACA%=u@A%=u0tA$ A$? ŠA$? ‰tA @0[ÉUSMU E]tKv2t $ $? B$? Bt vtjvt<v#t$ $? Bt t&vtt tB t[ÉUVSu] 9u1'`bhbh`u)؍e[^ÉUt)}u#}WEPEPVq u>t}t;t+}u%}WEPEPSA ];t}t}t-}t'E;EuD}u EU)‰U>t;a>u;t)>t;uU+Ev>u ;uEEUR qEPqEe[^_ÐUuu uÍvU,WVSEEUUEUvRl`v4%@uƀ}-uEEEvE}+u UUE}t}u'}0u!E8xt8XuURUEE}uE }0uEEEEEURPjj/EUEURPjjW/EܾEE©v=w%1tEnUvR3_ 4%]ځvS^ 4%tCCEE;E}y}|;}wu;uw;uu;}uE;E~ E0vEEӋEËEEΉƃUUEU€}}蟔"v}tރ߃} tE}tEHU e[^_ÍvUuu uÍvU,WVSEEUUEUvR]v4%@uƀ}-uEEEvE}+u UUE}t}u'}0u!E8xt8XuURUEE}uE }0uEEEE5=}t 5=EURPWV,E܋EURPWV,ƉEEEE©&v=w%1tEnUvRc\ 4%]ځvS/\ 4%tCCEE;E}|9}wu9uw9uu9}uE;E~ E7vEEeӋEEËEEEM]EUUUEU€}}7EU}tEU覑"}t ]U]} tE}tEHU EUe[^_ÉU WVS]E 0ESURCetr;;}w1u9sE8uU]߅u`UttOu SiƋE 0uh51`SjVn19s(}t"jVURU҉EuC9suߋE8uU 2bjE Ee[^_ÉU WVS}] 19s'vjSEPU҃u1]F9rܸe[^_ÍvU,WVSutuu2hEPu58SuhSAv }WS1vhS#v hS3u vPjj EPHt WF{uuu|ItlWjjPt萎WѐÆ*P誐YOdh *gƃu(Wchfu"VgPUvPfu8賍VgWg PӏWjh Vt@_VHgP9g W'gPWjhP:t.VfWf PCPSjW9tO貌VfPf WfWɎ uP襎}Wh`r =\3t5\3"f5\3=T3t5T3fT3=X3t5X3e=X3P31ۋ5\3C!9u|tP31[^_ÍvUWVSuHEt>uhE}EUURdÃuhjGyE>t\3u؍e[^_ÍvU WVSuE UEX3;tV:uF߰HPSVu#߰HU C UC$;uT3ЋUT3DUe[^_ÍvUuAuh2jGÉU WVS] 臉0 FװHPRj~mjhCjmm ډװHPSjKmjhCj:m V@ƒӉ߰HPRj m jhFjlEP mU WVSuu u1=tEPSEx}@u}LSE0WfE)ރP t$=t EPE)1u } ut]E PVS\ރ>uk~u~u ~ >uP~u9Ft(>u4~u.~u(~ t"9F t EE =@u&=th,X1ۿĽ<8t/URURU RV8Ѓt=t(,C~=t ,1e[^_ÐUuVÐU,WVSEE}u1E8t8ЍPMYt*;t%8tǰE;u܃UMTEH MXtEuEE‹ETRTEuE 1/uU:t*M12Vaƃ vUEEMAUZtLE;t@8t0MAU4BU3VZaƃ;uUBMBtUBMAB A qZtEEtE;t2vUBM4AMEp 3VYu;uыUBMEe[^_ÉU(UE MEAQu A  A EAEEEuQUWVS}u E w} u EgE쉅$UuU $EB1Dž(vE (uEXtV Q;tLU v1F9} 43u9u  G ;u((~EUB U ;B t$@@ !vUB$BUB $B l$P1Dž(vE (uEXE (uE@ $;B u5;lF;u;tz,lT 8ǂ,ǂ0fǂ4jhD9 P VF;uv((lu$P*$UR E P$[^_UVS]u tP{uHjnPt/@@@ @VSP 1e[^ÐU}t U؋EO}t:E>vUR<>E,vEP(>U}t E1e[^_ÍvUU t>t Gt>EE@E EE@EE@uPu@ÉULWVSDžDžDžDžDžDž}uUf=}t} h6u}8Uyv}1EEEU Uh;M.1UE t}}+9}2؃A.A%A.AGN;} |ԃ2cv fÍf0A v]fӍfЍ(ˆfЍЍf0AfӍЍf(€0A.AGN;} /0QnGhRj jPǃ }8MwpEP]Sj PWR tQQ:EEU UMEDžURS2M8Rj:1[^_ÐUh6u |}t h6ÉU%h6]ÐU WVSu] 1EPs=}1YUvtz tB xu@9uu 1jrSuC_8؍e[^_ÍvU WVS}u =L5H5`8+FFÅt9{utVs Zuك=`8u7FLH؍e[^_ÐU WVS]ufh6u u 8ch6tSE PEPh hWjjjSE PEPj(Ã0~"k6@tEPhWSr Ã%h6t h8EPEPSPKÃ}&h6t h8t8Fu Ffuwh6t!F%PFPhR)Fw-$p8"88 8v؍[^_ÍvUWVSEEEEEh6u u 8v+]81E8t 8.uG@8u1;Ev x.؅u3URt URURURU RPE79r5EPUREPU RjEPY C8UEu=h6|i61۾6=6vEPUREPU R6EP \8=8t t%"uEUBuECi6uC>ty}u/u i6@u"EPUREPU RjEPL=}tU8'v}t8}t 8e[^_ÍvUWVS]u h6uu 8h6t%EPEPuPSh! uF߰ЍpTNx <.uVSSUZvR߰҉ЍD=~85VShP6uuEPEPP[^_ÉU WVS]i6g7h5phPǃUjWYE!vR#v4%@uF>ù>SP|FvR" 4%@uҀ>^~t4vRl"v4%@uC;u`hVh`SWZ`.vWhPWZ1[^_ÉUU h%PRuÉUWVSu}}t}w} mv=t VdEV~0tF@9F0tv01F0FF^ }vt1\}taEPEPVP Ãu E }} uZW20E uDE;}t}W0E } u f^ FFCFFZˀ;}t}uf^ E F~t tF؉Fv~ vF8J=t VQcEe[^_ÉUlWVS}$u(h6uu 88h6t EPURE PURh~  GG}f66fE$gGh6$gGg_ }Em} }tz}neEPEPVSU R_ D)ƃSEPSEP UfB} }EPEPVSUR ÃSj tSEPc Sj:SjDUfB E 9|vCSEPSEP SjSEP }tEPURS2]UfB )e[^_U WVSE} u}8U)‰Ѓ nCSj)]~SP=CCSj' SjUB @fB )e[^_ÍvU|WVSDžDžDžDž=`6u `6=d6u d6h6u h6f=6u t f6t6q65fr6p6jhp6h`3 1l6%7 77 0hR.ƃhVh6 76566Dž=6t|=6sa=6 tXv> t> uDž%vt0DžDžF>t%=6s > uF>t> t > t> uhh\8;#jh"P蜚 t  p t  u F> t> t>B> 9hVh67h)h6迗ƃ tDžjh-Pڙ+ t   t  u F> t> t>> yhVh67j h6莚ƃ t6566Dž=6t[=6sE> t> uDžvt0DžF>t=6rF>t > t> uDžj h4P莘 t   t  u F> t> t>6> ->t8vRTv4%@FC;uȍ1DžDžj5h?j SszPPSV zzw"`3rrPY,`31 󫋕zw#p6rrP,.p6DDD 2jhBP視W t  A tF> t> t>^> U>;L1vRtv4%@u(F>t"Ph?u >;t>}PW7QhF/vRv4%@uF>t >;t>}PWVt7"􋝌77ǂ47474UPWj=ǂ4`3    4F/vRhv4%@uF>t >;t>}‹&t/u+W3ƒ SWjt|*1vy ٸCGv؋ǀ7ǀ7 HjhKP.u) t  uhSPRhP ~ l6%77􋅠PK=6uChS%u(j.S謓ƃtFPh6 /u666U&t i6$hX$ƃthdV h61x[^_U WVS}u h6VSh{vC; t; tjhS蕑uRCPB1$%77 7h6 7PhDvjhS,u9h6uVWh h6hjhSܐu i6 j hS踐u i6aj hS蘐u i6Aj hSxu i6@!jhSXu k6@C;t; t; u;e[^_ÍvUE|)%=tÉUjEP|%G(‹E3E1%ÉUEvÍvUVS]s{ts Su׍e[^US];tAEEj EPS,E8u}tE8u1]ÐU|WVSUE}EEE]ECCC CCCC}u} u (zzzzt EBtttEv߉{tZ{ tTE=|DSE;u-xt'xt!CM;AuC ;AtE CEE8}% =t=Iv= u {tcv{t {t{uB}{uCE PSS Eߍu}E=.vߍuE8CU;tBt :CM;AtAt yC U;BtBt z{uMC{uExt@C{ uUztBC }uEPM QSEPE PURSwE}}tMytE@EtxuEU:}CtEE}uE1CtEP  vE=ߍuCU;C;BtBt zC M;AtAtstyui{uExt@C{ uUztBC EPM QEPSE}tUztMIMtyuEE81}tE}u}t EU1$E}t uMEx[^_ÐUVSu1ۋF=t:t @8t:u#uAt 8tA8uAut;u1v[^ÉUWVS1ۃhh*:vƿt9ƿt&ƿtƿu0[UvƿtƿuhWƿu [CPz7&PhPPqA|vC~[^_U WVS1EE=th,kUREP(t=,=u 1ۿv<:tgEPE PEP:ЉƃuJ]t#vjURSƃu.[uᐃ=t ,EU1-C~=t ,}t ue[^_U,WVSu} EE]jjv}=8t1vP!WVuكvttpPVCt#vpPVkCu %jWsÃu EUb}t u؍e[^_ÐUujG;tuWEPSWFu vIjURvÃu.t~tvt~u  EU1}t u؍e[^_ÐUWVSu EPEPuEpu1xtj%V蓅ÃuEPEPVEPvVǃuWo)8C]EPEPWEPEu;Et2v{u"sEPVEPtEF[uуW,Ee[^_ÐU WVSEu ]tJ߰PFu "v߰PSv 1e[^_ÐUWVSuEhƒtfEPRjuOE 8uG~uAUt'tttE HMEEU B PÃu1zC CU rjPSM AACSCBC}uQ EqPRU B rMQP؍e[^_Uju uU WVS}u Gt G }tu  1 |Vt t̓V!wІ/Gt uh d1PVptP}uGtuGfP1e[^_ÐUUu1 H=Ht9t 8u1UVSu^uVjjj} :P3jjj } vP t!jjSk}1P^e[^UVS]uU ;tkf=t f=uSu:6j EPSÉf68u}tE8u 9u1ve[^UWVSE}t>EEPt ERu}&EPǃu 1ɋ]St~7؉]BE1;us?ËC#797t,7؉]F;us]C#797uωt}u ~ ;t}MARu}tiE9E}?uNx.D;D ~$ \DT TL\ NyՍvE]9]|U1;M}vωBA;M|BW1e[^_U|$WVS] }1҉E]}t}tqv}aUBȉB] f􋅤+PPSRMQ 􋅨P3\}t}t }uAщUDžDž;􋅤+PPSRMQ 􋅨PLSSƃ St v}t}t }hVSRMQ* |FVt6щ+9~ C+PPRv}u#tmU9tUvڃ􋍠QU#PEPH#Pj~#PURh@j%Nr0딐t BQP`xt)RQhj%qu !u  u(ǰ}u󥃽u E vEuSPEPqBut'yt@txu v vu~;s Tt{7t)}u#EPC}u=KvuURuMQ PuUR8Ev81x[^_ÐUlWVS}1}}]hǃt hEu W8vUBtY tt[yuEE}EMMĉuEEEEEWvuEEuEE}E#vWUREPu y}"WMQvEPuuuW tCt [t{u}t#URuuuMQ| tCW-EP!}u8p1 UE1e[^_ÉU< WVSuEPh P9ǃu1o~Đ?#thzWsÃth}WsÃtDžCs;jv; t; uCCv߃uh}S1sÃtCWM QWst;u}1FEEEEPEPhPt;vFCF C tQSV:[uȋ[^_ÍvU,WVS} E]hhƃu QCtt[t{uEPWVu҃V-}tUE1ve[^_ÍvUt8tF8u 1EEF89~ulWƒtZFM4REP7Cu ELUt6sRE؃u,[t{uE܋FM܃<uUE1}t uWE؍e[^_U,WVSEEh6uu 8h/Eu8} TwfGE_ GEGEh6tSEPEPh0hEPjjjSEPEPj;Ã0~%k6@tEPhEPSÃ9h6thEPT8vEPEPSEPÃ|;]~fNFu Ffu;FEh6t9F%PFPh7F%E_?EP}uS}w=E$v8b8R8B82Ee[^_ÐUWVSE @EEEEh6uu 8'81E8t 8.uG@8u1;Ev x.؅u'URtU RP+SE79r(E PjUR58EEu=h6|i61۾6=6tzvU R6EP&8=8t t%"uEUBuECi6uC>tt}u#u i6@uE PjURH9}t E8$}t8}t 8e[^_ÍvUWVS]u h6uu 8h6tuPSh=uJ߰ЍpwXt#N<.uVSSodZ߰҉ЍD=v82VShhP]P uP[^_ÐUME EUB EjjEPQjRt1vÐU WVS}EP(}1W1]t){ tC xuWsu؋C puu b#e[^_ÉU WVS}=DE H5`8 Wv6WYt&^;t:3W=t ;u} t!E Pv t ƅu=`8u DHe[^_ÐU\WVSEEE1EfEEEEEEE]jjSjjEP UuEԃ<jjSPjEP }2!8 uF~ URMQE}pEԉEE9EyUЉUȀzOB tc=BtHJ fMEӃ`z`tB`$U܍TUEEPCM؍LMfEEȉEf}Uf9P tf}MA΃EE1vG5%M#At>t ÃuƉ]1v%U#Bt3>tÃu:u MM]G~UEЋEE9EEEE؃uMEPVE+EU܍EPEuMQEEE+EU‰UU܉UPjMQmEEfEUԉUЃE9vMЉMȀy\A FFF fE˃`UŰMJUЋBMACUЃhPREPQCUCDEEMA UB`PSMQ EЀx`tB`$EEEeEMA}PEpfEqMȉMf}_Ef9A tPf}EUB8M̋AUBABBuăE1G5%M#At>t ÃuƉ]1v%U#B>tÃttktKcEMA SVPFvEMA:uURjP'MM&vSVEPMUJSVQt]GFEUEMEЋEE9E|EPEU9UrMEUMQ1e[^_ÐUuwÐU WS5HL%Ph hPgHLH =PuhPsPP߰HPSh&5P)q tFu;PP߰HPSh65Pp t19hFhuG J[_ÍvU WS=PuhPr5H5DhLhSGDH PP߰HPSh65Po u9hFhuF c1[_UVS=PuhPqt1=<uW=Tt5TEPEPhhTh65Pqƃ uS<WvTEPEPhhT5Sh65Psƃ St<10uuhFhuE uGe[^ÍvU=@uhRhT@5@E `8ÍvU=@t5@/@`8ÐUVS=<thRt =@uhRhTY@t!5@hhɼƃu1e>+u[jytJ=Dth'=Lth hP>#nhbV^ÃS5ĪheV^ƃ/F> t> thhV^ÃCV%̪ЪȪƃheSR^ÃtBCt<;t7; t/; t*hsvheS^ÃtCuĪe[^ÐUj juÐU WVS}u hVu`6#GtSPhVM uNx   Vj e[^_ÐU, WVS]E#7=7tEx #= 1PVE PEP70tp8t0Ph8+7 Kx  Sj u1t(7tWE PVPhS } uMPVPPPtPhSɃ0jhPjjPEP} }"0PhS|&SP脷Sj F|[^_ÐU5uÍvUu huÐULWVSuh6u|EPu u#-}$0PhV趂@]# E#H LU}MމMMMMMă=7t 7ut R44hV< =7t 7t)NyF;F|;Vj;=7t 7Ih0VځE# th9V賁E# th=V茁E# thAVeE#  $thEV>E#( ,thIVE#0 4thMVE#8 <thQVɀE#@ DthUV袀=7t 7t{WSjPhYVrEPSjPhbVT MQSjrPhbV3EPSjTPhbV =7t 7 t"Nx Vj Vjj]SVj jS Vj@jSVhjS u1}u+}u%}uNx  Vj -e[^_ÐU WVS}E ]hRWURP#ƃ }1Iu+KyC;C|.!Sj.vSP>[^_ÉUuhu uSÐU WVS]EPSEPEPu 耵ƅ|&߰ЍPt|.tB;E|1fEe[^_UVShVhu ujà tuV)1[^U WVS]} u{t)sWXVu t {uׅte[^_ÍvUSEU ]xt;ut@, xuRhbht]USEU ]xt;ut@, xuRhbht]Ujuh0ÉU} u<juPÉUjuhlÉUE= wbw+wB2 wv@=w/=w=== w=v=@=@ejpyqiaYQIA91)!PhhÉUS]j(hS/}Shhh]ÉUVS]fо f1fʃf1f<`Q)QRhh((e[^UWVSu11ۋ=w%1tTPAѐ9.u]A=w%1t8A=w%1t\A1;dr`G;\s14` ~ Љ%[^_UWVS1EEEEv=w%1t|PCѐvRv4%@tCύv=w%1=w%1tETPЉUCˍvvR v4%@tCύv=w%1J=w%1tETPЉUCˍv;.C=w%1t~EC=w%1tFUBEC=w%1tUTЉUCvRv4%@tщvRv4%@tCύv2wt$)U4)U4)U4<+u)U)‹E)Ѝ)v12w"$vU E  U CvR 4%@tӉvRv4%@tCύvEe[^_ÐU,WVSE1EEEEEEEEǰH}ǃEPEPÃEPEPƒ EEu+}u}u ]Uv}u}u]U1E8-u EEE8+uEvE=w%1tUtBōvE8.uyEE=w%1tOEEEE=w%1tEUTЉUEU]؁ÀvEvR 4%@u 9}sEȋEvRm 4%@t9}5E9}'EP#EEvR 4%@u 9}sEȋEvR 4%@t9}E9}EPEEvR 4%@u 9}sEȋEvRM 4%@t 9}sE9}sEP EE UPUPUPEU BEBEBEBEBEB EB EB B B BZe[^_ÍvUP= EH"A$}$6u4u0u jE4PE0PU,RE PE PUR` vE4PE0PPu ]ƃu E4PE0PjhGE4PE0PRlE4PE0PE,PE PU REP E4PE0Pjh{E4PE0PU,RE PE PUR PE4PE0Pjh1DžU )ЃR蝣ÃE E4PE0PjhP Sh]SƃE4PE0PVS E4PE0PPjVJ  E4PE0Pj h"m Džu ÃE E4PE0Pjh0 u4u0Sƃ E4PE0PV*E4PE0PRjV  E4PE0Pj h,* Džu :ÃE E4PE0Pjh u4u0S3ƃc E4PE0PVyE4PE0PPjV * E4PE0Pjh7y Džu 艡ÃE E4PE0Pjh< u4u0Sƃ E4PE0PVE4PE0PRjV7 y E4PE0Pj h@Z Džu ؠÃE E4PE0Pjh u4u0Sƃ E4PE0PVE4PE0PjhJ< E4PE0PPjVg  E4PE0Pj hM }$b u E PhX]Sƃ E4PE0PVSK E4PE0PU,RE PE PUR^ }$ u 苟E PhX]S!ƃ E4PE0PVSI E4PE0PE,PE PU REP  E4PE0Pjh E4PE0PU,RE PE PUR d vE4PE0PPu ƃD  u 9U  }4]0vWSPu [ ƃ u 9U  WSjh<9E r Su U$RE4PE0P߰HPSwv}$N u4u0u j2E4PE0P}0HPk  Su E4PE0P߰HPSv}$u kÃE u ZE  PSh\hSƃE4PE0PVS E4PE0PRu ƃSu E4PE0Pjh ZE4PE0PPu ƃ6u E4PE0Pjh| E4PE0PRu F ƃu E4PE0Pjh0 E4PE0PE,PE PU REP }$ju ƃE u ÃE  u ޛE PSVhc4Soƃ0E4PE0PVS )E4PE0PU,RE PE PUR< vE4PE0PE,PE PU REP E4PE0Pjh% E4PE0PU,RE PE PUR }$^u4u0u jBE4PE0P}0HP{ E  E Phm]S\ƃE4PE0PVS E DžDž9U E4}0UE E v}|u+PWjht Dž RhzPƃRWVP Ui9E NE4PE0Pjh~}$u wE E E E E PRQh]Sƃ0E4PE0PVS hP+E Pu r ƃ]~,E4PE0PjhbDž Dž19U4E0RPHPR`PR)؃0~0P+P*09|v}$zu ƃE E E E 8E u E  PSVPh]Suƃ E4PE0PVS/EP9u 蠗E P Ph]Sƃ0E4PE0PVS=u WE PPh]Sƃ0E4PE0PVSu E PhX]Sƃ E4PE0PVSFE4PE0PU,RE PE PURY hP+E Pu ƃ~.E4PE0PjhBDž vDž19E4U0PRHPR|^PR)؃0~0P+P|,09|E4PE0PjhJkE4PE0PE,PE PU REP |΋+U 1ۉ9}؅}CE ؅}C$)t9SPhWƃ E4PE0PVWGC9| Ph]S9ƃE4PE0PVSa9E DžU4E0U]hSË+} ~19}!E PhSÃF9|PR+PP?YRPjh~RPRj0+@P ]hS19}[CE u7vRv4%t E .F9|PR+PP<} 9U mE0+[^_U WVS]} ހ;tAtWS1u )9v&H#C;t;\u C;t퐀;.uC;u)e[^_ÐUWVS]}]EEUEPWjhl;] s\3D3;E wPFPhn4tURWjhr|#tǃhViÃthVOÃtChdVj~~UvhdVjXQi6 t$hdhdj vtdxtvC; t; tƃhSqÃtACt;;t6; t.; t)HshS6ÃtCu8e[^ÍvU WVS}j#^;tW3t-;uƅtE 9FuW6ue[^_ÉU WVS} ujÅt9suWEPC0ފu~؍e[^_USh6tu u_m]ÍvULWVSE DžUE} t% }tD}:Dž, Dž-UBЉUB%DžDž փ ;VPURtà ҃t;{}t }u?vӁL)‰UDž@@Dž DžDžd8;vVPURsà 9҃ލF ;VVquǃVcu }uuV/ud8vV,uÃ3;3t}t }ȺhWVREPrà 8W҃!;]Ӂ);P]} hWVREPqà |BW?st2;n;~:vP諱)v;}tOW>PEP1PjgPURh j%7 0{v t# svbP3tURVPURhpà ptx; u/ȺsvӁ~v)ov5,t%5hj% ރ>v;t,u'ǰ))‰=rSh^r,Qj#hq:SVc)ރ;t+vWhZu~;s 07t&~}uPh=uM};iaURӭ)i6 tPPh]x8 81[^_ÐUEtuvPuu u ÍvUWVSu] h6u{su 8wtt E.E8/1j.VuVflƒt=w%v1>~.hVSmwvhVh|EE@@ i6 tEPEPR\v8 =w%1u:.uB:uӀz.=w$%v1tj:Vu >:>~.hVS-vBhVhw{EE@@ 8=w$%1u ::t:.uB:u΀z.0hǃu8vhWEPjV[fà }W豝ShPw4EPVSWÃW腝28#8W_Sh11e[^_ÍvUWVSuh6uou81}uI} uCj hV}tj h V}uE EE }t }t v/;E tv}t}t4vPFPFPFPhPɞ pv3%P3$%Ph2P舞Kỹhh9P vh迚ƃu81>hVj jWbà }R}u4hhBWxhVj jWAbÃ0}V;ShJv VSh1j PSV ÃuV1{VךECE C PhEP[ }u)i6 t hh%qCC 8؍[^_U\WVSEM1E 9E}v7ЉU1;us:#797t(7л7vF9s#97uEf4x}u~ Dx9}}G;} |}t\] 9]}TvuNx@Mv6u f; ~& f f< ED]TNyEE 9E|[^_ÉUh6u kt}t h6ÐU%h6ÐUVSu];s~s~Vu 3\3)s1e[^ÉUEPu uÉUl WVS]u tShj#كn舾u BjjhHjRK\ǃ 􍅸PWtShW, PPxRPhW,  tW,ꋅ+P=u Ft5hWi,tiPhWI,=thW/,hV@jjhHjP[à uNWLv<%u(~mu"FS􋕨RtP_vSP'`FuSj`Sƅ uVWT.WǾ+  tT)‰Ћ)‰DžDžjPj=uj P5 jPW5fajRW5W@))‰SDžDžjPV V'[^_U=t5ÐUVS=u/jjj:jjP==EjEjhhu]S-qjjV5輙 %uPjhhSpjjV5脙 %u5x[^ÍvUEUtE tutÍvU5舝UUtÐU WVS]u EFt7ЍxCu1:EuWVS`uK؍e[^_ÉUWVSE} " Btpv9u Bu@u1[^_ÐU WVS]} vRpnƃ44GvRFn49u Cu1QvRnÃ4Wv Rm 4)É؍e[^_ÍvU WVS}]E EvvRmƃ44E@EvRdmv49tWvR7mà 4EPv R m4)ÉCtO>1e[^_$FreeBSD: src/lib/libc/i386/string/strncmp.S,v 1.6 1999/08/27 23:59:35 peter Exp $SD$L$ T$@AJt}tm8ui@AJtnt^8uZ@AJt_tO8uK@AJtPt@8u<@AJtAt18u-@AJt2t"8u@AJt#t8u@AJtt8t )[1[$FreeBSD: src/lib/libc/i386/string/index.S,v 1.5 1999/08/27 23:59:30 peter Exp $vSD$L$ 8t@u1[ÍvUVSuU ]u CFl vCB3\sQ sCS:Npe[^UVSuFltXPjV؃ue[^ÐU WVSEpl1EPkt(E;F|^VWEP3܍vvՐe[^_U WVSu}~pt V~p~=1ɋFltv9P}P@uAVKj:Ãu JltPE0 Cu3-7Cu$j֍3̍ SPjiCUCS PsEpN 7swvNFlC^lFpe[^_ÉU WVS]} uSM[ltOv3W聮u;CuPsvm[utC UCBv1e[^_ÉUEtt.tt k1s)!Phh  ÉUWVSDžDžDžj/uu5ǃ=tB9=t:5l8t&~`t VAVރul8=} t E }t}u 5l86tFPuuu4jt芊ƃjtV) F\FhDžPPv\蛒tu f;FdtM~\WÃ~`tF`PPBЃFhF`WS蘐S ~hG~`t F`PPBF`F\juhhhS jSÃjS#D8#DžDž jPSNj9tSVhjFHP^FIFHFLfFJfFXS螓(S菓Fh@,~`t F`PPBF`F\jSƅDžjjPjhSà u:=@9=@9 =H9=h)f=v{CS@gDžKRPPhFURh|AjSЉǃ tFCS@Fh uh 5tKCS@FhBPRedCS@ЃjFHP*FIfFJFLfFX FhjAuFP~`1DžF\h hF\PRPjhFHPvF` uhS'Fhjjv\uhbJDžS"Sv\ċƅ PSv\蛍ufFd/vF`PPBЃt V  $t l85l8} tU 21h[^_ÉUWVSuE~`tuEPEPv\t}u Ef;Fdt8^\S`ǃF`PPBЃ SWWq F`PPBЃF`F\FhVe[^_UjuÍvU WVS}1l8tHCPW3u,St l8S贄 ދue[^_UEU@P؂MU2PuDMM1EPEPt vUEj ]SE@`HE؋URPShCEPhBjEp`ЉÃ0t)hqEp` #uC cvu ÃuOEU@PMU2PuCMM EPEPuuEPhC|؍e[^_ÉUS]=uhh^t 1]ÍvU6.& ÐUS]=uEPuth't1h']ÐUU hBPRuQxt 1U,WVSjEP EEUREPH\u!URhD4qE 1*}u"URhD qE vUUtvE@POvǃuWu:8E8 E@P'vÃuSu8E EPhDp5h8uSuWURp8ЉƋUE 0WvSv 8vEPhD#pU EPhDpEU e[^_ÉULWVS} ]$1=uEj @uEt"DlPuƃu4h5 @9 H9vDhFXjEPzUfzu(jEPU REPfgUfBE@pUFBF BFB FFEUFV F$F(~T^\F`Fd)}33E3ẺEEEE E܋UUjWvX^8SSeEPSh FB<6t*B<"EEPQ2.l}1ÐUVSu^{t 3nSPztCLPBЃSdV}de[^ÉUWVS}u 1nvEB=~=Z S1cƃu 1SjVhuhVjxP iMAQ PT`} PTptpPjjV@PiH }LjhP|hhx)‰`l|)ȉC}`C@B`}W)‰XXCO )ȉB} XB@BX\PTP| uTu DžHHt-Hu\E9t Vb}G$8E9t VZbE@$LP(SMQu }7hlEtu-G(6G$E UB(B$E([^_ÉU WVS} u~=VWE0kÃu躇UB(B$v)߅ċEe[^_ÐU=uhh`UWVSuEÅu 1vVEPVBЃu.Pu hhS2߰Ѝ\@}E$vu>Ph+U)PS{uƃhISc߰Ѝ\ tVhRvuh`vuuh SbuuhSbEƀ ƀEe[^_ÍvUu uPhR5ÉUEv " ÍvUuPhR5ÐUVSuÅu 1v@9 tuM5D9x5H9/=P5@9TPVh8"hSW$5@9+PVhE"hS1ƃ ƃ؍e[^ÉUu4PhR5ÐUEv1P"ÍvUu uÉUWVSu uMDž|u|PVEPe^|jEP(bv^u+DžlDžhDžpDž|Et.%Džl)DžhDžpDž|~^|fukDžxxPtPhPlPEPzkà jpPhPlPEPbà |||VEPbÃfu]#8t)jtPhPlPEP:b E9t"|PVEP!d}͂8؍H[^_ÉU VSu$j@jÃu 1{<uxt8 t8K PS@C SCC ujjC(PVLSVhN C PVXNFV@ЉC:u~/t>/tj.VUt1u D#>:uF>/ЉDžS#װ҉PS5fhg#Sf VSfj.V t DžtjVauDjVÃEPS[c|E%f=tScqvhPScƃS\c u̍RQ} Se} PQG RM L􋽄WWC FE ;0|1U ;r}DM LtB Cz v B F} ;w|1E ;p}FM LtBCzv BF} ;w|1h[^_ÍvUMAtƒЃ v,t -t+u߉ÍvUVS]ut= Ѓ w01҉TP9C Ѓ v;U| E 1[^ÉUS] hjEPut[U)9:uLAj;jEPQ\t(E+E9:u!AjQщU)Ѝ9Eu)Ѝ9Eu#)EE}2;VNE1ۋM ;Y}OPu L*C} ;_}$;8Puߋ8L؉EE1ۋE ;X}SU Pt L+vCM ;Y}$ PtߋL؉E1ۋ} ;_}E PEu UЉUMԉMv}; }9};E \u#1tXu E+EE+EM Lڋ}<8tUvUCE ;X|MًU LǂPǂT}߉`ǂdE@h8EU BBMىLǂPǂTE@} G }t UċMDG }  /] LEPURS2)]C}tMQ}WS)E1e[^_US]Sh@#4tjSh@#]U=|5hjth@ÉUWSh#MÃu =~Shl߰H=%tShUW;u=LTh@#hLW?hSt,;:tjhSth2e[_ÍvU WVSE}E~t;F}1ҍP<t6B;V|1,;V}E;F|NvB;V};}2LWV3EP6SW CL0G(e[^_UVS]u 5VjS=e[^US]hjS]ÍvUVSu ]=uhJShVut C(% vC(,e[^ÉUhjuÐUS] Sjuh؋]ÐUhu uGU,WVSU1E IuP}썲LL};EuUB};D~E}tW~SA2@93u5u2B93u)E~!I:@9;u 2@93t؋EXIUU E.‰)ЉEU))E )yMQx vEQų )‹uV)))ЉF))EM$I)))ȉF}FEEM)Ћ}Dž}O+]؍؍؍G}GwuQ։U)))4EHyEEHEQmӉU)))))E}}E1ۋMu>QщU)Ѝ9Eu)Ѝ9Eu#M; }ǔu~N#F;#|MA)EAAu;4}E@}G G U W$[^_ÉUuPU8u EPuaPÉUSEM  9%1[ÐU WVS] M;| 3 Й։)Vue[^_ÉUSUM AZ)É؅u@AZ)É؅u2A Z )É؅u$AZ)É؅uAZ)É؅u)‰[ÐUWVSE}ԋu jMALؙ]u!!jVSqMуu E@UBz0t"Ѓ@9B0tr0 8MA0E` ߋ})tP^u(U9zr :)z=MQEP"u$URE URPUrMуu"u=t EPDjSUz0t"Ѓ@9B0tr0F7MA0UBBb ߃=t Ri1x[^_ÍvU WSE] EǰHEUBUE=t S}iEPSǃ=t Snie[_ÐUVSu] =t S,iKyC;C|< tSV+ƃ=t She[^ÉUVSEPu ]ƃt+Åt huu*} fC 1D7;Es5^SURWj0]߃B;}v!}t MQ(+E e[^_ÍvUShPuu uAà t$uuPtÍvUShSuCtuuuu SÍvUVSu] 9s!@tсt t@9w1P([^UEރ:w$h$v1UE߃]%ÉUUBvB ÍvUWVSEEU9EEU2u%t =tl~UBU9t.UPBUuǃPFf 9uWKuԋE8u@>u E+E _vU:u(2؃? Ћu O(*vFTEE9E0{Oe[^_US] jEPu=1C@ ~CCjSEP]ÉU WVSEu }xu]x uW@@ X;tA)B9} &)63X;ue[^_ÍvUEM UttRQ"RQgN/ÉUWVS}EEuEeShT%Ƙƒt1T%B=wW}u/E}FE.u7}t1}t+FEGu}~UE v1e[^_ÉU,WVS]ECCC mEE8:u @E8:yUUEE2EvV_%WɗuVp%W賗t e) E܁}Ey:uG}}}u}]XC;EECE܈CEE-.s;uSUR&*}7G}*}tC;EvnECE܈C}t,+u9M)ى)ڋ}::C9~];]u"EU EBEBEB 1e[^_ÉU WVS߾%fjSEPj؍e[^_ÐUEPuuEÍvUWVS]1cKjEPSGK8"tM9]tHE4]tM<.u t0GC6v R 4%@u1v1vtt&tIwʁ}wEpvw}w}wEUCw}y}l}_EU ЋU ƃ} tU e[^_USM< @ }'B+v1;}; | ;J~@;|[ÉUS]jEP(} tEE]ÍvUME EUBEjjEPQjREt1vÐ.v̀rÐUVSuUt$] CAuJtvAJuvJu[^ÍvU,WVSu]E}ٿ&K&)Ȋ8хu}K-EPh &E PdEPSE Pe[^_ÍvUSEU ]~;|SRPa#S4R9s1v"]ÉUS]~;} !Hj$hS]ÍvU WVSuӃS ǃtSVW&v1e[^_ÉUWVSuEFӁvR 4%@uҀ-u E+uF}t}u0u>xt>Xu ^E}uE 0uE1uEU1EÉ©=w%1tnӁvR<v4%ۉځvSv4%tCC;E}=}| ;}wu;E~ EE}NJF€&}}E" }t߃} tE}tFU e[^_Ív$FreeBSD: src/lib/libc/i386/string/bcmp.S,v 1.5 1999/08/27 23:59:29 peter Exp $WV|$ t$1L$u L$t@^_ÐUu ut1Uu ut1Uj@u ub t v1Uj@u u: t v1Uj@u u t v1UE hPPut 1UE hPPuqt 1UVSu] SVtACPV,t-CPVtC PV,t1e[^ÍvUVSu] SVt-CPVtCPVt1e[^ÍvUVSu] SVTtCPVht1e[^ÍvUVSu] SVtACPVt-CPVtCPVt1e[^ÍvUVSu] SV\tCPV4t1e[^ÍvUVSu] SVt-CPVtC PVt1e[^ÍvUVSu] SVtCPVDt1e[^ÍvUVSu] SV|tCPVt1e[^ÍvUVSu] SVttuCPVu1e[^UVSu] SV,tCPVt1e[^ÍvUVSu] SVthtEjCPVt1e[^ÍvUVSu] SV`thtEjCPVt1e[^ÍvUu ut1UVSu] SV4tCPVt1e[^ÍvUu ult1UVSu] jSVZtjCPVDt1e[^ÍvUVSu] SV|t.tu"CPVdCPVou1ve[^UVSu] SV,t-CPV,tC PVt1e[^ÍvUu uHt1Uu u$t1UVSu] SVtJt"wt :t#2CPVCPVCPVu1ve[^UVSu] SVHtJt"wt :t#2CPV'CPV[CPVu1ve[^U WVS}uE uSt uGjV_ËU uh&51;VjSjSWU҉ƃ?uS E e[^_ÍvUVSu] ;%EEPVu1#}tuuSVve[^ÉU WVSu }jD{Ãt6VƉsu_SVQtNCPVe t:CPV)t&C PVtCPVv1e[^ÍvUUE w:$'v8 0 ( @PÉUUE tu@PÉUVSu] Ftt"0~u fSv4Sv FCtwt ( t!FCFFC FCF Ce[^ÐUVSu] CCC t{uSuLC);S|S~u+1KB;St C t uSPte[^ÍvUSE] MUtt!RQS) vRQSmv//1]ÉUVSUu ]BPBPBPPh4'SVy[ 9sG/1e[^UlWVS}1EEEUUME<M)ȹ)ȍ M E}~E]EEU<uu Ӿ Ft}t;u~]uE}~t}t;u~]u}t }E]E}t&M9M|E9E}9E:C}t:C}u\}uV}t}uJ}uAEЉ)¸.)PSE PJ߰Ѝ\*EU4h@'S ÃE}?}tEEu:CCUЉ);EwRM QqE O-1e[^_ÍvUWVS} u]tVtACtJuutAu)H[^_ÍvUWVSu} EPt 9tAs)։)u$߰ЍDtAJC;u)[^_ÐU(UE EPEPÐUÉUSM] t$r t5;vEQEPQB#AURQЅt E1]ÐUSM] t$r t5;vEQEPQB#AURQЅt E1]ÐUUM trt"(BQR@BQR 1UUM trt"(BQR@BQR 1USM] t$r t5;vEQEPQB#AURQЅt E1]ÐUSM] t$r t5;vEQEPQB#AURQЅt E1]ÐUVS]u tGrvFEUBCRS@Ѓt^CURS@NCURSЃt6CURSЅt#E1҉Ӊ1ɋE1 Ӊ^1e[^ÍvUVS]u tGrvFEUBCRS@Ѓt^CURS@NCURSЃt6CURSЅt#E1҉Ӊ1ɋE1 Ӊ^1e[^ÍvUSM] t$r t6;vEQEPQB"AURQЅt Ef1]ÐUSM] t$r t6;vEQEPQB"AURQЅt Ef1]ÐUSM] t$r t6;vEQEPQB"AURQЅt Ef1]ÐUSM] t$r t6;vEQEPQB"AURQЅt Ef1]ÐUSE] UURPt E1]ÐUSE] UURPt E1]ÐUSM] t,r tFKv;%EQEPQB*AURQЅt}%1]ÐUu uÉUVSuM UӃt )؉Ã>u.FRQV@ЃtRtUFShV@F>u/FRQV@ Ѓtt"FShV@ >t1ve[^U WVS}uE VW6;uv?uwt rFtQgvu[u,VWËE uh (5(VSWvtSE 1e[^_ÉUE hPPu-ÍvU WVSu} ]WVLt{t9t{u}u1$jEPVCvjURVUҍe[^_ÐU WVSuE t u߰HEEPV;E9Ew|UBt rBtNhtZu,RËE uh:(5貒4EuSV\ SE v1e[^_ÉUju u UhEU fEfEEEEEEPREP‹EÍvUE@(`c@,c1ÐUEU} ut@0 tH ÉUM U}ttEtA vtÍvU=‹ BBB BB B$B(B )B$*B(+B,,B0-B4.B8/=t(‹BBÐUSh@jjhg(hPhLuà t u5H\H؋]UX(=Lt@Uj juuUSh`jjh(hhuà t 5pp5|u¡| 5[¡5D¡ 5*¡5¡ 5¡5¡ 5¡؋]U帀(=t`UlWVSu(tu(uE QE8t(0EPuE  }փ58Sjh(S EPSh(S uSjSLi PP`u wO<Pǃu EPW>4PSP ;;~ u!VSƃ;u|uv;u}Ozu􋅜PE8t 0E819}߰ËE B9|;U}E B;U|E 1?vWxu􋅜Pl_[^_ÐUVSEu 19sj Pg@C9r؍e[^UVSut>u (>v:;:-uz1uCBr=w%1t B=w%1tB  u(9tvCB:i[^v̀rÐUWVSuEFӁvR 4%@uҀ-u E+uF}t}u0u>xt>Xu ^E}uE 0uEE}tEE1uEU1EÉ©=w%1tnӁvRv4%ۉځvSv4%tCC;E}=}| ;}wu;E~ EE}NJF€&}}}tGs" v}t߃} tE}tFU e[^_Ív$FreeBSD: src/lib/libc/i386/string/strcpy.S,v 1.5 1999/08/27 23:59:34 peter Exp $L$T$QtLBAtBBAt8BAt.BAt$BAtBAtBAuX$FreeBSD: src/lib/libc/i386/string/strcat.S,v 1.5 1999/08/27 23:59:33 peter Exp $W|$T$ W1OtLBAtBBAt8BAt.BAt$BAtBAtBAuX_ÐUE9vMQSU҃ MQWU҃‹E} v؉E}uMMMEJv}&u]MNvu]MvCAN}}}E HEEEEmueE}uME}&u]vNvu]CANEE};}URWMуs|uqE}uEMMEH}&u]MNvu]MvCANU)UM)M;}EPURMуa;}wl}uMD}&uMvNvuMCANE}E)E}UUUE EE9E EEEЉ}ev}u+U Jv+E}%uvNvuCAN+};}vW+EPMуEEU9UiE EEEU+U+E9~Ѕ~E)ƒ}$]щNvƋ]ѐCANU+UE+E+E9vЅ~CU)ƒ}!ыNvƉщCAN+E;EvMQUR1uPMQE+E;EvU)‰U1uE e[^_UjuÍvUWVSEPEP$E%f=@t vjUR.[DžEPS{E%f=@tnjjP<Mj _2it DžU tFPSH1(t t 1ZDž1Dž1IRP訩c)؋NjPSWRƃ~)눉M ] tV􋅘P;jUReY u+􋅌P􋕜RC Džv1;sDu:ft3WG)É9׃9t˃t F뵐hpjVRDž1;t_tPCPT t {u E tF<u􋝈S$vPP+x x-CPhC tBCe BE BR+ B3# 􋅜P􋕘R 1h[^_U=u5EUBEjjEPhjRetÐUVS]sSa 3Cs c SO SN VVe[^ÍvULWVS}w0 `} TEEuUЉUE EPEԃu EEЃUREPU REPURE EEԉEEE EEЉE؃$EċUԉỦ׋E9FvẼ$E̋U؉U+EEЉE܉EE9Et Ẽ$E̋E+EEЉE؋U9UY9EvEPURU҃EEuU܉UEEEuU؉UE}uC E}t/u;uVEPU҃;E]yvEEE;SURU҃;E]E9EEދU҉UE0;]r]+]9vSURU҃;E~ދU29EvqvE)1uE0SEPU҃;E]vދU29Ew/}U2SEPU҃;E]ދE9EwҋuUUE9EuY}t/vUU9rUUEuyUBUG9rUBUGMuV}t.UU9rUUEu!UBUG9rUBUGMuE9Es U9UE9Es;}tUUE9rZvUBUGE9rBvU9Us7}tUUE9rvUBUGE9rE؋Uĉ$EċU9U}ЋEԉEЉ}ԋE EEȉ$U9oE9Eu!E EPUREPOoUЉUԃEP1e[^_UWVSEE}w1URMQEPURE $UUU v]MQEPSU)ډ]S]+EM D$UUʉMuU2PVMу ЉU;u{M<1 v};}s"U:PWMу%;EtӃJUM1+EE E}~E0F BKu+uu9rv}U<2;}seW+]SMу%;Et:U+EE E}~ڐ]F BKu+U9r};}r}~ +U]F BKu+U9r;urV+EPU҃~U+EUEEE Eu;ue[^_ÍvUWVSEEEU JUtG}vuvCANu+};}v+]WSU҃͋EEMue[^_É$FreeBSD: src/lib/libc/i386/string/strcmp.S,v 1.5 1999/08/27 23:59:33 peter Exp $D$T$@BtX8 uT@BtL8 uH@Bt@8 u<@Bt48 u0@Bt(8 u$@Bt8 u@Bt8 u @Bt8 t)ÐUVS]u EUM;tuQRPVSvt {u5t:w t4jh)P6k"t:w qu1fSwI$ )c , ;e[^ÐUu uhÉU WVS}jÅt85sGCGC {e[^_ÍvU WVSuU Ѓvߋt]9SutTC ;FuC;Ft7jCRP6CFFF;C }VwuSe[^_ÍvU WVS}1t!9zuRӋ݉F~e[^_ÉUVS]C;C| CuUC{u!CuCPss 3C~'CK ufytASJs)։9~1AC9tyuCuȍe[^ÍvU WVS]} 0 S>8tu=0t%C$PSWt E8 vE1e[^_ÐU WVS}=u EPu &ƃt5jjWh,Ã|ڃtE9t21?tfp Et uH fx@@$e@, f@(Pf@ fe[^_ÐUE URPjujhBUS]SEt K]ÐUUB f t1 R;ÐUS]=8uCC C uMC u* vC t&Sc CCK 6{0t.C@9C0ts0C0Ct36q)KC =~s_v~tFC4~t F ~tFE~t~t ~uFCMQSu1e[^_ÉUVS]E H{4@}P(SDAK C$jP @PS t QVS0S(uC,K@C<Й{@PG(;C~CPS e[^ÉU WVS}E4jW|-t EtN04uуWt}u E1;}*8<0t40`C;|܃tQW1}u1+Ue[^_ÐUSE} t?tX4t+jjS7,uӃSuǃ01]ÉU WVS}4aGj h) ЉG@SW0 jjjVut6hSVMt=t"O,Bv1ۍ8<2t"jjXP42W uC~1[^_ÉUSEX}uuu jS ǃ,]ÐUSEUXt$tRǃ,Gvu*ǃ,vuu uPSl]ÍvUSEX}vǃ,/tju jS"ǃ,]ÐU,WVSEp URUM MjjRQPmPEPD&EuUUXMMIEXUE9U.vf{v5)9EuuMy׋MHsEf{uAjEPPUR%EX MEEp f{URMQEPURMQE EEEPURfju%PMQ%E~XEEUr E9E} w/} r)URMQEPURH E`;Ub,v} r,} t} vMavEXUf|SwjMQRPEP?UDSMAMECDK)‹MQEPURMQluEPURMQEP\tXUbSMQEPUR(t02vMaE` Ub1e[^_ÍvU WVSEUpt*t%t 3dž,$|udž$dž(dž 1 u^$ Cdž(;^(w#jjSV"ƒt zf?t͉$;^(~dž$A x(f|GuA=C=A>CEA?A@EUBA@BAABABEAC1ҍyD]vECDDCDECDFEDGVfEEQEQB~[^_ÍvUWVSu1Lhhxt#x=x~ttth Džt|uDž|x}uE}uNLECDž|xDžlDžhLUDžtEDžx}t }h$sà 1ǃEǃ|Eǃj$Ɖso1 󫋅L9t ^FTFF ЧF (FFFh}tWE  tt uU RMQ.-vE  jj0oEPRE EjEP'}b1u  EddBEBEBEdEE``BEBEBE`EE\\BEBEBE\EEXXBEBEBEXEETTBEBEBETEEPPBEBEBEPE}b1}U=EE_xE EEdxu0Ex=w Džxxv Džxhu  ǃǃ xlt*xI#ltlBl!‰lx9lsllO1Nj1tffw fǃWjI uSh4h3JStRM t!@E@t!}}"[vvOt7{ts耺tzSZ18[^_ÐU WVS}jj7Jƃt jV#8EP7AIƃt|EP7*IÃte}u_CCfCfCC jV肽jV7MK jS7=K1e[^_ÍvU0VS1uh)-Ã؅u)Ph)hVB ]SB EPSjV à t V\jEPj؍[^ÐUtt  1USEX{tjs3:JC u v[]ÍvU WVSEX{tjs3IC}t}EPu S<ƃu[}uj63I@jPujjVS:?ǃ !@tj63JICe[^_ÐU|WVSEU } uRUӋEUBBCBCECCEUBCBCBCECCEUBCBC BC EC C EUBC BC BCECCfEECECCfEECECCfEC 1f;u/CEUUEEU܉U}ؐ֍ EfEEDSEDSU EUBBABAEAEUBBABAEAt?AE܋UBBABAE܈AE؊GGAGAE؈AfFf;uCQC @1f;u4CEUЉUẺEUȉU}ĉ֍ EfE֊E׈DSEֈDSU EЋUBBABAEЈAE̋UBBABAËAAtDEȋE@E@AE@AEȈAEĊGGAGAEĈAtDEUBBABAEAEUBBABAEAfFf;ux[^_ÉU|WVSEU } uRCfEC 1f;u1CEUUMMEE}vƋUB EUBBABAEAEUBBABAEAt?AEUBBABAEAEGGAGAEA֋MQfEEDSEDSfFf;uCQC @1f;u4CEUUMMEE}܉ƋUB EUBBABAEAEUBBABAEAAtDEE@E@AE@AEAE܊GGAGAE܈AtDE؍U؊BBABAE؈AEԍUԊBBABAEԈA֋MQfEҊEӈDSE҈DSfFf;uE̍ŮBBCBCËCCEȍUȊBCBCBCEȈCCEčUĊBCBC BC EĈC C EUBC BC BCECCfEECECCfEECECx[^_U$SMEUBBABAEAYAEUBABCBCECYAEUBABCBCECY A EUBA BCBCECYAEUBABCBCECYAEUBABCBCEC[U WVS}w~tjv6AFjW6A~tv褯F Ft%|dždžt%NdždžV(W S'1҅tЍe[^_ÉUSEX{tjs3@C} tC t11 tS"t3@u ]U VSujj6C>ÃtZEb1EEEE %EjEPS;jS6?1ve[^Cv\̀rÐUdSMU Ӆt S}EfEfEMMUUPuEPfE…tEЋ]ÍvUu jEPutUÐUjjEPuvtUÉUS]jjjSN1҅tډЋ]ÍvUS]jjjS&1҅tډЋ]ÍvUuÐUlWVSu} t}tp;tC;u+]K9r2%*))Š)K9r;XtˍSU} u }tMvK9vC;/uEPV/E%f=@t} t.hh VU }*8tQ}thV8uָlEPVgt8%D];t79t3Ph)t@8u 0CӍvCv1e[^_ÉUWVS}jEP#Ejjh *2à |jtEPS SٴE|Džxw 0_ˈwxw|GG02G 0xx~X[^_U=u+1v@=~hÍvUWVS}u =u 1ۍvȈEؙE:C~[^_ÉUS=u       É[ÍvUM19s v@9rÍvUVSu1ۋM Itۍ1Fs%0*))É[^ÍvUSM] 1iGuWEP"jWE0h(vESG9`SG9u.%CPWE PEPƃtsf{uECfKftSE PEPktGtIjWE0'}p1EjWE0'.jWE0'WEP,e[^_ÍvU WVSVj6E0g%ÃvfuESB<GtG PUR!ƃDCu^;u!fCUfCC SEPSUR"v7 C؃)RPP-"fsUCuWEPEPEPQ]SWWEPEPEPVEP ƅEBFf9Es'%U)PЍDFPЍDFPfFEUԋB tdw tbMVF)fFfJEB0WMQS2UԋCMVF)fFfJEB0}u M܋vEЉUԋE܊H CEЅuU܋PE܃ PSMAq ]S f}tEDF0vEPTPEP U؋CMVF)fFfJEB0MQ UԋC vf}tEDF0vEPTPMACMVF)fFfJEB0UBCv}M 9u9] }uuQS]vuuE PURt}jMQ]3njEP3^ E,U9tv1ۅjuM1ju]3 1ejEPU2jMQ]3 juE0juU2 Mqe[^_ÐU WVSEPEPƃu 1qvMfFUfF] CFFC F {u:]] C9u$KfFEfU]3E#ǃujVU21v] GCGfGUfGC G {t?js2ÃuW誇1pCjSU2Wu]SVWE PURà EWU R9u] WEU EE0؍e[^_ÉUWVS}EPWƃtEPW Ãu1jEEFCCFfCfFfCfFU B C F uuSVRW‹E0EЍe[^_ÉU WVS] }UfCfCC4G t G WwFCfCfCC4E@ tBEP4UFfCc K jSE01e[^_ÍvU WVSu UMfFfFF0CF tuUBNj F)fFfFF0C7G PSGtbw MQuKiEP‹ F)fFfFF0QRSSUC χvfFf N jVM1b1e[^_UuPvv36txF3C P66G GC }Ct.EPUREP PEPuM} u E!@tzC@U;Bv>:u P0vC@PE0wuPUC@Bs PU2lCUBUUvCUB É1e[^_UVSuEfxuyuA u v1A t@QB@uv@QB@tX P UEt6PPEPSV t vEEPu Ѝe[^ÉUWVSu} W;VvVr:t)‰ACsGv)Ɖ[^_ÉUWVS}E P;WvWE r:tCAFsGU ;Bs@[^_ÍvUWVS} ]ujWEPjGPEPE U;Es;>uusu65u |vEUEU> ߋFEjuE0ƃt];]v]SFPWjVU28E)؉E u1e[^_ÍvUWVSE UMEUx MM]EPEPÃu ECCC fCfCu9vVURCP@}tMAjQE0c U)]jSM1=1e[^_ÍvUVSu] jSEPjSEP ju6ƒu \vB tjR6Bvju6ƒt)]BERV9]w1e[^$NetBSD: bcopy.S,v 1.6 1996/11/12 00:50:06 jtc Exp $vVW|$ t$L$)9rу_^ʃON_^ÍvUMU BB jR1ÉUVS]u t9j3ƒtB  V3e[^ÉUlWVS} uEPW<{uE%f=tf1lh(jeÃt[1ҐDDD B~E 1RPEЋURPf؉e[^_USEU M] $[ÍvUS]uh*5nsS u1YQE AAHTt HJ QACA CACA]ÍvU WVSU E;r1vE PURÃCHUL;t CBCACtXYK{tSC B vC UBS CCUBC BCBKvURÃ1E U1jWVwz99EsyU;tǔOE CCE HULtXYKCUBC BCBtss$АCe[^_ÐUE U`P1ÐUS];t4 yt QA B A CQ AQm;u̓Sm1]ÐUVSut"vCtSVt"[u1҅tЍe[^ÍvUVSu; rrtlCu^CtSVtyCHT;tvCBS{t SC B C FS C4[uPkÅtCC1e[^ÍvU WVS} tE pp$ ЃU B1jVSw9u39u/E pev;u U b1e[^_ÍvUU BE9Ptu1ÐKwv_̀rÐUVSu uVjÃt VS]؍e[^$FreeBSD: src/lib/libc/i386/string/bzero.S,v 1.5 1999/08/27 23:59:30 peter Exp $vWS|$ L$1~ڃ)Ӊك[_ÉUEPu uÉUS] {tSu<'CC C1]ÉUlWVS}M UG $fEGfEGEċG,EԍEEEEERQuVBÃ|VTtE@tO @؍[^_UVSMEU] t txv w K0 }K%+)щʀ0gfffK)Ѝ)щʀ0u=K$0u}t(<0t$K0Kȃu wlv[^ÉU WVS]u MEUυwRURPQS t#vwu wOjj VSQ(0v(Ojj VS4(0jj VSN(É֍vOjj VS4}0jj VS~É։ uOvO$0 u}t0?0t+O0%O؃ u Gkve[^_ÉULWVSwkDž =tEP謚UB tzu2MQNt=t EP芚UB f uDfz|==t RWMQE PUR_DžM Dž$DžEuuEEDž t%%t  t%u⋝+tLS^]E}~EPMQ u DžDžDžDžƅ  X$8+uƅ 뵍v1ۋƒЃ w\BBЃ v⋅8$$u)0$$PQE Pr$t$EURAEv$t#$BvEMIvƅ+v *1ۋƒЃ w!v\BBЃ v⋅8$uw$u)0$$PQE P$t$ vEUZA5$t$BEMYWDžH1ۋ & \BЋ ȃЃ vԉDž1ۉ \BЋ ȃЃ vԃ$uC$0$$PRM QltR@Ft /" P$t$AEMA  tw$t*$H!EUBRt $uIj@t2$t$/EMI=$t#$BvEMI} ƅ- u u Džu Džt<$t$(ݝ:E MiݝB$t#$ݝBvEE@ݝt+ܝEuƅ-Dž+v xtDž+F  t _Dž  PP RPPQP,0 gt Gu?~9~E gue vDž g eA QEPvV fu;~&u tW|9K@;|Njt%"+ Gƅ- tI$t$AEUBHtE$t$BEMA?v@tE$t$BEMAf$t$AEUBv t[$t.$HvEUBRtA$t$JvEMI@tF$t!$B^EEPEv$t#$AvEE@ $t#$BvEMIDž +߀Dž x$t#$BvEMIu Dž+|>PjR"t+;Ѝx tZ$t-$HEUBRtA$t$JvEMI@tF$t!$B^EEPEv$t#$AvEE@ Dž$+ Dž + t[$t.$HvEUBRtA$t$JvEMI@tF$t!$B^EEPEv$t#$AvEE@t& t t tƅ|M tK u twQPRPQR=vu t1QPRPRn +x1  P Pƅ9}tt9}+~EFEE}~EPMQ u^]E}~EPEP]utFEEtcƅ0 ff FEE}~EPMQVu%=+~~~C$FEE}~EPEPku$^]E}~EPUR-u)~E$FEE}~EPMQ`u$^]E}~EPEP"uu~} eG݅D@5+FEE}~EPEPu;|FEE}~EPEPKuKH~C$FEE}~EPURwu$^]5+FEE}~EPEPuFEE}~EPMQ`uۅ~~~C$FEE}~EPEPu$^]E}~EPURQuFE;FEE}~EPMQau)Å~Fv$FEE}~EPEPu$^]E}~EPUREuFEE}EPURFEE}~EPEPCuFEE}~EPEPvu)N)‰EE}EPMQ-BBFEE}~EPEP;u݅E@t@JVEHEE}EPMQK~C$FEE}~EPEPu$^]E}~IEPUR)FEE}~EPEP/uUNME}~EPEPou+~u~DFEE}~EPMQu^]E}~EPEPu]}tEPMQu4Eu}tEPEP~uE t ]LUB @t Dž=tMQ $t09$t$ L[^_ÐU,WVSEEUUEEE@M EE/%u"E1MAMBX$,1ҋu TPFЃ v>$];]|EPEPS;]~]E]jvE@E*1҉vTPFЃ v>$u9];]|EPEPS*;]~]E]Fu;]|EPEPS;]~]ECBЃ MAMBЃ v1ɉLBЋE@EBЃ v$v@t sk t1;]|EPEPS?;]~]E Cvt0;]|EPEPS;]~]EC@t0;]|EPEPS;]~]EC;]|EPEPS;]~]ECft0;]|EPEPSf;]~]EC.;]|EPEPS6;]~]E C t0;]|EPEPS;]~]E Ct0;]|EPEPS;]~]E C@t0;]|EPEPS;]~]ECV;]|EPEPS^;]~]EC& @;]|EPEPS;]~]EC;]|EPEPS;]~]EC t0;]|EPEPS;]~]E Cbt0;]|EPEPSb;]~]EC*@t0;]|EPEPS*;]~]EC;]|EPEPS;]~]EC}~UP[EMU;M~Ewj$.UE U NvUE U :vUE U &vUE U vUE U A;M~}tE9Et uEe[^_ÍvU WVSE EE84?E@9}ƃu,VkDÃuqHWSEPJVEPSÃuAH)PjP IE E0e[^_ÍvUWVS]}u fu etEuCu(EPEPWSRu u}‹EgtGuEtN fu90uEE@t@ED@uU vE0E9UrE$U)ʉȍe[^_ÉU<WVS}] Ew}G-wv+F ~AIgfff)Ѝ)Ӊڀ0à I09sAF9r 0F0F)[^_UWVS}E xG tuWF*U  MrUG t^EEUrUtvPMQwG,ЉÃl])ދU B)؉BuPG *M MEpEtG %Bf=BuB9ws=W)ӍOOPRGÉ_G t&9s~SEP7F)_v;Gv-9v)SURPFW, Dv_9r!SMQwG,ЉÃXSEP7SF)_])ދU B)؉BEEu EM MEpEt}u3Vj UR#ƒtEH)‰U vNMEU9vG_Ë;Gv'9~#SURPEW+ uw>_9|SMQwG,ЉÃ~TӃSEP7OE)_)]uW5+u"E])ދU B)؉B1 O @e[^_ÍvUEPEURPEU RP*,EUÉUjEURPEU RP,ÉUU1Bf%=uBu}tUE1ҋ@%=u }ЉÍvUVSuu Vq@Ãu t V?؍e[^É$FreeBSD: src/lib/libc/i386/string/memchr.S,v 1.8 1999/08/27 23:59:31 peter Exp $W|$D$ L$uG_Ð1_É$NetBSD: bcopy.S,v 1.6 1996/11/12 00:50:06 jtc Exp $vVWt$ |$L$)9rу_^ʃON_^ÐUVSuP=pX@@ e[^ÐUuk>ÐU WVSuFE^1M ME ЉUȉG;}|ɅtOM;N|7F@PDËFK V PRQLB V\ލFMU BVe[^_U WVS]} M98)1Ҹ~ vB9R‹EBB  ~$ PCj RƒF9|C! vPCj RƒF;u|Ѝe[^_UU1uuuu|@@u ÉUMt't1`t NB1fuuuuu @u US]jdX@]ÐU}ԋuEE}tl}$}tU3U96+EE,v]K9|) )]]1EĉEȅ} )EUUUjE~}~EE9~}ȋU)U))U}~h}tL~4VEPEURPà UR2]])t#SuVvEPUR"}uh/Ã8O;F> $/v-l&l&t&t&&&&z&n|&b|&Vx&Jx&>&2&&5l&l&h/5l&CE}>=&t&EEEj EP=&t &=&t t&jjjhjhjaP& uh/;j H&T&=u % jY&@&e[^_ÉU WVSE]1 X&v t29Yruy9tABQMvyA)Y uSǃtW +5H&P&9sv1P&A9r=&t PhW }t"=&u E&vEPXe[^_ÉUWVSEwEHEuP&U<shENMEU9~.}WÃuEP1v]MfCfK MfC fC}{CE1vS E)w;u} {v F;u|;[uD1}~<{ME쐉!fK fKU)UF}ՋE +H&P&P&Mu 1vP&}K{u9t1u Ft1fK uP&}A)K =&tCPhCPe Ce[^_UVSu=p&tc v9s1$w V VsÃ=&tt VjS ؍e[^U WVS}=p&t +H& wh0 v;L&vh 1vP&;u[thF1;t=t&9u 9E ;v{@Ht h`1n%J MƃM#t h{12p=t&u-9u s(9E wuxh11KvE P4Ãt1} t"t;u sV M QWS W ؍e[^_UWVS}<=@&uh1!=p&M + H& wh0; L&vh 1P&Euh1vth1jEthF1MkP&P&ƒ|u1A1P&<t =&tVhUR =tjVMQ/}=&uj|&&UPx p=X&u@X&X&v}X&M9K s;tE9C s;u9{v&SPCPjU9S u<S KK;tw;PugE@ C EHKUtSXE9{u sMK4;u&X&h1 ;C;vuC ;&ujj 9&uUS‰S CRC &s +5H&FL&9wP&A; L&v}@UR/}K CHEth`1MSM#th{1=&tCPhEP DfC S P&f{ u2:t%8tʃ:t 9t @;CrOC f;CuE9t9uC +H&P&s9t SVe[^_ÐU VSu=th&2D&=D&t/h2 D&=t 1=@&u=|&t u1VÃ=&tEu]j EP  D&=t =x&tu h28؍e[^ÍvUS]=th&-2D&=D&th25SS=&t]EEj EP D&=t ]ÉUWVS]} E=th&92D&=D&t0h2 D&=t 1vt=@&u h11ۃ=@&uO=|&tuSM1,u W' WSƃЉU=&t]}uj EP  D&=t =x&t}t h2Fe[^_UWVSEE}tu=*uj+*UX]vC;t;=u+]]=*/v]utNt9t CA8tuA<=tu1[^_ÍvU WVS}tw=*ul+*E X]vC;t;=u+]]=*/v]utNt9t CA8tuA<=tu1[^_ÍvU$S=8t8Ѓ]S jS jSjjP jj7jSj jiP_j$FreeBSD: src/lib/libc/i386/string/memset.S,v 1.5 1999/08/27 23:59:32 peter Exp $WS|$ D$L$W~$ĉ Љڃ)ӉكX[_$NetBSD: bcopy.S,v 1.6 1996/11/12 00:50:06 jtc Exp $vVW|$ t$L$)9rу_^ʃON_^Ív$FreeBSD: src/lib/libc/i386/sys/brk.S,v 1.7 1999/08/27 23:59:38 peter Exp $D$9v D$̀rD$)UEU RPjuuuu ujh*US]uu CP| șCPSTfc ȋ]ÍvUS]C tjjjCPfc uu CPD]ÍvUS]uE URPCPiuu fc vK CPST]ÐUE@PU WVSEt1v_wNxvf{ tSU EXNy?uҋEe[^_ÍvUu ht,@uÐUd6Dž=|A=$t*At@9(=|b @(jjP}6I90h35#R5Z};0h35qv$PE PEEEEE EjEP56‹E  9t7N>0h35(ufDžPV5)Ã~)ffuɅ] 0h 45 6Dži MQ<U9~8h6th45|DžMfvff wAh6tPh.45{Dž(u vf)ft PV5Ãͅ! x 0hA4kt^J+Mfft?fwSP5GÃ~ f)uf;1h6u 7 hJ45z5;E~EPEPg v=|=$u@9(tv=$tR@(jjP}69 ) 0hg45w i6=l6t= uWQ5}+ 0hr456 ju u5;E G 0h~451v= tIƅDžfDžjP5R  Qju u5o ;E t+ 0h45:`6~ =l6 DžBR)ЍjPBz?B~B=}jh4fBfBBB BPjPjPR6à V8jPT;u;|{v;}j)B)ȉB}B@Bv)Ѝ0h4u0h6th45@vDžSDžPPjEPUR5 (0h45V=Dž =h6th.45uDž(f;t$h6u 7 h4i6u_P4uIh6u 7 [h45t5;E~EPURqi6usEEPMQE EPuquRh6u 7 h45yt5;E~EPEPH Bt tu[h6t7h45t5;E~EPMQ =7Yh6 u@Bt4h6th55sDžh6u7%!=!uh55csh6u 7 t7h-55;s5;E~EPMQ th6tu i6u=0tK11ېPEPURu u0Ѓ $D5C)xt􋅤P;l6t; d6@c􋅤Ppu(uN=?<v/[^_ÍvU=|65 $(ÐU|WVSEEuNEEPE0GOjjEЋURPǃPNEv}tVU҃F$P ÃFCFfCFCC@PCPFPʜ9}r!(PEPRtgE UEBUURƃGEP}t}tURjEPURE UEBSMEU4(}uEPURsx[^_ÍvUUE PP$ÉUWVS}]}t$uE PEPJ|1tVJEGEEEGEEEG ESEPhjwSjhjjƃ ^t(t!GGƃ }u ! v|}jjj|P uiud8uZE ;! h`5|P @!t8ME t t! EP|PE Es!FFȏF |F XFFԈFjj3hƒtcB ub J jjR3/jt$t! ujSЃtC?4t V (}t|P1h[^_ÉUSEX{tjs3iC!u v]ÍvU WVSEX{tjs34iCEHwq$d5U 0t]svC(ts$Fd]C(ts$NuP! ujSЃvt;vbCtt#QE tE;wHPS^DC(t*u B\N)Ãr2P=VGfFEf+Xp0PVGfFf>E)fLFf\Fe[^_ÍvUWVSE pUEf|FwU REPv}t UDVUB NjUf+|VEH9trLFˋE XډUUDV)PSEP_UU5f|VuVfDVfDVVfDVDVfDV;U~DFUfVfDVfDVfEH8U J1e[^_U!EtjjuMQ$!Eu>}EPPEPURM QEPgUbMaIEH UJ HM؉ˋBEfEEf|svsE؉EUމUs)‰ЉEPuMQ;E u\f+EtHf|sDsU)‰PDsEPEPSfsf+DsMfKf|K|sE6DsE؉E sDsU)JREPEPfETsfUރ9Mf) E)fLCf|CE`Ub1e[^_ÍvU\WVSEE܋XURU؉]EMfM;Of;;CfHfw{EPu VEp PURMQuV CEE5URUԋMMuvu؋EE܅kU܋ZMMf|C CEf)Uu)ftSUfTCjuVQEPzE܃U܋ZMI fME}tuVEP U܉UЋMI fMοf;;f{uuȍEEĐS؉EMS)uȉNDS؉E SDS)uĉNTSfU΃EpuUR;E u{Mfyv)FuFTQ9wEPVQ6vURMQEuvuԃEPURVLMIuf~v6EEMAUBETF9UwQMQV E@<\tPdU\@jؙ]K t1RPEPut/URV]Sftt;EtOf}u)f9u#fEP fV]C fFExt~}t:X 19}lMvEAADADEDB9|>fEEEA9uQfEFQEDQB9~1e[^_UWVSu }E@ EUuR[G]]Extj}t:X 19}XMvEAADADEDB9|*19MVfEAVEDVB9~}t$UZG~j1h5jaEx ED  UB H9EuhE}MQj PEPEDC~[GrUz ЃD  12EE}E}$M)M U4ÉyC؅}C$)M UB ƍ\;Z$|KJ$19}E;XD~ DF9};tU+\@ %1e[^_ÉU WVSuU B f ft‰T@JQ;V$}V$NF H!Í8uQVƒ؅}C؅}C$)!U RVe[^_ÉU0VSu]SEPSj覻 h. t"hjjm jEPjV1ue[^ÍvUWVS]fELSfMD{fEM AtS)ft{q1PSEEf+pf4{p0P5EMf EfD{fD{MAM fAM)fLSftCe[^_ÐU WVS]E ;}ms F8M tMjjjU PP847S u78M 41e[^_ÉU,WVSEU z}M@EEEURU"%U9~fUDG)fESMQEEPC)]]7FEfwFf7uM)fLWUfTGfwM QEPBE [7}uzf|wtkTwE9~fEDGf+EfEfw]SUREEPDC])]fDwMf)LGUfTG vfDwM y}IDGf}ȋU9~fU%;EuUE;PufMDGf+EfE]SMQEEPB)]]7FEfwFf7uM)fLWUfTG}t5fwM QEPE u 3U z}fwM IDGf}1e[^_ÍvUWVS}] ]1KEJDAfEKjSEPW6Ãt VWޅtjK}tfyt'AffwEfyuf|AtELAfMUJ~!EfAfACBviUBEEfUUUW +UfTAW JfTAEHt SW9t VWO81e[^_UWVSE PUMM]]ur}_ )É;Evf|runu}w4}uvE)EjE PUMDQP]S E tOPUEBu^ );Mfzt;Mu}]{4}t Ee[^_ÐUVS]u jQDPPS- t)Afxuۃtfuǃ $jU RDFPSS  @f8uL$ǃ :jE PDFPS ƒtUEPEEPRSǃ~:EU 9B u#EPFBPEP=<e[^_UVSu]uuju V"Ct1e[^UWVS}E pFW )‰UE @ fE]FffwTtSUREPjU RW t:sjE PDFPWtWURURSPWAà ~;EU 9B u$EPFBPEP:ge[^_UWVS]jEPEPuEP u`uuUR*;EЉUEPEPU fB ft,juB PEPU BuE @E }tEHXX|CLC3F֋EfSFfCf3f|CfLCEU E BEXHf;vGsLC|CffLCf|CuUR$u/}t } tFs$!jU RVjSe[^_U,WVS}UM9AvFEPQR4UUMAEE]CBEMEU E;w tu vPM Q]Su .ptItEU E;s7PSMQǃujS]39FExCS)ЍW9s2PWURMQjS]SvCf9s)RDCPP5fC΍SC)fCfJC؋MQU@q1P4M jS181e[^_ÉUS=tvЃ;u[ÐUWfixit_crunch%s: %s not compiled in usage: %s ..., where is one of: %sgrepexviewvitelnetftpmount_cd9660mount_msdosumountswaponrrestorerestorerebootmountmknodfdiskdmesgdisklabelclrichgrpchownsyncsleeprmdirrmmvmkdirlslnkillexprechodfddcpchrootchmodcat@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/cat/cat.c,v 1.14.2.8 2002/06/29 05:09:26 tjr Exp $benstuvusage: cat [-benstuv] [-] [file ...] stdout,8D\t-stdin%sr%6d buffercat@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/chmod/chmod.c,v 1.16.2.7 2003/11/14 15:27:08 tobez Exp $HLPRXfghorstuvwxthe -R and -h options may not be specified together.invalid file mode: %s%s: %s%s%s fts_readЌЌČЌЌЌЌЌЌЌbbbb,bb,bXXusage: chmod [-fhv] [-R [-H | -L | -P]] mode file ... G:g:u:no such group `%s',too many supplementary groups providedno such user `%s'.%ssetgroupssetgidsetuidSHELL/bin/sh-iusage: chroot [-g group] [-G group,group,...] [-u user] newroot [command] @(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/cp/cp.c,v 1.24.2.7 2002/09/24 12:41:04 mckay Exp $HLPRfinprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%st```````̓```````````````````ܓ```````<`H```T%s: %s%s: directory causes a cycle..%s%s: name too long (not copied)chmod: %s%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).%s -> %s fts_read$FreeBSD: src/bin/cp/utils.c,v 1.27.2.7 2004/01/22 06:23:38 kris Exp $%s%s not overwritten (y/n [n]) overwrite %s? %snot overwritten readlink: %sunlink: %ssymlink: %smkfifo: %smknod: %sutimes: %schown: %schmod: %schflags: %s cp [-R [-H | -L | -P]] [-f | -i | -n] [-pv] src1 ... srcN directoryusage: cp [-R [-H | -L | -P]] [-f | -i | -n] [-pv] src target%s %s $FreeBSD: src/bin/dd/args.c,v 1.25.2.2 2001/01/23 14:20:03 asmodai Exp $5p1ħ,̩& l@@$ | @@@@skipseekoseekofobsiseekifibsfilescountconvcbsbsunable to allocate space for the argument "%s"unknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsseek offsets cannot be larger than %qdbs must be between 1 and %dcbs must be between 1 and %dcount cannot be negativefiles must be between 1 and %qdibs must be between 1 and %dobs must be between 1 and %d g g g g g g| wrldunblockucasesyncswabsparseosyncoldibmoldebcdicoldasciinotruncnoerrorlcaseibmebcdicblockascii,unknown conversion %s%s: illegal conversion combination%s%s: illegal numeric value%s: %szzzz4zzzz$zzzzzzzzzD%s: illegal offset$FreeBSD: src/bin/dd/conv.c,v 1.15 1999/09/13 21:47:10 green Exp $%s: short input record$FreeBSD: src/bin/dd/conv_tab.c,v 1.10 1999/09/12 16:51:53 green Exp $    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/dd/dd.c,v 1.27.2.3 2001/08/01 01:37:35 obrien Exp $stdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffertruncating %sư>%s: seek error creating sparse file%s: end of device%s: short write on tape device%s: short write on character device$FreeBSD: src/bin/dd/misc.c,v 1.18.2.1 2001/08/01 01:40:03 obrien Exp $%qu+%qu records in %qu+%qu records out blockblocks%qu odd length swab %s %qu truncated %s %qu bytes transferred in %.6f secs (%.0f bytes/sec) ư>?@$FreeBSD: src/bin/dd/position.c,v 1.17.2.2 2001/01/23 14:23:55 asmodai Exp $%siseek/skip%s: illegal offsetskip reached end of inputoseek/seek%s: write failure@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/df/df.c,v 1.23.2.9 2002/07/01 00:14:24 iedowse Exp $ufsabgHhiklmnPt:BLOCKSIZE=512BLOCKSIZE=1gBLOCKSIZE=1k-l and -t are mutually exclusive.BLOCKSIZE=1monly one -t option may be specified%s/tmp/df.XXXXXXstrdup failedmkdtemp("%s") failed ,Plx?@ 0BBKMGTPE %5.0f%c %5.1f%c$@ SizeAvailUsedFilesystem%-*s %-*s %*s %*s Capacityifreeiused %*s %*s %%iused Mounted on %-*s %*ld %*ld %*ld %5.0f%% %*ld %*ld %4.0f%% %s Y@ df: %lld: %s usage: df [-b | -H | -h | -k | -m | -P] [-ailn] [-t type] [file | filesystem ...] sysctl failedmalloc failed$FreeBSD: src/sbin/mount/vfslist.c,v 1.4 1999/08/28 00:13:27 peter Exp $malloc failed@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/echo/echo.c,v 1.8.2.1 2001/08/01 02:33:32 obrien Exp $-n%s$FreeBSD: src/usr.bin/yacc/skeleton.c,v 1.28.2.1 2001/07/19 05:46:39 peter Exp $B[aim3O (                      !"   (:%&)*+%-/*+-/:<=>:%&)*+-)/%&)*+-/<=>%&*)<=>/%&)*+-:/&|)+-<=>&)<=>&)+-|<=>&|)&|)<=>&)&)<=>|<=>|<=><=>|&)%&|*+-/|<=>:<=>||%&|*+|-/:<=>%*+-/||:<=> malloc() failedoverflow%lld|&=<>+-*/%:()%lld %s syntax errornon-numeric argumentdivision by zero%syacc stack overflow4Ld|@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. -lillegal signal number: %s%s -soption requires an argument -- s0--illegal process id: %s%ssigunknown signal %s; valid signals: kill -signal_number pid ... kill -signal_name pid ... kill -l [exit_status]usage: kill [-s signal_name] pid ...%s %s %s %s @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. linkfhinsv.%s8P\Pt%s/%sreplace %s? not replaced %s %c> %s link file1 file2 ln [-fhinsv] file ... directoryusage: ln [-fhinsv] file1 file2%s %s %s @(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. COLUMNS1ABCFGHLPRTWabcdfghiklmnopqrstuwxCLICOLORCLICOLOR_FORCEColor support not compiled in. LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL TL$Q4DLT dpL,0%s: directory causes a cycle%s: %s:fts_readLS_COLWIDTHS0:0 %lu : %lu : %lu : %i : %i : %i : %llu : %lu %u-%lu%qu4>HRY`gu%stotal %lu %*lu %*lld %s %*u %-*s %-*s %-*s %3d, 0x%08x %3d, %3d %*s%*lld , %e %b %T %Y %b %e %T %Y %e %b %R %b %e %R %e %b %Y %b %e %Y %s/%s ls: %s: %s -> 0B%*s BKMGTPE%*lld%c ?@l0P@usage: ls [-ABCFHLPRTWabcdfghiklmnoqrstuwx1] [file ...] @(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/mkdir/mkdir.c,v 1.19.2.2 2001/08/01 04:42:37 obrien Exp $m:pvinvalid file mode: %s%s%s usage: mkdir [-pv] [-m mode] directory ... @(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/mv/mv.c,v 1.24.2.6 2004/03/24 08:34:36 pjd Exp $finv%s: destination pathname too long%s%s not overwritten (y/n [n]) overwrite %s? %s override %s%s%s/%s for %s? %snot overwritten %s -> %s cannot resolve %s: %scannot rename a mount pointrename %s to %smalloc failed%s: remove%s: set owner/group (was: %lu/%lu)%s: owner/group changed; clearing suid/sgid (mode was 0%03o)%s: set mode (was: 0%03o)%s: set flags (was: 0%07o)%s: set times---PRpv-PRpmv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rm mv [-f | -i | -n] [-v] source ... directoryusage: mv [-f | -i | -n] [-v] source target%s %s @(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. unlinkdfiPRrvW\&&h&&&&&|&&&&&&&&&&&&& &&,&&&D&&&&&&&&&h&&&&p&%s: %s%s %sfts_read$((('(('(('%s: is a directorymallocremove %s? override %s%s%s/%s %s%sfor %s? "." and ".." may not be removed unlink fileusage: rm [-f | -i] [-dPRrvW] file ...%s %s @(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/rmdir/rmdir.c,v 1.9.2.2 2001/08/01 05:16:47 obrien Exp $p%susage: rmdir [-p] directory ... @(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/sleep/sleep.c,v 1.9.2.1 2001/08/01 05:23:25 obrien Exp $usage: sleep seconds @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/sync/sync.c,v 1.9.2.2 2001/08/01 05:43:30 obrien Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/usr.sbin/chown/chown.c,v 1.15.2.3 2002/08/07 21:24:33 schweikh Exp $HLPRfhvthe -R and -h options may not be specified togetherseparation of user and group with a period is deprecated%s: %s%s fts_read666666666X6666h6666t6666666666666666666666666666666666666668~8~8 8~8~8H8~8~8H8~8t8t8groupuser%s%s: illegal %s nameyou are not a member of group %s chgrp [-R [-H | -L | -P]] [-f] [-h] [-v] group file ... chown [-R [-H | -L | -P]] [-f] [-h] [-v] :group file ...usage: chown [-R [-H | -L | -P]] [-f] [-h] [-v] owner[:group] file ...%s %s %s @(#) Copyright (c) 1990, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/clri/clri.c,v 1.4 1999/08/28 00:12:32 peter Exp $usage: clri filesystem inode ... %s%s: can't read superblock%s: superblock magic number 0x%x, not 0x%x%s is not a valid inode numberclearing %d @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/disklabel/disklabel.c,v 1.28.2.16 2004/03/24 08:34:22 luigi Exp $DOC2KVinumCCDfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownvinumbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunusedBNRWb:enrs:wf-f requires an absolute pathname/dev/%s%s%c%s%s%sioctl DIOCWLABELr???????????????D????p????????????????$????????????d???? ?4?????DAA MAXPARTITIONS (%d)Too many '*' partitions (%c and %c)unknown size specifier '%c' (K/M/G are valid)partition %c not an integer number of sectorstotal percentage %lu is greater than 100 %ld sectors available to give to '*' and '%%' partitions Offset %ld for partition %c overlaps previous partition which ends at %lu Labels with any *'s for offset must be in ascending order by sector Offset %ld for partition %c doesn't match expected value %ldpartition %c: size 0, but offset %lupartition %c: offset past end of unit partition %c: partition extends past end of unit partition %c is not marked as unused!partition %c doesn't start at 0!partition %c doesn't cover the whole unit!An incorrect partition %c may cause problems for standard system utilitiespartitions %c and %c overlap! unused partition %c: size %d offset %luY@cannot open %s"auto" requires the usage of a canonical disk nameboot overlaps used partition %c marked as FS_BOOTboot overlaps partition %c, %scannot install boot programWarning, (to write disable/enable label) disklabel [-NW] disk (to restore label and boot program) disklabel -R -B [-n] [ -b boot1 [ -s boot2 ] ] disk protofile [ type ] (to write label and boot program) disklabel -w -B [-n] [ -b boot1 [ -s boot2 ] ] disk type [ packid ] (to install boot program with existing label) disklabel -B [-n] [ -b boot1 [ -s boot2 ] ] disk [ type ] (to restore label with existing boot program) disklabel -R [-r] [-n] disk protofile (to edit label) disklabel -e [-r] [-n] disk (to write label with existing boot program) disklabel -w [-r] [-n] disk type [ packid ] (to read label)usage: disklabel [-r] disk%s %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s @(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/dmesg/dmesg.c,v 1.11.2.4 2004/02/29 20:39:40 iedowse Exp $_msgbufpaM:N:kern.msgbufsysctl kern.msgbufmalloc faileddmesgkvm_nlist: %snamelist%s: msgbufp not foundkvm_read: %skernel message buffer has different magic number%susage: dmesg [-a] [-M core] [-N system] $FreeBSD: src/sbin/i386/fdisk/fdisk.c,v 1.36.2.14 2004/01/30 14:40:47 harti Exp $/dev/da0/dev/ad0BBT (Bad Blocks Table)SpeedStor >1024 cyl. or LANstepDOS 3.3+ SecondaryEFI System PartitionEFI GPTBeOS file systemConcurrent CPM or C.DOS or CTOSSyrinxDRDOS/sec with 16-bit FAT (>= 32MB)DRDOS/sec with 16-bit FAT (< 32MB)DRDOS/sec with 12-bit FATSolaris x86 bootBSDI BSD/386 swapBSDI BSD/386 filesystemIBM JFSNetBSDNEXTSTEPOpenBSDFreeBSD/NetBSD/386BSDSuspend to DiskBSD/OSAmoeba bad block tableAmoeba filesystemNTFS volume set??Linux extendedOS/2 hidden C: driveLinux filesystemLinux swap or Solaris x86Minix 1.4b ... 1.5.10Minix 1.1 ... 1.4aQNX4.x 3rd partQNX4.x 2nd partQNX4.xPCIXDiskSecure Multi-BootNovell Netware 3.xxNovell Netware 2.xxISC UNIX, other System V/386, GNU HURD or MachSpeedPriam Edisk (disk manager)GBEZ-Drive (disk manager)DM6DM6 Aux3CP/M or Microport SysV/ATDMQNX 4.2 TertiaryQNX 4.2 SecondaryQNX 4.2 PrimaryLinux native (sharing disk with DRDOS)SFS or Linux swap (sharing disk with DRDOS)Linux/MINIX (sharing disk with DRDOS)VENIX 286PartitionMagic recoveryplan9NEC DOSAST Windows swapfileOS/2 BM: hidden IFS (e.g. HPFS)OS/2 BM: hidden DOS with 16-bit FAT (>= 32MB)OS/2 BM: hidden DOS with 16-bit FAT (< 32MB)Compaq diagnosticsOS/2 BM: hidden DOS with 12-bit FATOPUSExtended DOS, LBAPrimary 'big' DOS (> 32MB, LBA)DOS or Windows 95 with 32 bit FAT, LBADOS or Windows 95 with 32 bit FATOS/2 Boot Manager or OPUSAIX boot partition or CoherentAIX filesystemOS/2 HPFS, NTFS, QNX-2 (16 bit) or Advanced UNIXPrimary 'big' DOS (> 32MB)Extended DOSPrimary DOS with 16 bit FAT (<= 32MB)XENIX /usr filesystemXENIX / filesystemPrimary DOS with 12 bit FATunusedBIab:f:istuv1234/dev/dev/%scannot open disk %scannot open any diskcannot allocate buffer to determine disk sector sizeread_s0%s: %d cyl %d hd %d sec SizeStartPart %11s %11s Type Flags %4d: %11lu %11lu 0x%02x 0x%02x ******* Working on device %s ******* Media sector size is %d Warning: BIOS sector numbering starts with sector 1 Information from DOS bootblock is: We haven't changed the partition table yet. This is your last chance. Should we write new partition table? -t flag specified -- partition table not written. (q(q(q(q4q4q4q4q4q4q4q4q4q4q4q4q4qp4q4q4q4q4q4qp4q4q4q4q4q4q4q4q4q4q4q4q4q4q4q4q4q4q4q4q4q4q4qpp4q4q4qp4q4qp4q4q4q4q4q4q4q4q4qpqqq fdisk -f configfile [-itv] [disk] usage: fdisk [-BIaistu] [-b bootcode] [-1234] [disk] %s%s%d: sysid %d,(%s) (active) start %lu, size %lu (%qd Meg), flag %x%s beg: cyl %d/ head %d/ sector %d; end: cyl %d/ head %d/ sector %d /boot/mbr%s%s: length must be a multiple of sector size%s: unable to allocate read buffer%s: short readThe data for partition %d is: Do you want to change it? The static data for the DOS partition 4 has been reinitialized to: sysid (165=FreeBSD)startsizeERROR: failed to adjust; setting sysid to 0Explicitly specify beg/end address ?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorAre we happy with this entry?parameters extracted from in-core disklabel are: cylinders=%d heads=%d sectors/track=%d (%d blks/cyl) Figures below won't work with BIOS for partitions not in cyl 1 parameters to be used for BIOS calculations are: Partition %d is marked active Do you want to change the active partition?active partitionActive partition number must be in range 1-4. Try again. Are you happy with this choiceDo you want to change the boot code?Do you want to change our idea of what BIOS thinks ?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorscan't get file status of %sdevice %s is not character specialcan't open device %scan't get disk parameters on %scan't get disk parameters on %s; supplying dummy onesunable to allocate buffer to read fdisk partition tablecan't read fdisk partition tableinvalid fdisk partition table foundcan't write fdisk partition table%s [n] yesYESyYSupply a decimal value for "%s" [%d] %s is an invalid decimal number. Try again. unknownERROR line %d: the geometry specification line must occur before all partition specificationsERROR line %d: incorrect number of geometry argsERROR line %d: unknown geometry arg type: '%c' (0x%02x)ERROR line %d: number of cylinders not specifiedWARNING line %d: number of cylinders (%d) may be out-of-range (must be within 1-1024 for normal BIOS operation, unless the entire disk is dedicated to FreeBSD)ERROR line %d: number of heads not specifiedERROR line %d: number of heads must be within (1-256)ERROR line %d: number of sectors not specifiedERROR line %d: number of sectors must be within (1-63)ERROR line %d: incorrect number of partition argsERROR line %d: invalid partition number %dERROR line %d: unable to adjust start of partition %d to fall on a head boundaryWARNING: adjusting start offset of partition %d from %u to %u, to fall on a head boundaryERROR: could not adjust partition to start on a head boundary and end on a cylinder boundary.WARNING: adjusting size of partition %d from %u to %u to end on a cylinder boundaryERROR line %d: size of partition %d is zeroERROR line %d: incorrect number of active args-rERROR: size of partition is zeroWARNING: partition overlaps with partition tableCorrect this automatically?WARNING: partition does not start on a head boundaryWARNING: partition does not end on a cylinder boundaryWARNING: this may confuse the BIOS or some operating systemsERROR: unable to adjust start of partition to fall on a head boundaryWARNING: adjusting start offset of partition to %uWARNING: adjusting size of partition to %u@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/mknod/mknod.c,v 1.13 2000/01/06 17:51:46 obrien Exp $usage: mknod name [b | c] major minor [owner:group] %s%s: illegal %s namegroup must be specified when the owner isgroupowner must be specified when the group isusernode must be type 'b' or 'c'%s: non-numeric major number%s: non-numeric minor numbermajor or minor number too largesetting ownership on %s@(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/mount/mount.c,v 1.39.2.4 2004/04/05 07:23:20 guido Exp $soft-updatessuiddirnoclusterwnoclusterrunionsynchronousread-onlywith quotasnosymfollownosuidnoexecnodevnoatimelocalNFS exportedasynchronousext2fsffsufsadfo:prwt:uvroonly one -t option may be specifiednorogetmntinforwrqnoautonot currently mounted %s/%s: unknown special file or file system%s has unknown file system type:@nfsr/var/run/mountd.pid%dsignal mountd$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$h$$t$$$$$$$$$$$̑,/usr/sbin/sbinforceupdateexec: mount_%s %s fork%s/mount_%smalloc failed, exec mount_%s not found in %swaitpid%s: %sstatfs %s%s on %s (%s, %s, mounted by %s, writes: sync %ld async %ld, reads: sync %ld async %ld) %s,%s-ofstabcurrentno mount [-dfpruvw] special | node mount [-adfpruvw] [-o options] [-t ufs | external_type]usage: mount [-dfpruvw] [-o options] [-t ufs | external_type] special node%s %s %s %s %s %s %s %u %u 1 1 2 2 0 0 syncasync@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/mount/mount_ufs.c,v 1.16.2.3 2001/08/01 08:27:29 obrien Exp $updatesyncforceasyncclusterwclusterrunionrdonlysymfollowsuidsuiddirexecdevatimeautorwrogroupquotauserquotao:ufsvfsload(ufs)ufs filesystem is not available%s on %s: mount table full%s on %s: specified device does not match mounted device%s on %s: incorrect super block%susage: mount_ufs [-o options] special node $FreeBSD: src/sbin/mount/getmntopts.c,v 1.9 1999/10/09 11:54:06 phk Exp $,-o %s: option not supported%s: not a directory%s: %s$FreeBSD: src/sbin/mount/vfslist.c,v 1.4 1999/08/28 00:13:27 peter Exp $malloc failed@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/reboot/reboot.c,v 1.9.2.4 2002/04/28 22:50:00 wes Exp $haltdk:lnpqcannot dump (-d) when halting; must reboot instead/boot/nextboot.confkernel="" ???halted by %srebootrebooted by %sshutdown~SIGTSTP initSIGTERM processesWARNING: some process(es) wouldn't die (can't restart init): %s%s                                             usage: %s [-dnpq] [-k kernel] vm.stats.vm.v_swappgsinv_swappgsin@(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/restore/main.c,v 1.10.2.3 2001/10/02 08:30:17 cjc Exp $./restoresymtableTAPE/dev/sa0b:cdf:himNRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0%c and %c options are mutually exclusiveillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specified.Begin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure ̮XXXXXXXXXXXXXXXXXXTdXtXXXXXXXXܮ4@XLб>>>>>>>>>>>>>>>>>>>>>>@>>>>>>>>h>>>>restore -t [-cdhkNuvy] [-b blocksize] [-f file] [-s fileno] [file ...]restore -x [-cdhkmNuvy] [-b blocksize] [-f file] [-s fileno] [file ...]restore -R [-cdkNuvy] [-b blocksize] [-f file] [-s fileno]restore -r [-cdkNuvy] [-b blocksize] [-f file] [-s fileno]restore -i [-cdhkmNuvy] [-b blocksize] [-f file] [-s fileno]usage: %s %s %s %s %s option requires an argument -- %c$FreeBSD: src/sbin/restore/interactive.c,v 1.8.2.1 2001/01/03 14:36:08 iedowse Exp $/addcd%s: not a directory delete%s: not on extraction list extracthelp directory is used If no `arg' is supplied, the current help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%slspwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help ]\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\,\<ķ\\,\\\и\\\\h\\restore > %s/%s%s: out of memory command lines cannot be continued missing %c ../canonname: not enough buffer space ..ls: out of memory directory reopen failed %s: %s%s: name exceeds %d char Warning: undefined file type %d tttttt%*d %srestore interrupted, continue$FreeBSD: src/sbin/restore/restore.c,v 1.7.2.1 2002/03/01 21:32:28 iedowse Exp $leafdir %s%10d %s %s: not on the tape ./%uMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %d) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state (t,,|NIL|ONTAPE|INOFND|NAMEFND|MODECHGFind unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %d: bad first %s: not found on tape expected next file %d, got %d unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %d type should be LEAF$FreeBSD: src/sbin/restore/dirs.c,v 1.14.2.5 2001/10/15 13:44:45 dd Exp $Extract directories from tape TMPDIR/tmp/%s/rstdir%d-XXXXXXw%s - cannot create directory temporary fopen%s/rstmode%d%s - cannot create modefile fopen/opendirfile: %s Root directory is not on tape .Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %d char lsMangled directory: reclen not multiple of 4 reclen less than DIRSIZ (%d < %d) reclen name too big (%d > %d) bad seek pointer to rst_seekdir %ld error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopen: %s cannot open mode file %s set owner/mode for '.'cannot find directory inode %d error setting directory modes Cannot find directory inode %d named %s %s: cannot create file: %s write error extracting inode %d, name %s read: %s write: %s no memory directory table $FreeBSD: src/sbin/restore/symtab.c,v 1.7.2.1 2001/12/19 14:54:14 tobez Exp $addino: out of range %d duplicate inumdeleteino: out of range %d deleteino: %d not found %s is not a directory %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTcannot find entry in parent listbad name no space for string table Check pointing the restore wfopen: %s cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table .open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table read: %s cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c $FreeBSD: src/sbin/restore/tape.c,v 1.16.2.8 2002/06/30 22:57:52 iedowse Exp $-r/dev/ttycannot open %s: %s /dev/nullCannot allocate space for magtape buffer Cannot allocate space for tape buffer Verify tape and initialize maps %s: %s Tape is not a dump tape Converting to new file system format. .cannot stat .: %s bad block size %ld Tape is not volume 1 of the dump header read failed at %ld blocks no header after volume mark! Cannot find file removal list maxino = %d no memory for active inode map Cannot find file dump list no memory for file dump list Changing volumes on pipe input? Otherwise, begin with volume 1. have no further files to extract. can quickly skip tapes that and work towards the first; restore start with the last volume If you are extracting just a few files,You have not read any tapes yet. %s%s%s%s%s%s%sYou have read volumes: %s%ld, Specify next volume #: Volume numbers are positive numerics Mount tape volume %ld Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) none Cannot open %s tape is not dump tape Wrong volume (%ld) Wrong dump date got: %s wanted: %slast rec %ld, tape starts with %ld sSkipping %ld duplicate record%s. active file into volume 1 End-of-input encountered while extractingWarning: %s %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Dump date: %sthe epoch Dumped from: %sLevel %ld dump of %s on %s:%s Label: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract fifo %s %s: cannot create fifo: %s extract special file %s %s: cannot create special file: %s %s: cannot create file: %s ran off end of tape not at beginning of a file Missing address (header) block for %s at %ld blocks write error extracting inode %d, name %s write: %s seek error extracting inode %d, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s hole in map mid-media short read error. partial block read: %ld should be %ld Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %d continuecontinuation failed: %s End-of-tape encountered partial block read: %d should be %d tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%d) Tape block size is %ld Note: Doing Byte swapping 8l4s31ll2lNote: Doing Quad swapping gethead: unknown inode type %d TToldnewVolume header (%s inode format) begins with record %ldDumped inodes map headerUsed inodes map headerFile header, ino %dFile continuation header, ino %dEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d resync restore, skipped %ld blocks 0Checksum error %o, inode %d file %s $FreeBSD: src/sbin/restore/utilities.c,v 1.8.2.2 2001/07/30 10:30:08 dd Exp $mktempname: called with TMPNAMEnot on ino listRSTTMP%s%ld%luwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d symbolichardCreate %s link %s->%s warning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s NODELEAFentry type: %s inode number: %lu flags: %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump core$FreeBSD: src/sbin/dump/dumprmt.c,v 1.14.2.1 2000/07/01 06:31:52 ps Exp $Lost connection to remote host. on %s: %s%stcpkshellshell%s/tcp: unknown service who are you? RMT/etc/rmtlogin to %s as %s failed. Connection to %s established. IP_TOS:IPTOS_THROUGHPUT setsockoptTCP_NODELAY setsockoptinvalid user name %s O%.226s %d C closeR%d readW%d writeL%d %d seekS statusI%d %d ioctl%s: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). @(#) Copyright (c) 1980, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/swapon/swapon.c,v 1.8.2.2 2001/07/30 10:30:11 dd Exp $aswnoautoswapon: adding %s as swap device %s: device already in use%susage: swapon [-a] [special_file ...] @(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/umount/umount.c,v 1.22.2.1 2001/12/13 01:27:15 iedowse Exp $Aafh:t:vonly one -t option may be specifiednfscannot umount %s, %s is mounted there, umount it first/etc/fstab%sP22222222222222222222222222222222X22222`22l222222222222222fstab reading failure/rwrorq%s: unknown mount typemalloc failedstrdup%s: not currently mountedcan't get net id for hostunmount of %s failed%s: unmount from %s Cannot MNT PRCBad MNT RPCcannot remove mounttab entry %s:%scalloc>h? >?\@malloc umount -a | -A [-fv] [-h host] [-t type]usage: umount [-fv] special | node%s %s $FreeBSD: src/sbin/mount/vfslist.c,v 1.4 1999/08/28 00:13:27 peter Exp $malloc failed$FreeBSD: src/usr.sbin/rpc.umntall/mounttab.c,v 1.2.2.1 2001/12/13 01:27:20 iedowse Exp $a/var/db/mounttab%ld %s %s rcan't open %s timehostdirmallocwcan't write to %swrite mounttab entry %s:%scan't remove %s by hostdelete mounttab entry%s %s:%sbad mounttab %s field '%s'$FreeBSD: src/sbin/mount_msdos/mount_msdos.c,v 1.19.2.3 2003/12/03 01:51:23 fjoe Exp $nowin95longnamesshortnamesupdatesyncforceclusterwclusterrunionrdonlysymfollowsuidsuiddirexecdevatimeautorwrogroupquotauserquotasl9u:g:m:M:o:L:W:stat %smsdosvfsload(msdos)msdos filesystem is not available%sJKKKKKKKKKKKKKKKKKKKhKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKJDKKKKKKJKJunknown group id: %sunknown user id: %sinvalid file mode: %s [-s] [-l] [-9] [-L locale] [-W table] bdev dirusage: mount_msdos [-o options] [-u user] [-g group] [-m mask] [-M mask]%s %s /usr/libdata/msdosfs/%srcan't read u2w table row %d near line %d%i%i%i%i%i%i%i%iu2w table: missing item(s) in row %d, line %dcan't read d2u table row %d near line %dd2u table: missing item(s) in row %d, line %dcan't read u2d table row %d near line %du2d table: missing item(s) in row %d, line %d$FreeBSD: src/sbin/mount/getmntopts.c,v 1.9 1999/10/09 11:54:06 phk Exp $,-o %s: option not supported%s: not a directory%s: %s$FreeBSD: src/sbin/mount_cd9660/mount_cd9660.c,v 1.15.2.3 2001/03/14 12:05:01 bp Exp $strictjolietjolietrripgensextattupdateclusterwclusterrunionrdonlysymfollowsuidsuiddirexecdevatimeautorwrogroupquotauserquotabegjo:rs:vcould not determine starting sector, using very first session using starting sector %d cd9660vfsload(cd9660)cd9660 filesystem is not available%sxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWxWVxWxWWxWWxWxWWxWxWxWxW(WxWxWLWXWxWxWpWusage: mount_cd9660 [-egrv] [-o options] [-s startsector] special node $FreeBSD: src/sbin/mount/getmntopts.c,v 1.9 1999/10/09 11:54:06 phk Exp $,-o %s: option not supported%s: not a directory%s: %s/LtenexEebcdicimageIbinaryAasciiusage: %s [ %s%s | ]Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.typeWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] STOUSTORAPPElocal-filesusage: %s local-files mputContinue with%s: not foundr+wwusage: %s remote-file [ local-file ] local: %sRETRremote-filesusage: %s remote-files mgetonoffand logged inConnected %sto %s. Not connected.Connected for proxy commands to %s. No proxy connection.(none)Gate ftp: %s, server %s, port %s. Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off.Nmap: (in) %s (out) %s Nmap: off.Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT cmds: %s. (but disabled for this connection)Use of EPSV/EPRT cmds for IPv4: %s%s. Command line editing: %s. Macros: %s usage: %s [ on | off ] %s %s. Bell modeEditing modePacket tracingusage: %s [ on | off | bytecount ] mark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark).Verbose modeUse of PORT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] %s: bad gateport value. %ldDisabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD.XCWD %susage: %s local-directory Local directory now %s getcwd: %susage: %s remote-file DELE %smdeletefrom-nameto-nameusage: %s from-name to-name RNFR %sRNTO %s-usage: %s remote-directory local-file nlistNLSTLISToutput to local-file:usage: %s remote-files local-file mlsSHELL/bin/shsh-c%sTry again laterusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed.PWDPWD command not recognized, trying XPWD.XPWDLocal directory %s getcwddirectory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD.XMKD %sRMD %sRMD command not recognized, trying XRMD.XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITE %smodefile-nameusage: %s mode file-name SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:commandusage: %s command ?Ambiguous command.?Invalid command.?Invalid proxy command. Case mappingCarriage Return strippingNtrans off.Nmap off.mapoutusage: %s [mapin mapout] nmap: unbalanced brackets.Passive modeUse of EPSV/EPRT on IPv4 ftpStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP.XCUPusage: %s [restart_point] restart: Invalid offset `%s' No restart point definedRestarting at %qd for next get, put or append SYSTLimit of 16 macros have already been defined.macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line.macdef: end of file encountered.Macro not defined - 4K buffer exceeded.Restricted data portsfilenameusage: %s filename %s %qd %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". PAGERmoreCan't allocate memory for $PAGER|%s?verboseuserumasktypetracetenexsystemsuniquestructstatussizesitesendportsendruniquerstatusrmdirrhelprestrictrestartresetrrrenameregetrecvquotequitpwdputcproxypromptprogresspreservepassivepageopenntransnmapnlistnewermsendLmputmoremodtimemodemlsmkdirmgetmdirRmdeletemacdeflslpwdlessllcdimageidleChelphashglobgategetftpformexitepsv4editdisconnectrldirdeletedebugcrclosenrchmodcduprcdcasebyebinarybellasciilrappendaccount$!...Can't allocate memory for local dircompleteCan't allocate memory for remote dir %s Must be logged in to complete.@X@Xmacro nameusage: %s macro_name '%s' macro not found. ?Ambiguous command.?Invalid command.Not connected.Can't allocate memory to parse URLhttp://ftp://url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %shost %s, port %s, path %s, save as %s. %s: %sCan't create socketCan't bind to %sCan't connect to %sRequesting %s GET /%s HTTP/1.1 Host: %s Connection: close Requesting %s (via %s) GET %s HTTP/1.0 Failed to format HTTP requestWriting HTTP request200Error retrieving file: %sContent-Length: Can't open %sWriting %sReading from socketSuccessfully retrieved file.Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %s http fetch aborted.ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.:@/Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'cd/*?[]{}Retrieving %s/%s %s/%sgetmget%s: %ssocketbindconnect to address %sTrying %s... connectgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockopt---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUIT%c%c%c421 Service not available, remote server has closed connection.%s: send aborted waiting for remote to finish abort.sentlocal: %s remote: %s -%slocal: %s%s: not a plain file. STORAPPEREST %qdr+w%s %snetout receive aborted waiting for remote to finish abort.receivedRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly.Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: EPSV return code must be 229PASVLPSVPassive mode refused.wrong server: return code must be 227%d,%d,%d,%d,%d,%dwrong server: return code must be 228%d,%d,%d,%d,%d,%d,%d,%d,%d%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dwrong server: return code must be 229%c%c%c%d%cPassive mode address scan failure. Shouldn't happen!setsockopt (reuse address)setsockopt PORTRANGE (ignored)listenEPRT |%d|%s|%d|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dacceptSTOUproxy server does not support third party transfers.No primary connection.PORT %slocal: %s remote: %s abortresetrunique: can't find unique file name.Lost control connection for abort.%cABOR ftphttpFTPSERVERPORT%sftpgateTMPDIR/tmp/FTP_PASSIVE_MODEnopftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumb46adeginpP:s:tUvV%s: %sx$8HT`lftp> sorry, input line too long.?Ambiguous command.?Invalid command.Not connected.!$Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46adeginptUvV] [-P port] [-s src_addr] [host [port]] %s host:path[/] %s ftp://host[:port]/path[/] %s http://host[:port]/file macdefmachineaccountpasswdpasswordlogindefaultHOME.%s/.netrc%s/.netrc: %sr%scan't strdup *anameanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.can't strdup *apassRemove account or make file unreadable by others.can't strdup *aacctMissing macdef name argument.Limit of 16 macros have already been defined.Macro definition missing null line terminator.4K macro buffer exceeded.Unknown .netrc keyword %sAlready connected to %s, use close first. tousage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s asciinon-printstreamfile8SYSTRemote system type is %s. 215 UNIX Type: L8binaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$initsorry, arguments too long.(%s) ftpXXXXXX%s/%sunable to create temporary file %swNLSTarcan't find list of remote files, oops.%s %s? Interactive mode: off.Prompting off for duration of %s. %s: not foundSIZE %sMDTM %s%*s %16s1919%03d%02d%02d%02d%02d%02d%04d%02d%02d%02d%02d%02dCan't convert %s to a time. KMGTP %3d%% **********************************************************************************************************************************************************|%.*s%*s| %5qd %c%c --:-- ETA - stalled -%2d: %02d:%02d ETA.AMKs%qd byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d .A>P?emacsContext sensitive argument completionftp-complete^I0isipv6addr: got %d for %s @(#)commands.c 8.4 (Berkeley) 5/30/95%s sequence challenge /usr/bin/opiekeyfork!^?offwontwilldontdohelpDisplay send options?Send request for STATUSgetstatusPerform Telnet 'Synch operation'synchSend Telnet End of File CharactereofSend Telnet 'Suspend Process'suspSend Telnet 'Abort Process'abortSend Telnet 'End of Record'eorSend Telnet 'No operation'nopintrinterruptintpSend Telnet Interrupt ProcessipSend Telnet 'Go Ahead' sequencegaSend current escape characterescapeSend Telnet Erase LineelSend Telnet Erase CharacterecbreakSend Telnet BreakbrkSend Telnet 'Are You There'aytSend Telnet Abort outputaoneed at least one argument for 'send' command 'send ?' for help Unknown send argument '%s' 'send ?' for help. Ambiguous send argument '%s' 'send ?' for help. sNeed %d argument%s to 'send %s' command. 'send %s ?' for help. ?Need to be connected first. There is not enough room in the buffer TO the network to process your request. Nothing will be done. ('send synch' will throw away most data in the network buffer, if this might help.) Telnet 'send' error - argument disappeared! SENTUsage: send %s "value" must be from 0 to 255 Valid options are: "%s" '%s': ambiguous argument ('send %s ?' for help). '%s': unknown argument ('send %s ?' for help). '%s': bad value ('send %s ?' for help). %-15s %s setsockopt (SO_DEBUG)Will send carriage returns as telnet . Will send carriage returns as telnet . Already operating in binary mode with remote host. Negotiating binary mode with remote host. Already in network ascii mode with remote host. Negotiating network ascii mode with remote host. Already receiving in binary mode. Negotiating binary mode on input. Already receiving in network ascii mode. Negotiating network ascii mode on input. Already transmitting in binary mode. Negotiating binary mode on output. Already transmitting in network ascii mode. Negotiating network ascii mode on output. print hexadecimal representation of terminal traffic(debugging) toggle printing of hexadecimal terminal datatermdatashow option processingviewing of options processing (debugging)optionsprint user readable output for "netdata"output of "netdata" to user readable format (debugging)prettydumpprint hexadecimal representation of network trafficprinting of hexadecimal network data (debugging)netdataturn on socket level debuggingdebuggingdebug recognize certain control characterslocal recognition of certain control characterslocalcharsmap carriage return on outputmapping of received carriage returnscrmodsending carriage returns as telnet crlfsending of binary dataoutbinaryreceiving of binary datainbinarysending and receiving of binary databinaryskip reading of ~/.telnetrc filedon't read ~/.telnetrc fileskiprcsend interrupt characters in urgent modeautomatic sending of interrupt characters in urgent modeautosynchflush output when sending interrupt charactersflushing of output when sending interrupt charactersautoflush%-15s toggle %s display help informationenabledisable%-15s %s %s Need an argument to 'toggle' command. 'toggle ?' for help. '%s': ambiguous argument ('toggle ?' for help). '%s': unknown argument ('toggle ?' for help). WillWon't%s %s. alternate AYT characterforw2alternate end of line characterforw1character to use for XOFFstopcharacter to use for XONstartcharacter to use to erase a wordworderasecharacter to use for line reprintreprintcharacter to cause a Suspend Processcharacter to use for literal nextlnextcharacter to use to erase a linekillcharacter to use to erase a charactereraseThe following are for local editing in linemodecharacter to cause an EOF character to cause an Abort processquitcharacter to cause an Interrupt Processcharacter to cause an Abort OutputflushoutputThe following need 'localchars' to be toggled truefile to write trace information totracefilerlogin escape characterrlogincharacter to escape back to telnet command modecharacter to toggle local echoing on/offechoTelnet rlogin escape character is '%s'. Telnet escape character is '%s'. Format is 'set Name Value' 'set ?' for help. '%s': unknown argument ('set ?' for help). '%s': ambiguous argument ('set ?' for help). onFormat is 'set togglename [on|off]' 'set ?' for help. %s set to "%s". %s character is '%s'. Need an argument to 'unset' command. 'unset ?' for help. '%s': unknown argument ('unset ?' for help). '%s': ambiguous argument ('unset ?' for help). %s reset to "%s". ?Need to have LINEMODE option enabled first. 'mode ?' for help. Print help informationkludgelineDisable literal character echo-litecho+litechoEnable literal character echolitecho-softtabs+softtabsEnable tab expansionsofttabsDisable character editing-edit+editEnable character editingeditDisable signal trapping-isig+isigEnable signal trappingisigThese require the LINEMODE option to be enabled(or enable obsolete line-by-line mode)Enable LINEMODE optionline(or disable obsolete line-by-line mode)Disable LINEMODE optioncharacterformat is: 'mode Mode', where 'Mode' is one of: 'mode' command requires an argument Unknown mode '%s' ('mode ?' for help). Ambiguous mode '%s' ('mode ?' for help). won't %s. %-15s [%s] %-15s "%s" ?Ambiguous argument '%s'. ?Unknown argument '%s'. Deprecated usage - please use 'set escape%s%s' in the future. new escape character: Deprecated usage - please use 'toggle crmod' in the future. %s map carriage return on output. Fork failed SHELL/bin/sh-cExeclConnection closed. fromquitbyeVerify remote special character definitionscheckUse remote special character definitionsimportUse local special character definitionsexportNeed an argument to 'slc' command. 'slc ?' for help. '%s': unknown argument ('slc ?' for help). '%s': ambiguous argument ('slc ?' for help). List the current environment variableslistSend an environment variablesendDon't mark an environment variable for automatic exportunexportMark an environment variable for automatic exportUndefine an environment variableundefineDefine an environment variabledefineNeed an argument to 'environ' command. 'environ ?' for help. '%s': unknown argument ('environ ?' for help). '%s': ambiguous argument ('environ ?' for help). only Need %s%d argument%s to 'environ %s' command. 'environ ?' for help. DISPLAYunix:%s%sUSERLOGNAMEPRINTERCannot send '%s': Telnet ENVIRON option not enabled Cannot send '%s': variable not defined %c %-20s %s Connected to %s. notmuchOperating with LINEMODE option LocalNo%s line editing %s catching of signals Operating in obsolete linemode Operating in single character mode Catching signals locally Remote%s character echo %s flow control No connection. Escape character is '%s'. status?Already connected to %s open (to) -l-a-susage: %s [-l user] [-a] [-s src_addr] host-name [port] %s: %s hostname too long for unix domain socket: %sTrying %s... sockettelnetBad source route option: %s telnet: socketsetsockopt (source route)telnet: setsockopt (IP_TOS) (ignored)bindconnect to address %sUnable to connect to remote hostConnection closed by foreign host. opieenvironzslctoggleunsetsetopenmodedisplaylogoutclose%s> %s ?Ambiguous command ?Invalid command Commands may be abbreviated. Commands are: %-*s %s ?Ambiguous help command %s ?Invalid help command %s HOME/.telnetrcrDEFAULT?Ambiguous command: %s ?Invalid command: %s ?Need to be connected first for %s. @(#)main.c 8.3 (Berkeley) 5/30/95[host-name [port]][-r] [-s src_addr] [-u] [-e char] [-l user] [-n tracefile] [-4] [-6] [-8] [-E] [-L] [-N] [-S tos] [-c] [-d]Usage: %s %s%s%s%s rlog468EKLNS:X:acde:fFk:l:n:rs:t:uxy%s: Warning: -S ignored, no parsetos() support. %s: Warning: -f ignored, no Kerberos V5 support. %s: Warning: -F ignored, no Kerberos V5 support. %s: Warning: -k ignored, no Kerberos V4 support. %s: Warning: -x ignored, no ENCRYPT support. %s: Warning: -y ignored, no ENCRYPT support. -l-sfgggfggggggggggggf`ggggghfgfggggfgggghggggggggggg$g4gLgggggpggggggggggggggg@(#)network.c 8.2 (Berkeley) 12/15/93select@(#)ring.c 8.2 (Berkeley) 5/30/95@(#)sys_bsd.c 8.4 (Berkeley) 5/30/958p8pop0p8poopoop p(pooppSetSockOptmallocsleep(5) from telnet, after select: %s @(#)telnet.c 8.4 (Berkeley) 5/30/95SENT ~ ~D~ ~D~J~ ~D~D~D~D~D~D~D~D~D~D~D~D~D~D~D~D~D~D~D~D~D~D~D~D~D~D~D~D~DISPLAY>88>8888888888888888888>888888>>>888>UNKNOWNTERM%c%c%c%c%s%c%cNo room in buffer for terminal type. %c%c%c%c%ld,%ld%c%clm_will: not enough room in buffer $8Dlm_will: no command!!! lm_wont: no command!!! lm_do: no command!!! lm_do: not enough room in buffer lm_dont: no command!!! lm_mode: not enough room in buffer localremoteremote defaultSpecial characters are %s values slc_import: not enough room slc_end_reply: not enough room env_opt_start: malloc()/realloc() failed!!! env_opt_add: realloc() failed!!! USERPRINTERSYSTEMTYPEJOBACCTRCVDIn SUBOPTION processing, RCVDl(HxԜX l       ,<L\؛z close Remote side does not support STATUS option @(#)terminal.c 8.2 (Berkeley) 2/16/95@(#)utilities.c 8.3 (Berkeley) 5/30/95IACDONTDOWONTWILLSBGAELECAYTAOIPBRKDMARKNOPSEEORABORTSUSPEOFNEW-ENVIRONENCRYPTAUTHENTICATIONOLD-ENVIRONXDISPLOCLINEMODELFLOWTSPEEDNAWSX.3 PAD3270 REGIMETTYLOCOUTPUT MARKINGTACACS UIDEND OF RECORDTERMINAL TYPESEND LOCATIONSUPDUP OUTPUTSUPDUPDATA ENTRY TERMINALBYTE MACROLOGOUTEXTEND ASCIINAOLFDNAOVTDNAOVTSNAOFFDNAOHTDNAOHTSNAOCRDNAOPNAOLRCTETIMING MARKSTATUSNAMESUPPRESS GO AHEADRCPECHOBINARYEEOLEBOLEWRECROVERINSRTMCEOLMCBOLMCWRMCWLMCRMCLFORW2FORW1XOFFXONLNEXTRPEWSYNCH0-wCannot open %s. (standard output)%c 0x%x %c%.2x%.2x %s IAC %s%s IAC %d%s %s %sEXOPL%d%s %d %dresp DO_DONT %s: %d resp DO_DONT %d: %d want DO %s want DO %d want DONT %s want DONT %d DO %s DO %d resp WILL_WONT %s: %d resp WILL_WONT %d: %d want WILL %s want WILL %d want WONT %s want WONT %d WILL %s WILL %d RCVDSENT%s IAC SB (terminated by %s %d , not IAC SE!) (Empty suboption???)TERMINAL-TYPE IS "%.*s"SEND- unknown qualifier %d (0x%x).TERMINAL-SPEED (empty suboption???) IS %.*s SEND %d (unknown) ?%d?TOGGLE-FLOW-CONTROL OFF ON RESTART-ANY RESTART-XON %d %d (%d)LINEMODE WILL WONT DO DONT (no option???)Forward Mask %x%d (unknown) %dSLC %s NOSUPPORT CANTCHANGE VARIABLE DEFAULT|FLUSHOUT|FLUSHIN|ACK%s%s%s(0x%x) %d;MODE (no mode???)|LIT_ECHO|SOFT_TAB|TRAPSIG|EDIT%s%s%s%s%s (0x%x) ?0x%x? IS IS %s %s %s %d SB SEX-DISPLAY-LOCATION NEW-ENVIRON IS SEND INFO " VALUE " VAR " ESC " USERVAR " %03o %s (unknown)x000000000000000000000000d4ؿ000Hxhp %02x@(#)cl_bsd.c 8.29 (Berkeley) 7/1/96@(#)cl_funcs.c 10.50 (Berkeley) 9/24/96smcuprmcupError: move: l(%u) c(%u) o(%u)xterm]0;%susage: ex [-eFRrSsv] [-c command] [-t tag] [-w size] [file ...] usage: vi [-eFlRrSv] [-c command] [-t tag] [-w size] [file ...] %s@(#)cl_main.c 10.36 (Berkeley) 10/14/96TERMunknown]0;%s/dev/ttytcgetattr%s: No terminal database found %s: %s: unknown terminal type signal-reset%s:%s @(#)cl_read.c 10.15 (Berkeley) 9/24/96hinputlines=%lucolumns=%lu@(#)cl_screen.c 10.49 (Berkeley) 9/24/96016|Vi's standard input and output must be a terminalTERMLINESCOLUMNS%s%s: unknown terminal typetcgetattrtcsetattrcupsmsormsoelcuu1%lu@(#)cl_term.c 10.22 (Berkeley) 9/15/96fdXRP?97+'%~zxnjgOIG:42(cursor upkkcuu1cursor rightlkcuf1delete to end of screendGkedscroll upkripage upkpppage downknpcursor lefthkcub1delete lineddkdl1insert at cursorikich1go to sol^khomekendgo to eol$kllscroll downkinddelete to eolDkelcursor downjkcud1delete characterxkdch1insert lineOkil19+4(I:lakahajakf%d233|This terminal has no %s keyfunction key %dstderr%s046|messages not turned on: %s045|messages not turned off: %sTERMlinestigetnum: linescolstigetnum: colsLINESCOLUMNS@(#)cut.c 10.10 (Berkeley) 9/15/96 (08@HP@(#)delete.c 10.12 (Berkeley) 10/23/96002|Line length overflow$FreeBSD: src/contrib/nvi/common/exf.c,v 1.3.2.2 2002/10/16 17:01:04 ru Exp $/tmp%s/vi.XXXXXXXXXX237|Unable to create temporary file238|Warning: %s is not a regular file%s239|%s already locked, session is read-only%s/%s-c option240|%s: remove241|%s: close242|%s: remove243|%s: remove244|Read-only file, not written; use ! to override245|Read-only file, not written246|%s exists, not written; use ! to override247|%s exists, not written248|Partial file, not written; use ! to override249|Partial file, not written250|%s: file modified more recently than this copy; use ! to override251|%s: file modified more recently than this copy252|%s: write lock was unavailableaw254|%s: WARNING: FILE TRUNCATED256|%s: new file: %lu lines, %lu characters315|%s: appended: %lu lines, %lu characters257|%s: %lu lines, %lu characters258|%s expanded into too many file names.%d259|%s: not a regular file260|%s: not owned by you261|%s: accessible by a user other than the owner262|File modified since last complete write; write or use ! to override263|File modified since last complete write; write or use :edit! to override264|File modified since last complete write; write or use ! to override265|File is a temporary; exit will discard modifications266|File readonly, modifications not auto-written@(#)key.c 10.33 (Berkeley) 9/24/96079|No non-printable character found0123456789abcdef01234567d    d d   276|Unexpected character event277|Unexpected end-of-file event279|Unexpected interrupt event280|Unexpected quit event281|Unexpected repaint event285|Unexpected string event286|Unexpected timeout event316|Unexpected resize event287|Unexpected write event8%D%%P%\%h%%%t%%%%@(#)line.c 10.21 (Berkeley) 9/15/96003|unable to delete line %lu004|unable to append to line %lu005|unable to insert at line %lu006|unable to store line %lu007|unable to get last line008|Error: unable to retrieve line %lu@(#)log.c 10.8 (Berkeley) 3/6/96009|Log file/usr/src/usr.bin/vi/../../contrib/nvi/common/log.c010|Logging not being performed, undo not possible011|No changes to undo3H3333H34l4012|Logging not being performed, undo not possibleh550505050556013|Logging not being performed, roll-forward not possible014|No changes to re-do6787x787768015|%s/%d: log put error267|Log restarted@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1992, 1993, 1994, 1995, 1996 Keith Bostic. All rights reserved. @(#)main.c 10.48 (Berkeley) 10/11/96exnexnviewviewc:eFGlRrSst:vw:only one -c command may be specified.only one of -r and -t may be specified.only one tag file may be specified.-s option is only applicable to ex.window=%s<;<;<;<;<;<;<;::<;<;<;<;<;<;<;<;<;<;::<;<;<;<;<;<;<;<;<;<;<;<;<;<;<;X:<;|:<;<;<;<;<;<;:<;<;<;<;<;:::<;,;4;ex/vi: %s%.*s---c$-s%s: %s @(#)mark.c 10.13 (Berkeley) 7/19/96017|Mark %s: not set018|Mark %s: the line was deleted019|Mark %s: cursor position no longer exists@(#)msg.c 10.48 (Berkeley) 9/15/96020|Error: %s, %d: : %s%.*sHXI;IXIH299|yanked298|shifted297|moved296|joined295|deleted294|changed293|added 301|lines300|line%lu 317|%d files to edit021|new file022|name changed023|modified024|unmodified025|UNLOCKED026|readonly028|empty file027|line %lu of %lu [%lu%%]029|line %luLC_MESSAGESLANG%s%sVI_MESSAGE_CATALOG030|The file %s is not a message catalog268|confirm? [ynq]269|Press any key to continue: 270|Press any key to continue [: to enter more ex commands]: 161|Press Enter to continue: 275| cont?271|Press any key to continue [q to quit]: VVVVV W@(#)options.c 10.51 (Berkeley) 10/14/96~~sh]XOtIC90(tt ȁ~ȁ؀,ȁ,,Pztmg`UL܁E ?5*@  @ȁ@  @  4zqhwriteanywrapscanwrapmarginwraplenwindownamewindowwarnw9600w300w1200verbosettywerasetimeouttildeoptersetermtagstaglengthtabstopsourceanyslowopensidescrollshowmodeshowmatchshiftwidthshellmetashellsecuresectionssearchincrscrollrulerreportremapredrawrecdirreadonlypromptprintpathparagraphsoptimizeopenoctalnumbernoprintmsgcatmodelinemesgmatchtimemagiclocklistlisplinesleftrightkeytimeignorecaseiclowerhardtabsgtagsmodeflashfilecextendedexrcerrorbellsescapetimeedcompatibledirectorycommentcolumnsceditcdpathbeautifybackupautowriteautoprintautoindentaltwerase   |yol"h%c&`,]*Y0T2Q4L:I7E8B6>>;=8B5<1?)?'I$N!IKLMwswmwlwiwawttytypettytstotltagswsmdsmslowshsectscrroreparaoptnumodelinesliichtgtexedebdircobfawapaiCDPATH:cdpath=%sTMPDIR/tmpdirectory=%sescapetime=6keytime=6matchtime=7/usr/share/vi/catalog/msgcat=%sreport=5paragraphs=IPLPPPQPP LIpplpipbppath=%s/var/tmp/vi.recoverrecdir=%ssections=NHSHH HUnhshSHELL/bin/shshell=%sshellmeta=~{[*?$`'"\shiftwidth=8sidescroll=16tabstop=8tags=%sscroll=%ldwindow=%lu031|Unable to set default %s optionall032|Usage: %s291|set: the %s option may not be turned off313|set: the %s option may never be turned on034|set: [no]%s option doesn't take a value035|set: %s option isn't a boolean036|set: %s option: %s037|set: %s option: %s: value overflow038|set: %s option: %s is an illegal number314|set: the %s option may never be set to 0039|set: %s option isn't a boolean305|No %s edit option specified%ld%*s no%s%s%s=%ld%s="%s"set %s set no%s set %s=%-3ld set 033|set: no %s option: 'set all' gives all option values@(#)options_f.c 10.25 (Berkeley) 7/12/96040|Screen columns too small, less than %d041|Screen columns too large, greater than %d042|Screen lines too small, less than %d043|Screen lines too large, greater than %d044|The lisp option is not implemented048|The paragraph option must be in two character groups049|The section option must be in two character groups@(#)put.c 10.11 (Berkeley) 9/23/96053|The default buffer is empty054|Buffer %s is empty@(#)screen.c 10.15 (Berkeley) 9/15/96@(#)search.c 10.25 (Berkeley) 6/30/96072|File empty; nothing to search073|Reached end-of-file without finding the pattern074|No previous search pattern075|Pattern not found076|Reached top-of-file without finding the pattern077|Search wrappedĖЖ078|Searching...@(#)seq.c 10.10 (Berkeley) 3/30/96 %s@(#)recover.c 10.21 (Berkeley) 9/15/96%s055|Files with newlines in the name are unrecoverable%s/vi.XXXXXX056|Modifications not recoverable if the session fails057|Copying file for recovery...058|Preservation failed: %s059|Modifications not recoverable if the session fails060|File backup failed: %s061|Copying file for recovery...062|Information on user id %u not found%s/recover.XXXXXX063|Unable to lock recovery filePrecedence: bulkSubject: Nvi saved the file To: From: root (Nvi recovery program)Reply-To: rootX-vi-recover-path: X-vi-recover-file: %s%s %s%s %s %s %s%s %s%s %s -r : to this file using the -r option to You can recover most, if not all, of the changes , when it was saved for recovery. on the machine was editing a file named , the user On %s%.24s%s%s%s%s%s%s%s%s%s%s%s%s%s%s 064|Recovery file buffer overrun065|Recovery file.recdir: %srecover.r+066|%s: malformed recovery file%.24s: %s vi: no files to recover. %s/%s067|%s: malformed recovery file068|No files named %s, readable by you, to recover069|There are older versions of this file for you to recover070|There are other files for you to recover/usr/sbin/sendmail071|not sending email: %s%s -t < %s@(#)util.c 10.11 (Berkeley) 9/15/96@(#)ex.c 10.57 (Berkeley) 10/10/96script 170|Interrupted!#&*<=>@~080|Unknown command name1bca1082|%s: command not available in ex mode083|Count may not be zero084|%s: bad line specification085|Internal syntax table error (%s: %s)lr086|Usage: %s088|Flag offset to before line 1089|Flag offset past end-of-file090|@ with range running when the file/screen changed091|Global/v command running when the file/screen changed092|Ex command failed: pending commands discarded093|Ex command failed: mapped keys discardedl,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,P,,,,,,,,,,,,,\,,,,,,,,,,,,,,,,094|The second address is smaller than the first                                d              q$0123456789'\/?.+-^095|No mark name supplied096|\ not followed by / or ?097|Reference to a line number less than 04sllllllllll|(098|The %s command is unknown099|Address value overflow100|Address value underflow101|Illegal address combination102|Illegal address: only %lu lines in the file103|Illegal address: the file is empty104|The %s command doesn't permit an address of 0@(#)ex_abbrev.c 10.7 (Berkeley) 3/6/96105|No abbreviations to display106|Abbreviations must end with a "word" character107|Abbreviations may not contain tabs or spaces108|Abbreviations may not mix word/non-word characters, except at the end109|"%s" is not an abbreviation@(#)ex_append.c 10.30 (Berkeley) 10/23/96 273|Entering ex input mode.@(#)ex_args.c 10.16 (Berkeley) 7/13/96111|No more files to edit112|No previous files to edit113|No previous files to rewind114|No file list to display ][%s%s%s@(#)ex_argv.c 10.26 (Berkeley) 9/20/96echo 115|No previous command to replace "!"116|No filename to substitute for %%117|No filename to substitute for #./%s304|Shell expansion failed289|Shell expansions not supported when the secure edit option is setpiperfdopenvfork-c118|Error: execl: %s119|I/O error: %s@(#)ex_at.c 10.12 (Berkeley) 9/15/96@(#)ex_bang.c 10.33 (Berkeley) 9/23/96!!%s 303|File modified since last write.! @(#)ex_cd.c 10.10 (Berkeley) 8/12/96120|File modified since last complete write; write or use ! to overrideHOME121|Unable to find home directory location%s/%s122|New current directory: %s%s@(#)ex_cmd.c 10.20 (Berkeley) 10/10/96\CO [CXCKCIC GC.CCBxO BBBBԂ BBIBGBl EB:B)B'Bw BBBAA* 1AAAA w BBAWAUAl EBJA)BCAT1IC0AAA A@@@\[C@@@(^ [C@@g@l"c@@@@@l @@??l @???H B??`?G? D?,??># B>>>{>L$ w>@>>=' ====' ==== ==`=U=t* =G= ==<^ ==<<x1 D?<`<F< [C?<(<!<1IC<;;? B;;;;F w>|;g;b;(O B@;;:I B::::F w>:g;:D :j:@:/: G *::::9999xO B`9@9!9M B988O B8z8u8 4Bj8@8%8 4B877M [C777ICq7@767W qEB 776|W IC666W 1B66a6N *:Q6<656^ 26"665IC55|5p w5a5@5B} B544H` @444pq 4@443q [C333| 3333D} ICy3`3X3D} ICK3`3I3H B?+3`?'3 w53@5 3 IC222 w5222 ICt2[2T2x ICH27232 4B)221 @[C111w>111HF 11`1G11 B 100 [C000 !0`0 00' =///| =//p/ $D?@/$/!/ $D?/.. $D?.c._. $@@.0.+. '..--@ --`-E-l B -,replace previous RE with previous replacement string,[line [,line]] ~ [cgr] [count] [#lp]~display different screens of the file[line] z [-|.|+|^|=] [count] [flags]3c01zcopy lines to a cut buffer[line [,line]] ya[nk] [buffer] [count]bcayankexit[line [,line]] x[it][!] [file]xitwrite the file and exit[line [,line]] wq[!] [>>] [file]wqwrite the file and switch to the next file[line [,line]] wn[!] [>>] [file]wnwrite the file[line [,line]] w[rite][!] [ !cmd | [>>] [file]]writedisplay vi key usage statement[viu]sage [key]viusageedit another file (from vi mode only)[Vv]i[sual][!] [+cmd] [file]enter visual (vi) mode from ex mode[line] vi[sual] [-|.|+|^] [window_size] [flags]2c11visualdisplay the program version informationversionexecute a global command on lines NOT matching an RE[line [,line]] v [;/]RE[;/] [commands]vdelete an input or command mapunm[ap][!] word!w1runmapdelete an abbreviationuna[bbrev] wordunabbreviateundo the most recent changeu[ndo]undorun the tcl interpreter with the commandtc[l] cmdtcldiscard all tagstagt[op][!]tagtopmove to the previous tagtagpr[ev][!]tagprevreturn to the previous group of tagstagp[op][!] [number | file]tagpopmove to the next tagtagn[ext][!]tagnext[Tt]a[g][!] [string]tag[line [,line]] t line [flags]tsu[spend][!]suspendsuspend the edit sessionst[op][!]stopread a file of ex commandsso[urce] filef1rsourcesuspend editing and run a shellsh[ell]shellset options (use ":set all" to see all options)se[t] [option[=[value]]...] [nooption ...] [option? ...] [all]wNsetrun a shell in a screensc[ript][!] [file]scriptsubstitute on lines matching an RE[line [,line]] s [[/;]RE[/;]repl[/;] [cgr] [count] [#lp]]edit the file containing the tag[Rr]ta[g][!] [string]!w1ortagre-edit all the files in the file argument listrew[ind][!]rewindgrow or shrink the current screenresize [+-]rowsc+resizerecover a saved filerecover[!] filerecoverappend input from a command or file to the line[line] r[ead] [!cmd | [file]]readexit ex/viq[uit][!]quitappend a cut buffer to the line[line] pu[t] [buffer]putedit the previous file in the file argument list[Pp]rev[ious][!]previouspreserve an edit session for recoverypre[serve]preserverun the perl interpreter with the command, on each lineperld[o] cmdperldorun the perl interpreter with the commandpe[rl] cmdperldisplay lines[line [,line]] p[rint] [count] [#l]printenter "open" mode (not implemented)[line] o[pen] [/RE/] [flags]openchange display to number lines[line [,line]] nu[mber] [count] [l]numberedit (and optionally specify) the next file[Nn][ext][!] [+cmd] [file ...]!fNnextwrite a .exrc filemkexrc[!] file!f1rmkexrcmap input or commands to one or more keysmap[!] [keys replace]!Wmap[line] ma[rk] keymarkmove lines elsewhere in the file[line [,line]] m[ove] linelmovedisplay lines in an unambiguous form[line [,line]] l[ist] [count] [#]listmark a line position[line] k keykjoin lines into a single line[line [,line]] j[oin][!] [count] [flags]!ca1joininsert input before a line[line] i[nsert][!]insertdisplay help statementhe[lp]helpexecute a global command on lines matching an RE[line [,line]] g[lobal][!] [;/]RE[;/] [commands]globalbring a backgrounded screen into the foreground[Ff]g [file]fgdisplay (and optionally set) file namef[ile] [name]filedisplay ex command usage statement[exu]sage [command]w1oexusage[Ee]x[!] [+cmd] [file]exbegin editing another file[Ee][dit][!] [+cmd] [file]f1oeditdisplay buffers, connections, screens or tagsdisplay b[uffers] | c[onnections] | s[creens] | t[ags]w1rdisplaydelete lines from the file[line [,line]] d[elete][flags] [buffer] [count] [flags]bca1deletecreate a set of tags using a cscope commandcs[cope] command [args]!scscopecopy lines elsewhere in the file[line [,line]] co[py] line [flags]l1copychd[ir][!] [directory]chdirchange the current directorycd[!] [directory]!f1ocdchange lines to input[line [,line]] c[hange][!] [count]!cachangeput a foreground screen into the backgroundbgdisplay file argument listar[gs]argsspecify an input abbreviationab[brev] [word replace]Wabbreviateappend input to a line[line] a[ppend][!]append@ [buffer]@shift lines right[line [,line]] >[>...] [count] [flags]>display line number[line] = [flags]1=shift lines left[line [,line]] <[<...] [count] [flags]<execute a buffer* [buffer]b*repeat the last subsitution[line [,line]] & [cgr] [count] [#lp]s&display numbered lines[line [,line]] # [count] [l]ca1#filter lines through commands or run commands[line [,line]] ! commandS!scroll lines^D@(#)ex_cscope.c 10.13 (Berkeley) 9/15/966F FFF8 EDD\ fDWDRD$ 9D-D'D,! D'DDiscard all current cscope connectionsresetkill numberKill a cscope connectionkillhelp [command]Show help for cscope commandshelpfind c|d|e|f|g|i|s|t buffer|pattern c: find callers of name d: find all function calls made from name e: find pattern f: find files with name as substring g: find definition of name i: find files #including name s: find all uses of name t: find assignments to nameQuery the databases for a patternfindadd file | directoryAdd a new cscope databaseadd309|Use "cscope help" for helpCSCOPE_DIRS :cscope.out%s/%scscope.tpath%s:pipevforkcd '%s' && exec cscope -dl -f %s-csh/bin/shexecl: %swr310|No cscope connections running%d%s 278|No matches for querysgdct efi311|%s: unknown search type: use one of %scscope: %d lines%1[ ]%s: "%s" %s doesn't match any cscope command Command: %s (%s) Usage: %s cscope commands: %*s: %s 312|%d: no such cscope session1No cscope connections. %2d %s (process %lu) @(#)ex_delete.c 10.9 (Berkeley) 10/23/96@(#)ex_display.c 10.12 (Berkeley) 4/10/96buffersconnectionsscreenstags123|No cut buffers to displaydefault buffer (line mode) (character mode)********** %s%s @(#)ex_edit.c 10.10 (Berkeley) 4/27/96@(#)ex_equal.c 10.10 (Berkeley) 3/6/96%ld @(#)ex_file.c 10.12 (Berkeley) 7/12/96@(#)ex_filter.c 10.34 (Berkeley) 10/23/96piperfdopenvfork-cexecl: %sfilterforkwparent-writerfilter read@(#)ex_global.c 10.22 (Berkeley) 10/10/96124|The %s command can't be used as part of a global or v commandpp@(#)ex_init.c 10.26 (Berkeley) 8/12/96/etc/vi.exrcNEXINITEXINITHOME.nexrc%s/%s.exrc125|%s/%s: not sourced: not owned by you or root126|%s/%s: not sourced: not owned by you127|%s/%s: not sourced: writeable by a user other than the owner128|%s: not sourced: not owned by you or root129|%s: not sourced: not owned by you130|%s: not sourced: writeable by a user other than the owner@(#)ex_join.c 10.10 (Berkeley) 9/15/96131|No following lines to join.?!@(#)ex_map.c 10.9 (Berkeley) 3/6/96132|No input map entries133|No command map entries134|The %s character may not be remapped135|"%s" isn't currently mapped@(#)ex_mark.c 10.8 (Berkeley) 3/6/96136|Mark names must be a single character@(#)ex_mkexrc.c 10.11 (Berkeley) 3/6/96.exrc137|%s exists, not written; use ! to override%swabbreviate map map! 138|New exrc file: %s@(#)ex_move.c 10.10 (Berkeley) 9/15/96139|Destination line is inside move range@(#)ex_open.c 10.7 (Berkeley) 3/6/96140|The open command requires that the open option be set141|The open command is not yet implemented@(#)ex_preserve.c 10.12 (Berkeley) 4/27/96142|Preservation of this file not possible143|File preserved@(#)ex_print.c 10.18 (Berkeley) 5/12/96%6lu TOOBIG $ [ynq]%c@(#)ex_put.c 10.7 (Berkeley) 3/6/96@(#)ex_quit.c 10.7 (Berkeley) 4/27/96@(#)ex_read.c 10.38 (Berkeley) 8/12/96!!%s ! r%s145|Only regular files and named pipes may be read146|%s: read lock was unavailable147|Reading...148|%s: %lu lines, %lu characters@(#)ex_screen.c 10.11 (Berkeley) 6/29/96149|No background screens to display @(#)ex_script.c 10.30 (Berkeley) 9/24/96150|The script command is only available in vi modetcgetattrptyforkemacsTERMemacs:TERMCAPtEMACS-iexecl: %sselectError: timed outError: shell: EOFshell151|No command to execute script-shellttypqrs0123456789abcdef@(#)ex_set.c 10.7 (Berkeley) 3/6/96@(#)ex_shell.c 10.38 (Berkeley) 8/19/96%s -i vfork-cexecl: %swaitpid; core dumped ...%.*s%s: received signal: %s%s%.*s%s: exited with status %dXX XXXXXX}XiX_XRXIX BX 6XXX XW WWWWWWWkWUW?W+WWVFilesize limit exceededCputime limit exceededWindow size changesVirtual timer expiredUser defined signal 2User defined signal 1Urgent I/O conditionStopped (tty output)Stopped (tty input)SuspendedTrace/BPT trapTerminatedBad system callSuspended (signal)Segmentation faultQuitProfiling timer expiredBroken pipeKilledIOT trapI/O possibleInterruptInformation requestIllegal instructionHangupFloating point exceptionEMT trapContinuedChild exitedBus errorAlarm clockAbort trapUnknown signal: %d@(#)ex_shift.c 10.11 (Berkeley) 9/15/96152|shiftwidth option set to 0@(#)ex_source.c 10.12 (Berkeley) 8/10/96%s@(#)ex_stop.c 10.10 (Berkeley) 3/6/96@(#)ex_subst.c 10.37 (Berkeley) 9/15/96153|Count overflow154|Count underflow155|Regular expression specified; r flag meaningless156|The #, l and p flags may not be combined with the c flag in vi mode169|Confirm change? [n]157|No match foundk                       k   ̅        ؄                                                        ܅         ,    8  D [[:<:]][[:>:]]^.[]$*([ ]|/\*([^*]|\*/)*\*/)*\^.[]$*+?()|{}RE error: %sĠ X X X X X X X X X           X X X X X X X X X X X  X X X X X X ( X X X X X X X X H X X X X X X X X X X X X X X X  X X X X X X  X X X X X X X X 8 @(#)ex_tag.c 10.36 (Berkeley) 9/15/96158|No previous tag entered282|Already at the last tag of this group255|Already at the first tag of this group159|Less than %s entries on the tags stack; use :display t[ags]160|No file %s on the tags stack to return to; use :display t[ags]292|Display too small.%2d ... %*.*s %*.*s* %s%.*s 164|%s: the tag's line number is past the end of the file165|The tags stack is empty166|%s: search pattern not foundrxxglobal -%s '%s'r162|%s: tag not found%s 163|%s: corrupted tag in %smunmapclose%s/%s@(#)ex_txt.c 10.17 (Berkeley) 10/10/96   d        l  p p p p  p p p  p p p p p p p  %c%6lu %.*s@(#)ex_undo.c 10.6 (Berkeley) 3/6/96@(#)ex_usage.c 10.13 (Berkeley) 5/3/96To see the list of vi commands, enter ":viusage" To see the list of ex commands, enter ":exusage" For an ex command usage statement enter ":exusage [cmd]" For a vi key usage statement enter ":viusage [key]" To exit, enter ":q!" The %.*s command is unknown Command: %s Usage: %s ^D%*s: %s The %s key has no current meaning Key:%s%s Usage: %s %s @(#)ex_util.c 10.23 (Berkeley) 6/19/96167|%d more files to edit168|Buffer %s is empty144|%s: expanded into too many file names283|The %s command requires the ex terminal interface272|That form of %s requires the ex terminal interface274|Command failed, no file read in yet.173|The %s command requires that a file have already been read in171|No previous buffer to execute172|No previous regular expression230|This screen may not be suspended290|The %s command is not supported when the secure edit option is set284|That form of %s is not supported when the secure edit option is set174|Usage: %s $ 4 < D \ h t    @(#)ex_version.c 10.31 (Berkeley) 8/22/96Version 1.79 (10/23/96) The CSRG, University of California, Berkeley.@(#)ex_visual.c 10.13 (Berkeley) 6/28/96175|The visual command requires that the open option be set%luz%c%lu%luz%c @(#)ex_write.c 10.30 (Berkeley) 7/12/96! 253|Writing...%s@(#)ex_yank.c 10.7 (Berkeley) 3/6/96@(#)ex_z.c 10.10 (Berkeley) 3/6/96---------------------------------------- @(#)ex_tcl.c 8.10 (Berkeley) 9/15/96302|Vi was not loaded with a Tcl interpreter@(#)ex_perl.c 8.10 (Berkeley) 9/15/96306|Vi was not loaded with a Perl interpreter@(#)getc.c 10.10 (Berkeley) 3/6/96177|Empty file h  h  @(#)v_at.c 10.8 (Berkeley) 4/27/96 %lu@(#)v_ch.c 10.8 (Berkeley) 3/6/96      $ 4 D T 178|No previous F, f, T or t search179|%s not found@(#)v_cmd.c 10.9 (Berkeley) 3/28/96) "@Tl$  `H#  O % #  ڂ06   D|" Di fU4" HDK |" D ! Dց Ӂx  @"  n kT@% J6 3! ۀŀ  @€   D`  , X   Dy, "@Dwf dM\ (CE 2 "@D ~0 "@D~~|" HD~~  D~`~! HDI~ ~ ~}% "@}}  @}} }}X  D}`}  ,3}}P  ,||% "@||  ||\  ||l  D}|h|W|>|4|||  D|{4  F{{ HE{{ E{`{  @{ {  {{@! Ezz! EzzX) "@zz  zz  z`z Bz-z  $zzyy  Fyyu  ytyx  DkySy  By yyx xx.  @Dxx,  @DxxL  Dxxl @DxnxD "BfxVx  Mx6x  D-xx0  ww  ww|  Dww  Fw`w  DKw3w  *ww|" D wv! Dvv  Dvv$ vv) "@zv  vmv  cv@v  vvp  uu  Fuuu  uux  Dulu  [uGut  )uu @tt "@Dtt  D~tlt  "@DctItdr  @t0t ~ reverse case[count]~ } move forward paragraph[count]} | move to column[count]| { move back paragraph[count]{ z reposition the screen[line]z[window_size][-|.|+|^|] y copy text to motion into a cut buffer[buffer][count]y[count]motion x delete character[buffer][count]x w move to next word[count]w u undo last changeu t before character in line forward search[count]t character s substitute character[buffer][count]s r replace character[count]r character p insert after cursor from buffer[buffer]p o append after line[count]o n repeat last search m set markm[a-z] l move right by columns[count]l k move up by lines[count]k j move down by lines[count]j i insert before cursor[count]i h move left by columns[count]h f character in line forward search[count]f character e move to end of word[count]e d delete to motion[buffer][count]d[count]motion c change to motion[buffer][count]c[count]motion b move back word[count]b a append after cursor[count]a ` move to mark`[`a-z] _ move to first non-blank_ ^ move to first non-blank^]] move forward section]][[ move back section[[ZZ save file and exitZZ Y copy line[buffer][count]Y X delete character before cursor[buffer][count]X W move to next bigword[count]W U Restore the current lineU T before character in line backward search[count]T character S substitute for the line(s)[buffer][count]S R replace characters[count]R Q switch to ex modeQ P insert before cursor from buffer[buffer]P O insert above line[count]O N reverse last searchn M move to screen middleM L move to screen bottom[count]L J join lines[count]J I insert before first nonblank[count]I H move to count lines from screen top[count]H G move to line[count]G F character in line backward search[count]F character E move to end of bigword[count]E D delete to end-of-line[buffer]D C change to end-of-line[buffer][count]C B move back bigword[count]B A append to the line[count]A @ execute buffer@buffer ? search backward?RE[? offset] > shift lines right to motion[count]>[count]motion < shift lines left to motion[count]<[count]motion ; repeat last F, f, T or t search[count]; : ex command:command [| command] ... 0 move to first character0 / search forward/RE[/ offset] . repeat the last command. - move up by lines (to first non-blank)[count]- , reverse last F, f, T or t search[count], + move down by lines (to first non-blank)[count]+ ) move forward sentence[count]) ( move back sentence[count]( ' move to mark (to first non-blank)'['a-z] & repeat substitution& % move to match% $ move to last column [count]$ # number increment/decrement[count]# +|-|# ! filter through command(s) to motion[count]![count]motion command(s) move right by columns[count]' '^^ switch to previous file^^^] tag push cursor word^] ^\ switch to ex mode^\^[ exit input mode, cancel partial commands^[ ^Z suspend editor^Z^Y page up by lines[count]^Y^W move to next screen^W^V input a literal character^V^U half page up (set count)[count]^U^T tag pop^T^R redraw screen^R^P move up by lines[count]^P^N move down by lines[count]^N^M move down by lines (to first non-blank)[count]^M^L redraw screen^L^J move down by lines[count]^J^H move left by characters[count]^H^G file status^G^F scroll down by screens[count]^F^E scroll down by lines[count]^E^D scroll down by half screens (setting count)[count]^D^C interrupt an operation (e.g. read, write, search)^C^B scroll up by screens[count]^B^A search forward for cursor word[count]^A@(#)v_delete.c 10.9 (Berkeley) 10/23/96@(#)v_ex.c 10.42 (Berkeley) 6/28/96207|The Q command requires the ex terminal interface <>suspend180|No previous file to edit!307|No ex command to execute@(#)v_increment.c 10.12 (Berkeley) 3/19/96\WOG@%#0*lo0x%0*lx0X%0*lX%+ld%ldabcdefABCDEF181|Cursor not in a number182|Resulting number too large183|Resulting number too small@(#)v_init.c 10.8 (Berkeley) 3/30/96@(#)v_itxt.c 10.16 (Berkeley) 10/23/96@(#)v_left.c 10.7 (Berkeley) 3/6/96@(#)v_mark.c 10.8 (Berkeley) 9/20/96@(#)v_match.c 10.8 (Berkeley) 3/6/96184|No match character on this line185|Matching character not found@(#)v_paragraph.c 10.7 (Berkeley) 3/6/96@(#)v_put.c 10.5 (Berkeley) 3/6/96l p t x |    @(#)v_redraw.c 10.6 (Berkeley) 3/6/96@(#)v_replace.c 10.17 (Berkeley) 6/30/96186|No characters to replace    (  ( ( ( (  @(#)v_right.c 10.7 (Berkeley) 3/6/96@(#)v_screen.c 10.10 (Berkeley) 4/27/96308|Enter to execute a command, :q to exit187|No other screen to switch to@(#)v_scroll.c 10.9 (Berkeley) 4/27/96@(#)v_search.c 10.18 (Berkeley) 9/19/96search+%lu188|Characters after search string, line offset and/or z command[[:>:]][[:<:]]%s%s%s189|No previous search pattern190|Search wrapped to original position@(#)v_section.c 10.7 (Berkeley) 3/6/96@(#)v_sentence.c 10.7 (Berkeley) 3/6/961 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 @(#)v_status.c 10.9 (Berkeley) 5/15/96@(#)v_txt.c 10.87 (Berkeley) 10/13/96191|Abbreviation exceeded expansion limit: characters discarded 192|Illegal character; quote to enter> @> @> G > P> > > > > p> N \I I O N O O tB HG O  O tB N N O J M N hK I 193|Already at the beginning of the insert%s %s%*s Unmatched %s194|No more characters to erase@(#)v_ulcase.c 10.7 (Berkeley) 3/6/96@(#)v_undo.c 10.5 (Berkeley) 3/6/96@(#)v_util.c 10.11 (Berkeley) 6/30/96195|Movement past the end-of-file196|Movement past the end-of-line197|No cursor movement made198|Already at the beginning of the file199|Movement past the beginning of the file200|Already in the first column201|Buffers should be specified before the command209|The file is empty202|Already at end-of-file203|Already at end-of-line204|%s isn't a vi commandWindow resize interrupted text input mode205|Usage: %sx $x 0x . conflicting matchers specifiedGREP_OPTIONSinvalid context length argumentegrepfgrepgrepreadskiprecurseunknown directories method-without-matchunknown binary-files type2.4d%s (GNU grep) %s Copyright (C) 1988, 1992-1998, 1999 Free Software Foundation, Inc. This is free software; see the source for copying conditions. There is NO warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. defaultw |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w |w r r r r r r r r r r |w |w |w |w |w |w |w r 0s ls |w s s s s _w |w |w 0v |w |w |w |w |w t |w |w w s |w s |w v |w |w |w |w |w |w ;w t t 4t t u |w v  v |w |w Tv |w xv |w |w v t v |w w v v v  v v |w |w |w |w |w w memory exhaustedmemory exhaustedfgrepawkegrepgrepdefaultmemory exhausted^\(\(^\|[^[:alnum:]_]\)\(\)\([^[:alnum:]_]\|$\)\)$^((^|[^[:alnum:]_])()([^[:alnum:]_]|$))$\\#$FreeBSD: src/lib/libutil/logwtmp.c,v 1.14 2000/01/15 03:26:54 shin Exp $0123456789invalid hostname%d/var/log/wtmp%d%02d%03d С С С С С С С С С С С С С С С С С С С С С С С С С С С С С С С С С С С С H С С С С С  С С  С С С  ܠ С С С С С С С С С С t С С С  С  С С С С С С С С С С С С С С С С С С С С С С С С С С С С С С С  С С С С l С С С С  С С С \  urolifc`]ZWTQNKHEB?<9630-*'$!  xrptNLMTncnsbsYGYFYEYDYCYBYAhlutccNDNPNRHC5inxxoulhzxtesosmsmidbdainhskmhcgneoxnxsxbambw~{xurolifc`]ZWTQNKHEB?<9630-*'$!kndTdBdNdCugYpYoBTYnYmYlYkYjYiYhYgYfYeYdYcYbYaNCpaCoMWmalwlhNlwsvtpbsglmliitco}zwtqnkheb_\YVSPMJGDA>;852/,)&#  ~{xurolifc`]ZWTQNKHEB?<9630-*'$!  |yvspmjgda^[XUROLIFC@=:741.+(%"  }zwtqnkheb_\YVSPMJGDA>;852/,)&#  ޿ۿؿտҿϿ̿ɿƿÿ~{xurolifc`]ZWTQNKHEB?<96i30-*'$! bxmumlGCGVGHGDGUGLGRG4G1G3G2kobcnlrsi2sLsAXvXtXrXoXlXhS8S7S6S5S4S3S2S1YZYzYyYxYwYvZzXys3s2s1s0cidvxlABAFGmRQMiKmZyZxZwZvZuZtZsZrZqZpZoZnZmZlZkZjZiZhZgZfZeZdZcZbZaZZZYZXZWZVZUZTZSZRZQZPZOZNZMZLZKZJZIZHZGZFZEZDZCZBZASbSfspIpIcocopu9u8u7u6u5u4u3u2u1u0WAPAfhPUTOQDDIHUWGCWRCDKSCLfMRMLMCcbFrFqFpFoFnFmFlFkFjFiFhFgFfFeFdFcFbFaFZFYFXFWFVFUFTFSFRFQFPFOFNFMFLFKFJFIFHFGFFFEFDFCFBFAF9F8F7F6F5F4F3F2F1RF!3!2!1%j%i%h%g%f%e%d%c%b%a#4#3#2#1*0*9*8*7*6*5*4*3*2*1&0&9&8&7&6&5&4&3&2&1%0%9%8%7%6%5%4%3%2%1@0@9@8@7@6@5@4@3@2@1LFLOeAXFXNRASARXSXkBpnacrPpOK5K4K2K3K1iPhuuctstawistsasrsfsccvrcrfr3r2r1rppopfpspxplpkUPSRRILEALSFICDODLDCpcnwmmmol9l8l7l6l5l4l3l2lal1l0kskekukTkRkFkrkPkNkHklkAkIkhk9k8k7k6k5k4k3k2k;k1k0kSkEkMkdkLkDktkCkakbipalicifi3isi1fsffvbueseeiedtemeaeecussomrmpmkimmhdmtimdmbashddsdldcvsupllndveCMlevihodocmCCchcdceclctcscrblbtNCURSES_NO_PADDINGCOLORFGBG A$@ , @, l, , , x2d2d2dJ2d<2d,2d2d  Out of memory%dz; <; <; z; <; <; <; <; <; <; <; <; <; 4; ; <; <; <; <; <; <; <; <; <; <; <; ,; <; <; <; <; <; <; <; <; <; <; <; <; <; <; <; <; <; <; <; <; <; <; <; <; <; <; <; <; <; : <; <; <; <; <; <; <; <; <; <; : : <; <; <; <; <; <; <; <; <; <; : <; <; <; : <; <; <; <; : d< < < < < d< @< < < d< d< < d< < d< < < < < < < < < < < < < d< d< d< < < d< < < < < < < < < < < < < < d< << < < < < < < < < < < < < < d< < < < < < < < < << < p< < <  < d< < <  < < <  < < < < < < < < L< d< < d< 4> = = 4> = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = F $H $H $H > D A $H $H B $B $H |B $H 0C $H $H $H $H $H $H $H $H $H $H $H $H (F E F $H $H D $H $H $H $H $H $H $H $H $H $H $H $H $H 4D @ $H $H $H $H $H $H $H > $H $H $H $H $H pE $H $H $H $H > > G $H |A $H pG $H $H \? C $H > @ $H $H ? G $H $H $H > $H $H A E $H G NCURSES_NO_SETBUF2Kn,X   `  %KLINESCOLUMNSTERMTERM environment variable not set. TERM environment must be <= %d characters. Not enough memory to create terminal structure. terminals database is inaccessible '%s': unknown terminal type. CC'%s': I need something more specific. '%s': I can't handle hardcopy terminals. @(#)termcap.c 8.1 (Berkeley) 6/4/93TERMCAPTERMPATHHOME.termcap /usr/share/misc/termcap/usr/share/misc/termcap:|:Out of memory|terminal names must start with letter or digitName collision between %s %sresolution of use=%s failedexit_standout_mode but no enter_standout_modeenter_standout_mode but no exit_standout_modeexit_underline_mode but no enter_underline_modeenter_underline_mode but no exit_underline_modeexit_alt_charset_mode but no enter_alt_charset_modeenter_alt_charset_mode but no exit_alt_charset_modeenter_alt_charset_mode but no acs_charsexit_alt_charset_mode but no acs_charsenter_blink_mode but no exit_attribute_modeenter_bold_mode but no exit_attribute_modeenter_ca_mode but no exit_ca_modeexit_ca_mode but no enter_ca_modeexit_delete_mode but no enter_delete_modeenter_delete_mode but no exit_delete_modeenter_dim_mode but no exit_attribute_modeexit_insert_mode but no enter_insert_modeenter_insert_mode but no exit_insert_modeenter_secure_mode but no exit_attribute_modeenter_protected_mode but no exit_attribute_modeenter_reverse_mode but no exit_attribute_modeto_status_line but no from_status_linefrom_status_line but no to_status_linemeta_on but no meta_offmeta_off but no meta_onprtr_off but no prtr_onprtr_on but no prtr_offrestore_cursor but no save_cursorsave_cursor but no restore_cursorexit_xon_mode but no enter_xon_modeenter_xon_mode but no exit_xon_modeexit_am_mode but no enter_am_modeenter_am_mode but no exit_am_modelabel_off but no label_onremove_clock but no display_clockdisplay_clock but no remove_clockset_color_pair but no initialize_pair/usr/share/misc/terminfoTERMINFO%s/%s%c/%.*sTERMINFO_DIRSEntry does not start with terminal names in column oneprimary namealias%s `%.*s' may be too longusetc%s (%s termcap extension) ignored%s (%s termcap extension) aliased to %s%s (%s terminfo extension) ignored%s (%s terminfo extension) aliased to %sextended capability '%s'unknown capability '%s'maMTbooleanstringnumericunknownwrong type used for %s capability '%s'unknown token type|yurmjfc]ZURLIC@:71.*'! kcuu1uptakhtsstkentnlkcuf1ndkcub1lekICimkich1ickhomehokrmireikcud1dokdl1dlkdch1dctbcctkclrclkelcekedcdkcbtbtkil1al  %s$<%d>hardware tabs with a width other than 8: %dhardware tabs with a non-^I tab string %sunknown capability `%.*s' in ko stringko translation table is invalid, I give upno value for ko capability %s%s (%s) already has an explicit value %s, ignoring koacsc string synthesized from XENIX capabilities``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~acsc string synthesized from AIX capabilitiesHOMEOut of memory%s/.terminfo@%&*!#Illegal character (expected alphanumeric or %s) - %spremature EOFempty longname fieldwhitespace in name or alias fieldslashes aren't allowed in names or aliases$[]!*?dubious character `%c' in name or alias fieldSeparator inconsistent with syntaxMissing separator after `%s', have %sno value given for `%s'Missing separatorIllegal character - %sPremature EOFIllegal ^ character - %sAllow ^? as synonym for \177Non-octal digit `%c' in \ sequenceIllegal character %s in \ sequenceVery long string found. Missing separator? ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` P ` ` ` ` ` ` ` ` ` ` ` ` ` X ` ` ` ` ` ` ` ` ` `  ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` ` @ ` H ` `   ` `  0 ` ` ` ` `  `  ` ` `  ( 8 Can't backspace off beginning of line|xtolifc` ] Z W S NKEB?<83.)#  !"#$     .{wsnie_ZSL DHDA=930-)#  I    !"#$%&'()~*y+t,n-k.g/c0_1;[2LX3S4O5L6H7C8>9b8:2;-<'=!>?@AB CDEFG=HIJKLMNOPQRST7UiVWQXYZ[\]^!_`ab|c^xdtepflghhdiaj]kYlTmQnMoIpEqAr;s35t1u-v)w%x!yz{|~}~ {vqlg6b]XSNIFD?:50+&! Pe Hzupkgb]XSNI+D?:50+ &!!"#$% &()*+,-./023456789:<=>?@AB|CwDrm Fh Gc H^ IZ VQOLLHC>83%-)$ !"#$%&'()*+,-.E/0123456789:;<N=y>u?o@jAfB`C[DpUEOFKGFH@I:J4K5/L)M/"NOPQR STUVWXYZ[X\]^|_`ab[cdefWghijkl|mwnmrolpfq`rZsUtMuGvAw8x1yt+z%{|}R~ !%&'"# ()$%&|w*r+mhc^YTOJE@<;y61,box1memumemlOTGCOTGVOTGHOTGDOTGUOTGLOTGROTG4OTG1OTG3OTG2OTxrOTptOTmaOTkoOTknOTdTOTdBOTNLOTMTOTbcOTnlOTdNOTdCOTncOTnsOTbsOTugOTrsOTi2slengthsgr1evhlmethlmerhlmelohlmelhlmehhlmscesascescpctrmrmscsmscrmpchsmpchdispcslinessetcolorendbidefbicolornmbicrbinelbirepsmgtbsmglrs3dss2dss1dss0dscsindevtpfxlsetabsetafgetmreqmpminfokmouscsnmzeromdocrsupcssubcsrcsdrbimscsdsbimsmgtpsmgtsmgrpsmglpsmgbpsmgbscsmcuumcufmcubmcudpordermcuu1mvpamcuf1mcub1mcud1mhparumrsupmrsubmrshmrmicmrlmritmrwidmsumssupmssubmsshmsnrmqsnlqsmicmslmsitmsdrfqswidmdefccvrchrlpicpisetbsetfscpinitpinitcocopu9u8u7u6u5u4u3u2u1u0waitpausehookpulsetoneqdialdialhupwingocwinrmclkdclksclkflnsmgrsmglmgcel1kf63kf62kf61kf60kf59kf58kf57kf56kf55kf54kf53kf52kf51kf50kf49kf48kf47kf46kf45kf44kf43kf42kf41kf40kf39kf38kf37kf36kf35kf34kf33kf32kf31kf30kf29kf28kf27kf26kf25kf24kf23kf22kf21kf20kf19kf18kf17kf16kf15kf14kf13kf12kf11rfikUNDkSPDkSAVkRESkRITkRPLkRDOkPRTkPRVkOPTkNXTkMOVkMSGkLFTkICkHOMkHLPkFNDkEXTkEOLkENDksltkDLkDCkCRTkCPYkCMDkCANkBEGkundkspdksavkreskrstkrplkrfrkrefkrdokprtkprvkoptkopnknxtkmovkmsgkmrkkhlpkfndkextkentkendkcrtkcpykcmdkclokcankbegrmlnsmlnenacsxoffcxoncrmamsmamrmxonsmxonkcbtplnacscrmpmc5pkc3kc1kb2ka3ka1iproghuuctslhtwindhtssgrriindscvparcrfrs3rs2rs1repmc5mc4mc0pfxpflocpfkeycuurincufcubilindnichcuddldchpadnelsmmrmmlf9lf8lf7lf6lf5lf4lf3lf2lf10lf1lf0smkxrmkxkcuu1khtskrikindkcuf1kppknpkllkcub1kil1kich1khomekf9kf8kf7kf6kf5kf4kf3kf2kf10kf1kf0kedkelkrmirkcud1kdl1kdch1kctabkclrktbckbsipil1ich1ifis3is2is1fslffflashrmulrmsormirrmdcrmcupsgr0rmacsechsmulsmsorevprotinvissmirdimsmdcsmcupboldblinksmacshddsldl1dch1cvviscuu1llcuf1cnormmrcupcub1civishomecud1cupcmdchhpaedelcleartbccsrcrbelcbtbitypebitwinbtnswidcscpsorviorhiorlorcnpinsmlsmcsmjumpmaddrspinhspinvbufszncvpairscolorswnummalwlhnlabwslvtpbxmclmlinesitcolslpixcpixsamxvpadaisycrxmxhpahlsbcecccndscrnpcnrrmcchtsmc5inxonxonulhzxteslokosmsgrmirdbdainhskmhcgneoxenlxhpxsbambwLLP0\X|`(,pp8Tl4td@l(`Txd htP@L$pH$t@ `, $xl<h`<`<Dx4XX,4p 08  ,hhX|H\xd8dl8P|$d8P<48| dD\d0tT ( 0XhD, l4<\<t|x`00X0LDT<TX`HXHpld|@HT, |222lifc` ] Z W 2 2K2B?<2222222222222 |2!y2"v2#s2$p2m2j2g2d2   a2 ^2 [2X2U2R2O2L2I2F2C2@2=2:2724212.2+2(2%2 "22A22222 2 2 2 2 2 1 1111111a111111111 1!1"1#1$1%1&1'1(-)1*1+1,1-k.1/10f1112X31415L61718191:1;1<1=1>}1?z1@w1At1Bq1Cn1Dk1Eh1Fe1Gb1H_1I\1JY1KV1LS1MP1NM1OJ1PG1QD1RA1S>1T;1U81V51W21X/1Y,1Z)1[&1\##1] 1^1_1`1a1b1c1d 1e1fx1g1h0i0j0k0l0m0n0o0po0q0r0s0t0u0v0w0x0y0z0{0|}~0000000000000000%0000u000~0{0~x0u0r0o0l0i0f0c0`0]0Z0W0T0tQ0N0aK0mH0E0B0d?0 <090v60`3000W-0*0'0$0!0000000 0 0000/////////////////z/////./'///X/(/////////5/6/7/8/9/:/;/</=|/>y/?v/@s/Ap/Bm/Dj/Eg/d/a/^/[/X/U/R/O/L/I/F/C/^@/=/:/7/4/1/./ +/ (/ %/ "/ ////// / ////...... !"#$%&'()*.+.,.-.../.0.1.2.3.4.50.6.7.8.9.:.;.<.=.>.?.@.A.B.C.Dg.E.Fh.G.H.I.J.K.L.M.N.O}.Pz.Qw.Rt.Sq.Tn.Uk.Vh.We.Xb.Y_.Z\.[Y.\V.]S.^P._M.`J.aG.bD.cA.d>.e;.f8.g5.h2.i/.j,.k).l&.mC#.n .o/pU.q.r.s.t.u.v .w.x.y.z-{-|-}e-~f-g-h-i-----------!-%-&-'-"-#--.(-)-$-%-&-{-*-+-----------~-{-x-bxmumlGCGVGHGDGUGLGRG4G1G3G2xrptkokndTdBNLbcnldNdCncnsbsugrsi2sLsAXvXtXrXoXlXhS8S7S6S5S4S3S2S1YZYzYyYxYwYvZzXyMTs3s2s1s0cidvxlABAFGmRQMiKmZyZxZwZvZuZtZsZrZqZpZoZnZmZlZkZjZiZhZgZfZeZdZcZbZaZZZYZXZWZVZUZTZSZRZQZPZOZNZMZLZKZJZIZHZGZFZEZDZCZBZASbSfspIpIcWAPAfhPUTOQDDIHUWGCWRCDKSCLfMRMLMCcbFrFqFpFoFnFmFlFkFjFiFhFgFfFeFdFcFbFaFZFYFXFWFVFUFTFSFRFQFPFOFNFMFLFKFJFIFHFGFFFEFDFCFBFAF9F8F7F6F5F4F3F2F1RF!3!2!1%j%i%h%g%f%e%d%c%b%a#4#3#2#1*0*9*8*7*6*5*4*3*2*1&0&9&8&7&6&5&4&3&2&1%0%9%8%7%6%5%4%3%2%1@0@9@8@7@6@5@4@3@2@1LFLOeAXFXNRASARXSXkBpnacrPpOK5K4K2K3K1iPtstawistsasrsfcvr3r2r1rppopfpspxplpkUPSRRILEALSFICDODLDCpcnwmmmol9l8l7l6l5l4l3l2lal1l0kskekukTkRkFkrkPkNkHklkAkIkhk9k8k7k6k5k4k3k2k;k1k0kSkEkMkdkLkDktkCkakbalici3isi1fsvbueseeitemeaeecussomrmpmkimmhdmtimdmbasdsdcvsupndveCMlevihodocmCCchcdceclctcsblbtYpYoBTYnYmYlYkYjYiYhYgYfYeYdYcYbYaNCpaCoMWNlwssglicoYGYFYEYDYCYBYAhlutccNDNPNRHC5inxxoesmsmixnxsxb"H "8++$p)\|0*!%'#T-L,8*`*h+$-&&(`' 'X0'+ %)t,(,|0**l-T* $(8%#'H*|,<$(d  #h%L# ,4l$)d<%|#" (!$*\"xT4$L)x*l %<* #," "@,D+$-@4&L$!%#(D*t+$<-p( <',%) +`-*+ *`$H-@&d&L&D%(#''4,H$( &t%X#|&'@&$"'DX&x$()H!%",(!h"x$X) !&%#, " "*P+$)4 0!t&,#(X p&++%)txX(,H'+*)hl*+*$$$-d&P%4#x''T$0-8L X,pp0%d#"((,l'TD"tl$ -4*p, %#,!t",,+$d)DX+ !%#h(,"( ",*\++$)Ld,@ h%t%+%;%+%-%*%/%+%c%s%-%c%c%2d%3d%d%\unknown %% code %s (%#x) in %s$</>      l       " <     `      |      `                                X                  6  6  6 6 6 6 6 6 6 6 6 6 6 6 6  \%03o%>%%%%?%%{%d}%%>%%t%%{%d}%%+%%;%%?%%{%d}%%>%%t%%'%c'%%+%%;%%?%%'%c'%%>%%t%%{%d}%%+%%;%%?%%'%c'%%>%%t%%'%c'%%+%%;%B%%{%d}%%+%%c%%'%c'%%+%%c%D%n%mdoxX.%.%rl                                                                           0   $ Out of memory.PPPPPP|PyPvPsPpPmPjPgPdPaP^P[PXPUPRPOPLPIPFPCP@P=P:P7P4P1P/P-P+P)P'P%P#P!PPPPPPPPPP P P PPPPPOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO}O{OyOwOuOsOpOmOjOgOdOaO^O[OXOUOROOOLOIOFOCO@O=O:O7O4O1O.O+O(O%O"OOOOOOOO O OOOOOONNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN~N|NzNxNvNtNrNpNnNlNjNhNfNdNbN`N^N\NZNXNVNTNRNPN~_~^~]~\~[~Z~Y~X~W~V~U~T~S~R~Q~P~O~N~M~L~K~J~I~H~G~F~E~D~C~B~A~@^?~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"! ^_^^^]^\^[^Z^Y^X^W^V^U^T^S^R^Q^P^O^N^M^L^K^J^I^H^G^F^E^D^C^B^A^@(null)(cancelled)\%03o"%s", line %d, col %d, terminal '%s' DRAR=R9R4R1R.R+R(R%R"RRRRRR RRRRQQQQQQQQQQQQQQQQQQQQQQQQOTxrOTptOTNLOTMTOTncOTnsOTbslpixcpixsamxvpadaisycrxmxhpahlsbcecccndscrnpcnrrmcchtsmc5inxonxonulhzxteslokosmsgrmirdbdainhskmhcgneoxenlxhpxsbambwUUUUUrUeU[UNU>U+UUUUTTTTTTT~TrTfTXTLT5T*TTTSSSSSSSpS_SGS6S"SSRreturn_does_clr_eolhas_hardware_tabslinefeed_is_newlinegnu_has_meta_keyno_correctly_working_crcrt_no_scrollingbackspaces_with_bslpi_changes_rescpi_changes_ressemi_auto_right_marginrow_addr_glitchhas_print_wheelcr_cancels_micro_modecol_addr_glitchhue_lightness_saturationback_color_erasecan_changenon_dest_scroll_regionno_pad_charnon_rev_rmcuphard_cursorprtr_silentneeds_xon_xoffxon_xofftransparent_underlinetilde_glitchdest_tabs_magic_smsostatus_line_esc_okover_strikemove_standout_modemove_insert_modememory_belowmemory_aboveinsert_null_glitchhas_status_linehas_meta_keyhard_copygeneric_typeerase_overstrikeeat_newline_glitchceol_standout_glitchno_esc_ctlcauto_right_marginauto_left_margin3W0W*W'W#W WWWWWW WWVVVVVVVVVVVVVVVVVVVVVVVVV|VOTknOTdTOTdBOTdNOTdCOTugbitypebitwinbtnswidcscpsorviorhiorlorcnpinsmlsmcsmjumpmaddrspinhspinvbufszncvpairscolorswnummalwlhnlabwslvtpbxmclmlinesitcols+Z!Z*WZYYYYYYYYYzYpYaYQY@Y/YYYXXXXXXXX|XtX`XQX:X$XXXWWnumber_of_function_keyshorizontal_tab_delaybackspace_delaynew_line_delaycarriage_return_delaymagic_cookie_glitch_ulbit_image_typebit_image_entwiningbuttonswide_char_sizeprint_rateoutput_res_vert_inchoutput_res_horz_inchoutput_res_lineoutput_res_charnumber_of_pinsmicro_line_sizemicro_col_sizemax_micro_jumpmax_micro_addressdot_horz_spacingdot_vert_spacingbuffer_capacityno_color_videomax_pairsmax_colorsmaximum_windowsmax_attributeslabel_widthlabel_heightnum_labelswidth_status_linevirtual_terminalpadding_baud_ratemagic_cookie_glitchlines_of_memoryinit_tabscolumnshhhh|hvhshphlhfhbh]hXhRhMhGhAhy4y&yyyyyxxxxxxxxxxxxxxxx~xvxnxfx^xVxNxFx>x6x.x&xxxxxwwwwwwwwwwwwwwww~wvwhwXwGw:w0w"wwwvvvv\cVcvvvvvvvvvvvvvwvkvZvJv;v,vv vuuuuuuu|ukuQuq.qqqpppppppmpYpGp0ppppoooooooosojoaoXoOoEo;o2o&oo obox_chars_1memory_unlockmemory_lockacs_plusacs_vlineacs_hlineacs_tteeacs_bteeacs_rteeacs_lteeacs_lrcorneracs_urcorneracs_llcorneracs_ulcornerarrow_key_mapother_non_function_keysbackspace_if_not_bslinefeed_if_not_lftermcap_resettermcap_init2set_pglen_inchset_a_attributesenter_vertical_hl_modeenter_top_hl_modeenter_right_hl_modeenter_low_hl_modeenter_left_hl_modeenter_horizontal_hl_modealt_scancode_escscancode_escapepc_term_optionsexit_scancode_modeenter_scancode_modeexit_pc_charset_modeenter_pc_charset_modedisplay_pc_charset_page_lengthset_color_bandend_bit_image_regiondefine_bit_image_regioncolor_namesbit_image_carriage_returnbit_image_newlinebit_image_repeatset_tb_marginset_lr_marginset3_des_seqset2_des_seqset1_des_seqset0_des_seqcode_set_initdevice_typepkey_plabset_a_backgroundset_a_foregroundget_mousereq_mouse_posmouse_infokey_mousechar_set_nameszero_motionthese_cause_crsuperscript_characterssubscript_charactersstop_char_set_defstop_bit_imagestart_char_set_defstart_bit_imageset_top_margin_parmset_top_marginset_right_margin_parmset_left_margin_parmset_bottom_margin_parmset_bottom_marginselect_char_setparm_up_microparm_right_microparm_left_microparm_down_microorder_of_pinsmicro_upmicro_row_addressmicro_rightmicro_leftmicro_downmicro_column_addressexit_upward_modeexit_superscript_modeexit_subscript_modeexit_shadow_modeexit_micro_modeexit_leftward_modeexit_italics_modeexit_doublewide_modeenter_upward_modeenter_superscript_modeenter_subscript_modeenter_shadow_modeenter_normal_qualityenter_near_letter_qualityenter_micro_modeenter_leftward_modeenter_italics_modeenter_draft_qualityenter_doublewide_modedefine_charchange_res_vertchange_res_horzchange_line_pitchchange_char_pitchset_backgroundset_foregroundset_color_pairinitialize_pairinitialize_colororig_colorsorig_pairuser9user8user7user6user5user4user3user2user1user0wait_tonefixed_pauseflash_hookquick_dialdial_phonehangupgoto_windowcreate_windowremove_clockdisplay_clockset_clocklabel_formatset_right_marginset_left_marginclear_marginsclr_bolkey_f63key_f62key_f61key_f60key_f59key_f58key_f57key_f56key_f55key_f54key_f53key_f52key_f51key_f50key_f49key_f48key_f47key_f46key_f45key_f44key_f43key_f42key_f41key_f40key_f39key_f38key_f37key_f36key_f35key_f34key_f33key_f32key_f31key_f30key_f29key_f28key_f27key_f26key_f25key_f24key_f23key_f22key_f21key_f20key_f19key_f18key_f17key_f16key_f15key_f14key_f13key_f12key_f11req_for_inputkey_sundokey_ssuspendkey_ssavekey_srsumekey_srightkey_sreplacekey_sredokey_sprintkey_spreviouskey_soptionskey_snextkey_smovekey_smessagekey_sleftkey_sickey_shomekey_shelpkey_sfindkey_sexitkey_seolkey_sendkey_selectkey_sdlkey_sdckey_screatekey_scopykey_scommandkey_scancelkey_sbegkey_undokey_suspendkey_savekey_resumekey_restartkey_replacekey_refreshkey_referencekey_redokey_printkey_previouskey_optionskey_openkey_nextkey_movekey_messagekey_markkey_helpkey_findkey_exitkey_enterkey_endkey_createkey_copykey_commandkey_closekey_cancelkey_beglabel_offlabel_onena_acsxoff_characterxon_characterexit_am_modeenter_am_modeexit_xon_modeenter_xon_modekey_btabplab_normacs_charschar_paddingprtr_nonkey_c3key_c1key_b2key_a3key_a1init_progup_half_lineunderline_charto_status_linetabset_windowset_tabset_attributesscroll_reversescroll_forwardsave_cursorrow_addressrestore_cursorreset_filereset_3stringreset_2stringreset_1stringrepeat_charprtr_onprtr_offprint_screenpkey_xmitpkey_localpkey_keyparm_up_cursorparm_rindexparm_right_cursorparm_left_cursorparm_insert_lineparm_indexparm_ichparm_down_cursorparm_delete_lineparm_dchpad_charnewlinemeta_onmeta_offlab_f9lab_f8lab_f7lab_f6lab_f5lab_f4lab_f3lab_f2lab_f10lab_f1lab_f0keypad_xmitkeypad_localkey_upkey_stabkey_srkey_sfkey_rightkey_ppagekey_npagekey_llkey_leftkey_ilkey_ickey_homekey_f9key_f8key_f7key_f6key_f5key_f4key_f3key_f2key_f10key_f1key_f0key_eoskey_eolkey_eickey_downkey_dlkey_dckey_ctabkey_clearkey_catabkey_backspaceinsert_paddinginsert_lineinsert_characterinit_fileinit_3stringinit_2stringinit_1stringfrom_status_lineform_feedflash_screenexit_underline_modeexit_standout_modeexit_insert_modeexit_delete_modeexit_ca_modeexit_attribute_modeexit_alt_charset_modeerase_charsenter_underline_modeenter_standout_modeenter_reverse_modeenter_protected_modeenter_secure_modeenter_insert_modeenter_dim_modeenter_delete_modeenter_ca_modeenter_bold_modeenter_blink_modeenter_alt_charset_modedown_half_linedis_status_linedelete_linedelete_charactercursor_visiblecursor_upcursor_to_llcursor_rightcursor_normalcursor_mem_addresscursor_leftcursor_invisiblecursor_homecursor_downcursor_addresscommand_charactercolumn_addressclr_eosclr_eolclear_screenclear_all_tabschange_scroll_regioncarriage_returnbellback_tab_HiStOrY_V1_ rw%s< , \ t  h  D P         *?_-.[]~=bindtelltcsettcechotcsettyX% h% x% % % % % % % h& & % % & 0& H& /.editrcHOME%s%sr^DEditline extended commanded-commandMove down one lineed-next-lineMove up one lineed-prev-lineSearch next in history for a line matching the currented-search-next-historySearch previous in history for a line matching the currented-search-prev-historyMove to the next history lineed-next-historyMove to the previous history lineed-prev-historyFirst character in a bound sequenceed-sequence-lead-inErase current line and start from scratched-start-overRedisplay everythinged-redisplayClear screen leaving current line at the toped-clear-screenDelete the character to the left of the cursored-delete-prev-charExecute commanded-newlineTty allow output charactersed-tty-start-outputTty disallow output charactersed-tty-stop-outputTty suspend charactered-tty-sigtstpTty quit charactered-tty-sigquitTty flush output charactersed-tty-flush-outputTty delayed suspend charactered-tty-dsuspTty interrupt charactered-tty-sigintIndicates unbound charactered-unassignedDigit that starts argumented-argument-digitAdds to argument or enters a digited-digitAdd the next character typed verbatimed-quoted-insertMove to the left one charactered-prev-charMove to the beginning of the current worded-prev-wordMove to the right one charactered-next-charExchange the character to the left of the cursor with the one under ited-transpose-charsMove cursor to the beginning of lineed-move-to-begMove cursor to the end of lineed-move-to-endCut to the end of lineed-kill-lineDelete character under cursored-delete-next-charDelete from beginning of current word to cursored-delete-prev-wordAdd character to the lineed-insertIndicate end of fileed-end-of-fileEmacs incremental reverse searchem-inc-search-prevEmacs incremental next searchem-inc-search-nextCopy current word to cursorem-copy-prev-wordSwitch from insert to overwrite mode or vice versaem-toggle-overwriteAdd 8th bit to next character typedem-meta-nextUniversal argument (argument times 4)em-universal-argumentExchange the cursor and markem-exchange-markSet the mark at cursorem-set-markLowercase the characters from cursor to end of current wordem-lower-caseCapitalize the characters from cursor to end of current wordem-capitol-caseUppercase the characters from cursor to end of current wordem-upper-caseMove next to end of current wordem-next-wordExchange the two characters before the cursorem-gosmacs-trasposeCopy area between mark and cursor to cut bufferem-copy-regionCut area between mark and cursor and save in cut bufferem-kill-regionCut the entire line and save in cut bufferem-kill-linePaste cut buffer at cursor positionem-yankCut from cursor to end of current wordem-delete-next-wordDelete character under cursor or list completions if at end of lineem-delete-or-listVi repeat current character search in the opposite search directionvi-repeat-prev-charVi repeat current character search in the same search directionvi-repeat-next-charVi move up to the character specified previousvi-to-prev-charVi move up to the character specified nextvi-to-next-charVi move to the character specified previousvi-prev-charVi move to the character specified nextvi-next-charVi repeat current search in the opposite search directionvi-repeat-search-prevVi repeat current search in the same search directionvi-repeat-search-nextVi search history nextvi-search-nextVi search history previousvi-search-prevVi cut from beginning of line to cursorvi-kill-line-prevVi list choices for completion or indicate end of file if empty linevi-list-or-eofVi move to previous character (backspace)vi-delete-prev-charVi move to the beginning of linevi-zeroVi enter command mode (use alternative key bindings)vi-command-modeVi undo all changesvi-undo-lineVi undo last changevi-undoVi move to the end of the current wordvi-to-end-wordVi move to the end of the current space delimited wordvi-end-wordVi delete prefix commandvi-delete-metaVi enter insert mode at end of linevi-add-at-eolVi enter insert mode after the cursorvi-addVi enter insert modevi-insertVi change to end of linevi-change-to-eolVi substitute entire linevi-substitute-lineVi replace character under the cursor and enter insert modevi-substitute-charVi enter replace modevi-replace-modeVi replace character under the cursor with the next character typedvi-replace-charVi enter insert mode at the beginning of linevi-insert-at-bolVi change prefix commandvi-change-metaVi change case of character under the cursor and advance one charactervi-change-caseVi move to the next wordvi-next-wordVi move to the next space delimited wordvi-next-space-wordVi move to the previous wordvi-prev-wordVi move to the previous space delimited wordvi-prev-space-wordVi paste previous deletion to the left of the cursorvi-paste-prevVi paste previous deletion to the right of the cursorvi-paste-next%d %skey_add: Null extended-key not allowed. key_add: sequence-lead-in command not allowed key_delete: Null extended-key not allowed. Unbound extended key "%s" Some extended keys too long for internal print buffer "%s..." %-15s-> %s ""[]no inputemacsvi%s -> %s %-15s-> is undefined %-4s to %-7s-> %s Standard key bindings Alternative key bindings Multi-character bindings Arrow key bindings %s %s %s: Invalid switch `%c'. %s: Invalid \ or ^ in instring. %s: Invalid \ or ^ in outstring. %s: Invalid command `%s'. tC D D D C D D D D D C C D D D D D C C D D C history: 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-unknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data checky<\?j deflate 1.1.4 Copyright 1995-2002 Jean-loup Gailly l()) ), ,, , , ,1.1.4q     invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeat3,55789==U>>incompatible versionbuffer errorinsufficient memorydata errorstream errorfile errorstream endneed dictionary1.1.4       L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c         (08@P`p  0@`  0@`invalid literal/length codeinvalid distance coded_7`(aapbbcd:ete inflate 1.1.4 Copyright 1995-2002 Mark Adler  #+3;CScspp !1Aa  0@` oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengthsinvalid distance codeinvalid literal/length code$FreeBSD: src/lib/libc/string/strtok.c,v 1.2.6.1 2001/07/09 23:30:07 obrien Exp $$FreeBSD: src/lib/libc/string/strspn.c,v 1.1.1.1.14.1 2001/07/09 23:30:07 obrien Exp $$FreeBSD: src/lib/libc/string/strmode.c,v 1.1.1.2.6.1 2001/07/09 23:30:07 obrien Exp $-csh/bin/sh...%s: illegal option -- %c %s: option requires an argument -- %c $FreeBSD: src/lib/libc/stdtime/strftime.c,v 1.25.2.4 2002/03/12 17:24:54 phantom Exp $@(#)strftime.c 7.38@(#)strftime.c 5.4 (Berkeley) 3/14/89%c?%02d%m/%d/%y%2d%Y-%m-%d%03d %H:%M%ld%lu%H:%M:%S %d%04d%e-%b-%Y+-$ `(̊,`(̎\؇DxЈ؇x(HdDD`8 shut up gcc*** unknown regexp error code ***invalid argument to regex routineREG_INVARG"can't happen" -- you found a bugREG_ASSERTempty (sub)expressionREG_EMPTYrepetition-operator operand invalidREG_BADRPTout of memoryREG_ESPACEinvalid character rangeREG_ERANGEinvalid repetition count(s)REG_BADBRbraces not balancedREG_EBRACEparentheses not balancedREG_EPARENbrackets ([ ]) not balancedREG_EBRACKinvalid backreference numberREG_ESUBREGtrailing backslash (\)REG_EESCAPEinvalid character classREG_ECTYPEinvalid collating elementREG_ECOLLATEinvalid regular expressionREG_BADPATregexec() failed to matchREG_NOMATCHREG_0x%x0%dxdigitupperspacepunctprintlowergraphdigitcntrlblankalphaalnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNUL ,L[:<:]][:>:]]40x tp(((((30((((((RSHtcpshell%drcmd: getaddrinfo: %s rcmd: socket: All ports in use rcmd: socket: %s %s: %s connect to address %s: Trying %s... rcmd: write (setting up stderr): %s rcmd: too many files rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: accept: %s socket: protocol failure in circuit setup. rcmd: %s: %s 0r/etc/hosts.equiv/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts owner.rhosts writeable by other than ownerISO_ISOEUCja_JPeucJPko_KReucKRzh_CNeucCNASCIIUS-ASCIICPOSIX0DXl$40%X%X       x l  T   `                    /var/run/dev.db/dev/$FreeBSD: src/lib/libc/gen/strtofflags.c,v 1.18.2.1 2000/06/28 01:52:24 joe Exp $nouunlinknouunlnknoopaquenodumpnouimmutablenouchangenouchgnouappendnouappndnosunlinknosunlnknosimmutablenoschangenoschgnoarchivednoarchnosappendnosappnd ,stringlist: %m40,'# usr2usr1infowinchprofvtalrmxfszxcpuiottouttinchldconttstpstopurgtermalrmpipesyssegvbuskillfpeemtabrttrapillquitinthupSignal 04ti`G@6#~qZB,User defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangup LLLLLLLLLLLLLLLLLLLLLLLL/dev/tty %ur+sh-c/bin/shHOME.$FreeBSD: src/lib/libc/gen/getvfsbyname.c,v 1.5 1999/08/27 23:58:45 peter Exp $BLOCKSIZEGKM%s: unknown blocksizemaximum blocksize is %ldGminimum blocksize is 512%ld%s-blocks/kernel...//dev/ : xxswufsswap ,rwrqror/etc/fstabfstab: :%d: waJ8$`1"r\MA P? `? O5ub@ dR>(j@Illegal byte sequenceOperation canceledValue too large to be stored in data typeNo message of desired typeIdentifier removedNeed authenticatorAuthentication errorInappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisc quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0W$FreeBSD: src/lib/libc/gen/disklabel.c,v 1.9.2.1 2001/03/05 08:40:47 obrien Exp $DOC2KVinumCCDfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownvinumbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunused/etc/disktabb0b1tyremovablesimulatedsfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdx./$FreeBSD: src/lib/libc/string/strncat.c,v 1.1.1.1.14.1 2001/07/09 23:30:07 obrien Exp $$FreeBSD: src/lib/libc/string/strcspn.c,v 1.1.1.1.14.1 2001/07/09 23:30:06 obrien Exp $authunix_create: out of memory auth_none.c - Fatal marshalling problem/usr/bin/rshrcmdsh: unknown user: %s localhost%drcmdsh: getaddrinfo: %s rcmdsh: socketpairrcmdsh: fork failedrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: setuid(%u): %s /bin/sh-c-lrcmdsh: execlp %s failed: %s LC_MESSAGESLC_TIMELC_NUMERICLC_MONETARYLC_CTYPELC_COLLATELC_ALLC/PATH_LOCALE/usr/share/locale|| |||(|LANG{xnoyes^[nN]^[yY]LC_MESSAGESpasswd.byname%upasswd.byuid/etc/pwd.db/etc/spwd.db%s: %mpasswd.adjunct.byname:##master.passwd.bynamemaster.%s%s/etc/netgroupr%c*%s.%s%s.**.%s*.*netgroup.byusernetgroup.byhost), , netgroup%s %sgroup.byname%dgroup.bygidr/etc/group: :/%s.dbtcr`xph`xphPATH/usr/bin:/bin:.execvp: : path too long sh/bin/shTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT$FreeBSD: src/lib/libc/gen/err.c,v 1.6 1999/08/27 23:58:33 peter Exp $%s: : %s /+'# ule\SJ52/%I:%M:%S %pmd%a %b %e %H:%M:%S %Z %YPMAM%a %b %e %H:%M:%S %Y%m/%d/%y%H:%M:%SSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJanLC_TIMECPOSIXPATH_LOCALE/usr/share/locale//LC_CTYPErNONEUTF2UTF-8EUCGB18030GBKBIG5MSKanjiRuneMagi(PPPPPPPPPP@Hh0D 8dHL` s sssssssssssssssssssssssssssssssssssssssssssssssssss$FreeBSD: src/lib/libc/string/strcoll.c,v 1.11.2.1 2001/07/09 23:30:06 obrien Exp $$FreeBSD: src/lib/libc/stdlib/strtouq.c,v 1.4.8.1 2001/03/02 09:45:20 obrien Exp $$FreeBSD: src/lib/libc/stdlib/strtoull.c,v 1.5.2.1 2001/03/02 09:45:20 obrien Exp $$FreeBSD: src/lib/libc/stdlib/strtoq.c,v 1.4.6.1 2001/03/02 09:45:20 obrien Exp $$FreeBSD: src/lib/libc/stdlib/strtoll.c,v 1.5.2.1 2001/03/02 09:45:20 obrien Exp $xdr_array: out of memory CPOSIX//LC_COLLATEr1.0 1.1 __collate_substitute__collate_strdup: udptcp%u/etc/host.confrhostslocalfilefilesdnsbindnis# /etc/hosts0123456789abcdefip6.arpaip6.intin-addr.arpa;; res_query(%s, %d, %d) ;; res_query: mkquery failed ;; res_query: send error ;; rcode = %d, ancount=%d ((((((;; res_querydomain(%s, %s, %d, %d) %s.%sHOSTALIASESr;; res_mkquery(%d, %s, %d, %d) /&LOCALDOMAINr/etc/resolv.confdomain searchnameserver%dsortlistoptionsconfRES_OPTIONSenv;; res_setoptions("%s", "%s")... ndots:;; ndots=%d debug;; res_setoptions("%s", "%s").. ;; debug inet6insecure1insecure2no_tld_queryedns0(8 $hdhdhdtcpudpUnknown errorResolved protocol is unknownInvalid value for hintsSystem error returned in errnoai_socktype not supportedservname not supported for ai_socktypehostname nor servname provided, or not knownNo address associated with hostnameMemory allocation failureai_family not supportedNon-recoverable failure in name resolutionInvalid value for ai_flagsTemporary failure in name resolutionAddress family for hostname not supportedSuccess# /etc/host.confrhostslocalfilefilesdnsbindnisGAIgethostby*.getanswer: asked for "%s", got "%s"gethostby*.getanswer: asked for "%s %s %s", got type "%s"# 0/etc/hosts;; res_query(%s, %d, %d) ;; res_query: mkquery failed ;; rcode = %u, ancount=%u ^_^^__;; res_querydomain(%s, %s) %s.%s%d/%sservices.byportservices.byname%.*s %s/%sr/etc/services# ,/;; res options: %s;; ns_parserr: %s ;; %s SECTION: .;; %s, type = %s, class = %s ;; ns_sprintrr: %s ;; ns_initparse: %s ;; ->>HEADER<<- opcode: %s, status: %s, id: %d ; flags: qr aa tc rd ra ?? ad cd; %s: %d, %s: %dNONEANYHESIODHSCHAOSIN4-#ADDITIONALAUTHORITYANSWERQUERYxUPDATEPREREQUISITEZONE`XUIF(%               i U  O > 8 $ !                 U    ~ { g b @           ` !L ; "6          #   "any"URN Naming AuthorityNAPTRmail agent (deprecated)MAILAmailbox-related data (deprecated)MAILBzone transferAXFRincremental zone transferIXFRATM address (unimplemented)ATMAserver selectionSRVNIMROD locator (unimplemented)NIMLOCendpoint identifier (unimplemented)EIDnext valid name (unimplemented)NXTlocationLOCIPv6 addressAAAAgeographical position (withdrawn)GPOSmapping informationPXkeyKEYsignatureSIGNSAP_PTRnsap addressNSAProuterRTISDN addressISDNX25 addressX25DCE or AFS serverAFSDBresponsible personRPtextTXTmail exchangerMXmailbox informationMINFOhost informationHINFOdomain name pointerPTRwell-known service (deprecated)WKSnullNULLmail renameMRmail group memberMGmailboxMBstart of authoritySOAcanonical nameCNAMEmail forwarder (deprecated)MFmail destination (deprecated)MDname serverNSaddressA%dinitdebugaaonly(unimpl)usevcprimry(unimpl)igntcrecursdefnamstyopndnsrchinsecure1insecure2noaliasesinet6no-tld-queryedns0?0x%lx?%u%ld.%.2ld~~~~~~~~(444444444444444(4444444444444(444444444444444(?; error: unknown LOC RR version%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %sm%04d%02d%02d%02d%02d%02dZONEREFZONEINIT131211109876UPDATENOTIFYCQUERYUCQUERYMIQUERYQUERYNOCHANGE14ZONEERRNOTAUTHNXRRSETYXRRSETYXDOMAINREFUSEDNOTIMPNXDOMAINSERVFAILFORMERRNOERRORADDITIONALPREREQUISITESZONE. @ %s %s ( %lu; serial ; refresh ; retry ; expiry ); minimum %u %u %u %u %u %u %u ( %d )0x%04x %u %u ( %s %d %lu %s %sunknown RR typeRR format error\#( ; %s %02x ; \xxxxx4xĒ0Ē0\0DИ(" "\\len <= *buflen/usr/src/lib/libc/../libc/net/ns_print.c ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=assertion "%s" failed: file "%s", line %d Wao}L%d%cnisyellowpagesypdomaindnsbindhtablehosttable/etc/hostshostsr/etc/host.conf ,:;$FreeBSD: src/lib/libc/string/strsep.c,v 1.2.12.1 2001/07/09 23:30:07 obrien Exp $ hosts.bynamehosts.byaddrr/etc/hosts# gethostby*.gethostanswer: asked for "%s", got "%s"gethostby*.gethostanswer: asked for "%s %s %s", got type "%s"size (%d) too big Too many addresses (%d) Impossible condition (type=%d) res_search failed (%d) static buffer is too small (%d) %u.%u.%u.%u.in-addr.arpa%x.%x.ip6.arpaip6.intres_query failed (%d) syslog: unknown facility/priority: %x<%d>%.15s %s[%d]: %m /dev/console /var/run/log/dev/log$FreeBSD: src/lib/libc/string/strstr.c,v 1.1.1.1.14.1 2001/07/09 23:30:07 obrien Exp $$FreeBSD: src/lib/libc/string/strpbrk.c,v 1.1.1.1.14.1 2001/07/09 23:30:07 obrien Exp $$FreeBSD: src/lib/libc/string/strcasecmp.c,v 1.2.8.1 2001/07/09 23:30:03 obrien Exp $$FreeBSD: src/lib/libc/yp/yplib.c,v 1.34.2.2 2002/02/15 00:46:53 des Exp $SuccessInternal ypbind errorDomain not boundSystem resource allocation failureUnknown ypbind error: #%d /var/yp/binding%s/%s.%dclnttcp_createYP: server for domain %s not responding, retrying clntudp_createfcntl: F_SETFDyp_match: clnt_callyp_first: clnt_callyp_next: clnt_callclnttcp_create failed yp_all: clnt_callyp_order: clnt_callyp_master: clnt_callyp_maplist: clnt_callRequest arguments badRPC failureCan't bind to server which serves this domainNo such map in server's domainNo such key in mapYP server errorLocal resource allocation failureNo more records in map databaseCan't communicate with portmapperCan't communicate with ypbindCan't communicate with ypservLocal domain name not setServer data base is badYP server version mismatch - server can't supply service.Access violationDatabase is busyYP unknown error %d  $$FreeBSD: src/lib/libc/yp/xdryp.c,v 1.9.2.1 2002/02/15 00:46:53 des Exp $clntudp_create: out of memory t\h (?Tlclnttcp_create: out of memory p|%8L`t%s: %s; errno = %s ; low version = %lu, high version = %lu ; why = %s (unknown authentication error - %d) ; s1 = %lu, s2 = %lu -------------"!!!!!!U!HllpL`޺`׺\0к1ĺPJxV8\.(((l  ȂG@Bʚ;Ƥ~@P.0L@yslea[U /tmp/EdDk.XXXXXXXXXX.+`?    id@-v$n9h<P@FA BCMxNfOUPRQRR8S/T+UV\acdezpdu_wXxHy8%~nXPG@8 `@@5555555@5 s5i5]5 W5@L5A595 ,555577D;9;6;3;.;(;$;;;;;@;: :@::@:::##.axVxSxPxKxExAxc8_X^4@c2v-f(_c%cDzcc8xc{  d,j d؁`d{d^dfd`d`ۑe\Ց@eDzБeɑeԉđ`pf&fԏftfrgr@gi̒0_g gg8~gfx heqehnyhqh`hWhؓQIhąK iCGi4;i`6i̒0_-`fpr(i#Cj\jlpj _ j<jj^jqkT\@k<_kykLrbC UMG>7/' ֮~b_HA#(4 ޭ٭ϭʭƭidFB ,¬66T4t44|4U @Ź\7r,8hQ8L (7`6@/)6X ʶ\y@d9d9A`E-#p//?wϭ@8w$9wBо0w//`3wA 5w>wd:w`6wA 4wt|XO}@:@}$I},Fs}F~J|<_}/deprecated command -- use 'toggle crmod' insteaddeprecated command -- use 'set escape' instead<_A8EE""""}xspkg$ ~wi[M?4% {wrlfb^YTNHB=950+(standard output)/etc/gettytab\^:   }) 0/dev/ptyXXh  D |   ~ u4 ll c Z Q ?AGB|pbhCbcVdFEAf.lL FFin֠xѠ ŠhsZzqre{vtqoahUVuNV@H4w W  R  LX  HX  B  Ԟ $FreeBSD: src/lib/msun/src/s_ilogb.c,v 1.6 1999/08/28 00:06:49 peter Exp $\]^7ba_`c8V9Mdefg:U;J<H=>LhW?O@NiAB CD  !"#$%E &'()*+,-./F 0123456789G :;<=>?@ABCH D E F GIJKjkLMKNIOP[lmcnoQRpqRSrZstuvwxSyz{|}~TPUQVTWx[ ܎ `%%p%c%%{10}%%/%%{16}%%*%%p%c%%{10}%%m%%+@(#)history.c 8.1 (Berkeley) 6/4/93  #   (       D X @  "  8  "  P    , 0   ( 0   8 @ P H  D, . * ( <( 4. + / D/ ) ) |- . <+  . . T. + $) ̜  \ 4 p L T 0 p  P  x       ̘ ,  @ $ T  Л    D ̝ L  ( 4 Р 6FՙGI`9J DϘE8`89@ėOePO<SЖT:?mf6@$7ܕ<Õ>gU@XYՔ;Z`J= BAmRRCQ,MNhC@,HVW`K L'`G& 5ˏ,x-@0%Ύ)0`<4ݍ#|.@!1 (܌ƌ3/`32$ŋ*+`=(re N?  lj` @*߈c@"ڇ̇uYJ7(!  o@-؅ʅ`B ۄw@ ƃ1 ' ""   !,-5/"""""""""""""""""""""""""""""""$""""""""""""""""""""""""#&"0"""""."""""4"%""""""""#&"0""""".""""""4"%"""""""B=   !A;""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" "" """   !"A""""/""" """ """"""L"RZK"""Q"7I: UH""@""NG"PTWY"D"""" ""6J9<>C"? "M"F"OSVX"E"""""8""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""JB \ 8h1 O Vă c ? fwdbck:*ܡ١š¡yvfcSP85)&٠֠Ġ{xb_RO@='$ߟɟƟ}gdQN<9(~nkYVIF0-I[1~[4~OAOBOCOD+/@ڦӦ̦@@ڦӦ ̦a@ڦӦ̦ = =,A"'B" """"z t@nhc]WO IC=7 0)@# @ݧ֧ѧʧŧ@@  xmc[VQKFB> 9@2,'  @ @(#)tokenizer.c 8.1 (Berkeley) 6/4/93تm`H6%Xֹ¹   `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`??$FreeBSD: src/lib/libc/stdio/asprintf.c,v 1.6 1999/08/28 00:00:55 peter Exp $1 x[P4)     `C-"ysm g ` ~ztqgd ` ] U R E B 8 5 % " m !"#$%&z'i(W)N*D+>,7-*-#../ /0123456789:;<=>?@l[b\R\=]2^ ^_ _`{{|}}~/dev/une\Rh#4'@(#)getbsize.c 8.1 (Berkeley) 6/4/93|vpib^XR $OpenBSD: dirname.c,v 1.4 1999/05/30 17:10:30 espie Exp $,n4n\no p CCCCCCC  d""<@ @zlhW0[ d'@Bʚ;jc[SLECA?=:741( |741ypE$FreeBSD: src/lib/libc/net/ns_print.c,v 1.2 1999/08/28 00:00:15 peter Exp $$FreeBSD: src/lib/libc/net/ns_parse.c,v 1.3 1999/08/28 00:00:14 peter Exp $x   @ $FreeBSD: src/lib/libc/net/base64.c,v 1.4 1999/11/04 04:30:43 ache Exp $$FreeBSD: src/lib/libc/net/ns_ttl.c,v 1.2 1999/08/28 00:00:15 peter Exp $   08DLt@(#)localtime.c 7.57WILDABBR%%@(#)asctime.c 7.7$FreeBSD: src/lib/libc/net/ns_netint.c,v 1.2 1999/08/28 00:00:14 peter Exp $$FreeBSD: src/lib/libc/net/ns_name.c,v 1.2 1999/08/28 00:00:14 peter Exp $0123456789JKxKK`LL@MMP,QQQ4RHRtRP\QQQQ4RHRRPR|SRuneMagiNONE`ccBBBBB@(((((((((((((((          (((((((    ((((((    ((((  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~̹ 0000000000000000}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMD7yACnF?O8M20HwZ