fjQPS1Pjf1ɎَѼ|}r,g|uuƀrIᾋ}R1҉ 5w ޿))0duddu`ûDL Ss*}}0r4uRZr?tfFRff1fC0fZf=wD@(f8r^P[s Ot0FsF ^(Fw.yURAZoUd]BReadBoot error PUWEVfd1440P$@ ,WEV(i @ @ @ BTXP1мfjf9W_s uU}EEE Efh ( f"1ɱѱ8ٺ6 -)б3QPhj+5 QQQQRja 1f֐ юَH"1Ўػptr4!PP 栈!桰!桰!XX!j@j td>0tc>2tk> u~tEj$USm]]fEfE EfCe[]XPPPP`jr11t$PV^=1ɱ󥖋D$@t+rBR/=_D$HuKKf)8󥑉-w1)ثufȫd$aσuD$ `X6qtltŰ=Vtf\tGt3CRu fu6 Ж1t -t ^ u 뎪PXPX$< i/ u`1ɴPf 8cuf1< tPЀfBPr0ƀrf Pffa g ?`}9m)u int@errDeflPeipHeax4ebx(ecx0edx,esiediebp espcsLds es fsgssscs:eipHss:espBTX halted'00b1000h01 50Çl$EMU ]$PXE(PD$E,D$Xu0}4l$UWVS0 0 )*1Ҁ=*|** )@ *@0p0Tj1x0j%|0t01۾P00000tO00 ы0 у? C~h"vthh *P *= *t&Sh"h" S t1 *tH ,= ,u:u#j h"S j7u Su jh"S h ,*aP5**#*Ph"x #tt jZtw *jƃ u ttA, t"u" *vOj j 1"- *=}GtV uj 1h *t j h , UUWVSEP8u =0 URh#n j4EP8PEf= t=ELFh#h$#, }+00uS8R|E%uS8PUqE%EË0ډ0jEPS E܅PS8P!]jS8R3VS8PlE裘0Dž41f}t=1j \/S8R;u 4FE9} 4~11\/+0D/0t/S8P8T F~ŋE%Ë0ډ0UMA9DE죘0jP0Z=0tCPh"!.K:Sut @A:uu:kCÍ9rhS6߃t=0tj 1ۅ~:/uB 1u[^_US]Su u#9u1h#h$#V] UWVS]=*u}=)uh 7))jj5){u+hd5)h#=<)TthE#8$ )*u19)5)15$lj $#!=#=#15X$Ƌ @$> D$P5)f15X$`)5) )0))E E05h))9uvuUU6 0$0  <)k)9)tI=)uh )5) D$)P5)))C=T$):  C 0$ l)9wu;h)w5$5h)#5)5 )#5,$9=)t* P D$P5)S=)0#));uvuV)PMQu50)uEe[^_ UWVS=*U=)uhx)*jj5) )þ *ǃw=1ڀzu uw Fu t Fvڃ= *u *t#t\{t hN#C*j*@P5)(uy )9WEVu WEVt=*tihT#E=*ufyu ***9suhZ#h$#4#*u*E E Pue[^_ UWVS}u %Gst% ctut0xt+vvo^;tdPqC;uSEuuE F]1u#CȅuKE9rP&KE9sPGN1e[^_US] uj S]UVSuUM t ACJu[^ U=)u00%)У))U‰)UE000UWVS]} u##Phd#b000 0=0f0؃00 5*50k00u1W0Phh#e[^_ UVSu1jt l+0u9r9r1e[^US]#t(0%00#tS؋]US]#tjBt u&j3*#ttu t1]US]00!u 0 04[fRf fZBB--uf1ɵ@ tD$ f1$dafd wdad%s /boot.config%s: %s/boot/loader/kernel >> FreeBSD/i386 BOOT Default: %u:%s(%u,%c)%s boot: No %s formatInvalid %s yesnoKeyboard: %s Not ufs slicelabelpartition%cDisk error 0x%x (lba=0x%x) DhaCcdgPrsv  """""0123456789abcdef/|\- 08&:@   &:Wr%`w/mnt<@T 08&:@   &:Wr%`S}<@TU &:@ w( < h/~oLJfA&:&:&:;^A&:&:&: GշN&:&:&:K`j!&:&:&:-S!&:&:&:j74!&:&:&:YTk!&:&:&:?!&:&:&:t]T!&:&:&:t!&:&:&:t?!&:&:&:t@!&:&:&:t !&:&:&:te!&:&:&:t!&:&:&:t* !&:&:&:t+1c!&:&:&:t(3E!&:&:&:tL ]!&:&:&:u=4!&:&:&:u#!&:&:&:uo!&:&:&: u !&:&:&:vCm!&:&:&:v!&:&:&:vA+!&:&:&:vzUZ!&:&:&:v?R!&:&:&:vq"!&:&:&:vH]%S!&:&:&:v>^!&:&:&:v1F!&:&:&:vX!&:&:&:v}IA|!&:&:&:v+e!&:&:&:vL!&:&:&:wEeA!&:&:&:ws-1m!&:&:&:/F!&:&:&:S!&:&:&:! !&:&:&:!&:&:&:pCV!&:&:&:ԅ+!&:&:&:puj!&:&:&:pFq!&:&:&:Vz5!&:&:&:N!&:&:&:y7!&:&:&:0!&:&:&:ޒ!&:&:&:EP:,[!&:&:&:E=/!&:&:&:W!&:&:&:W I!&:&:&:Wu?!&:&:&:W >0!&:&:&:W]#!&:&:&:W7(!&:&:&:W1!&:&:&:W]v!&:&:&:Wu"^q!&:&:&:Ww!&:&:&:W]iO!&:&:&:Wkm!&:&:&:Wil\!&:&:&:ZEU!&:&:&:+/!&:&:&:+ۙ'J!&:&:&:+*#!&:&:&:+۴D!&:&:&:+jU!&:&:&:+!!&:&:&:+Jp !&:&:&:+?!&:&:&:+ !&:&:&:+ !&:&:&:+ ?6!&:&:&:+Z!&:&:&:+P0|D!&:&:&:^HI!&:&:&:ߟy]!&:&:&:j!&:&:&: Ay!&:&:&: y@c!&:&:&:1wh!&:&:&:c99!&:&:&:~!&:&:&:F !&:&:&:K!&:&:&:P.D!&:&:&:!&:&:&: .=!&:&:&: 9<!&:&:&: Q!&:&:&: z*!&:&:&:!&:&:&: !'!&:&:&: Y&:&:&:ttyv0|c!&:&:&:LDBD!&:&:&:܀BD!&:&:&:v$8BD!&:&:&:Ef!&:&:&:%9!&:&:&:*d9!&:&:&:Or!&:&:&:ާF!&:&:&:3o!&:&:&:FM!&:&:&:- !&:&:&:8!&:&:&:$x;+!&:&:&:B*!&:&:&::2!&:&:&:S!&:&:&:v!&:&:&:Stk!&:&:&:47L"!&:&:&:A!&:&:&:D7!&:&:&: eGg!&:&:&: "!&:&:&: ?st!&:&:&:  $!&:&:&: vt!&:&:&: A!&:&:&: \8=!&:&:&: ͘!&:&:&: ty!&:&:&: !!&:&:&:v`!&:&:&:!&:&:&:MZ!&:&:&:F!&:&:&:TQ!&:&:&:vz@!&:&:&:8!&:&:&:!&:&:&:!&:&:&:M̲!&:&:&:f#!&:&:&:<!&:&:&:pD1!&:&:&:M!&:&:&:E%o!&:&:&: A@!&:&:&:cQa!&:&:&:bZ!&:&:&:@4b!&:&:&:!&:&:&:B!&:&:&:ÙI!&:&:&:"!&:&:&:Q!&:&:&:~m!&:&:&:-!&:&:&:y%!&:&:&:+!&:&:&:U2!&:&:&:G!&:&:&:XM!&:&:&:ʫ !&:&:&:V6!&:&:&:(!&:&:&: Y!&:&:&:ʫ!&:&:&:qmA<!&:&:&: |!&:&:&:@&Y!&:&:&:p2@!&:&:&:H!&:&:&:濶B!&:&:&: }!&:&:&: FJ!&:&:&:qi!&:&:&:޹Al!&:&:&:RQ !&:&:&:iq!&:&:&:jF!&:&:&:om!&:&:&:4rBD!&:&:&:[_XE!&:&:&:RXX7!&:&:&:'f!&:&:&:'20 _!&:&:&:2 ;%!&:&:&:̠,!&:&:&:h!&:&:&:<P!&:&:&:7C_!&:&:&:;F#!&:&:&:;W?!&:&:&:8 ?r!&:&:&:@8{Y!&:&:&:9R@FA&:&:&:Km'`|!:|!:&:px`P pFIam &:&:&:2A&:&:&:D]A&:&:&:A&:&:&:ٽB&:&:&: vQ&:&:&:z_C&:&:&: Prh?&:&:&: 3OAA&:&:&:3TA&:&:&:P",A&:&:&:CLA&:&:&:FA&:&:&:?rA&:&:&:c9A&:&:&:~8A&:&:&:lKA&:&:&:eq$'&:&:&:(tN&:&:&:β*2Y{\xQ/ٻ@g3~ZaR/?VM@5,SK΄~ ACNvCrjDUm RPp.@&|%{0Wl ow4$&%Ur;2 &'͚sz%f2c<nNv #L6`Ih;C%)DtYx/b!*C?A&-0a"T\: $>CDA{({!c>qf=Ns 9M=X-,3oU0CHztay|ܣe0"Z|DqNmaH/,9fnkZR̹. Vgv"&ڥS'*AnunCh)pVE\Ji7 T霞u8=pI5X\[K@ZlNOмD|?WCg?<Eְ~nh:,gBHY]h;"C8~"1E\[RMQsI6St@Xw ...;; all) for i in $all do mknod $name$i c 66 `expr $offset + $i ` done ;; *) echo "No such LabPC unit: $unit" ;; esac umask 77 ;; perfmon) mknod perfmon c 2 32 root:kmem chmod 640 perfmon ;; ipl) mknod ipl c 79 0 mknod ipnat c 79 1 mknod ipstate c 79 2 mknod ipauth c 79 3 ;; kbd*) unit=`expr $i : 'kbd\(.*\)'` chr=112 mknod kbd$unit c $chr $unit ;; i4b) mknod i4b c 60 0 ;; i4bctl) mknod i4bctl c 55 0 ;; i4brbch*) unit=`expr $i : 'i4brbch\(.*\)'` mknod i4brbch$unit c 57 $unit ;; i4bteld*) offset=64 unit=`expr $i : 'i4bteld\(.*\)'` mknod i4bteld$unit c 56 `expr $offset + $unit ` ;; i4btel*) unit=`expr $i : 'i4btel\(.*\)'` mknod i4btel$unit c 56 $unit ;; i4btrc*) unit=`expr $i : 'i4btrc\(.*\)'` mknod i4btrc$unit c 59 $unit ;; mlx*) unit=`expr $i : 'mlx\(.*\)'` mknod mlx$unit c 130 $unit ;; agpgart) mknod agpgart c 148 0 ;; twe*) unit=`expr $i : 'twe\(.*\)'` mknod twe$unit c 146 $unit ;; tw*) unit=`expr $i : 'tw\(.*\)'` mknod tw$unit c 19 $unit root:operator ;; local) umask 0 # XXX should be elsewhere sh MAKEDEV.local umask 77 ;; *) echo $i - no such device name ;; esac done  . .. 00 10 20 30 40 50 60 70 80|90 ... . .. protocols0groupspwd.dbservices0 . .. devstand0 binsbin0 etc mntmnt10mnt20mnt30mnt40 tmp usr@.profile0: # $FreeBSD: src/release/fixit.profile,v 1.8 1999/08/28 01:33:10 peter Exp $ export BLOCKSIZE=K export PS1="Fixit# " export EDITOR="/mnt2/stand/vi" export PAGER="/mnt2/stand/more" export SCSI_MODES="/mnt2/usr/share/misc/scsi_modes" # the root MFS doesn't have /dev/nrsa0, pick a better default for mt(1) export TAPE=/mnt2/dev/nrsa0 alias ls="ls -F" alias ll="ls -l" alias m="more -e" echo '+---------------------------------------------------------------+' echo '| You are now running from a FreeBSD "fixit" floppy. |' echo '| ------------------------------------------------------------- |' echo "| When you're finished with this shell, please type exit. |" echo '| The fixit floppy itself is mounted as /mnt2. |' echo '| |' echo '| You might want to symlink /mnt/etc/*pwd.db and /mnt/etc/group |' echo '| to /etc after mounting a root filesystem from your disk. |' echo '| tar(1) will not restore all permissions correctly otherwise! |' echo '| |' echo '| Note: you might use the arrow keys to browse through the |' echo '| command history of this shell. |' echo '+---------------------------------------------------------------+' echo echo 'Good Luck!' echo # Make the arrow keys work; everybody will love this. set -o emacs 2>/dev/null cd / #!/bin/sh - # # Copyright (c) 1990 The Regents of the University of California. # All rights reserved. # # Written and contributed by W. Jolitz 12/90 # # Redistribution and use in source and binary forms are permitted provided # that: (1) source distributions retain this entire copyright notice and # comment, and (2) distributions including binaries display the following # acknowledgement: ``This product includes software developed by the # University of California, Berkeley and its contributors'' in the # documentation or other materials provided with the distribution and in # all advertising materials mentioning features or use of this software. # Neither the name of the University nor the names of its contributors may # be used to endorse or promote products derived from this software without # specific prior written permission. # THIS SOFTWARE IS PROVIDED ``AS IS'' AND WITHOUT ANY EXPRESS OR IMPLIED # WARRANTIES, INCLUDING, WITHOUT LIMITATION, THE IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. # # @(#)MAKEDEV 5.2 (Berkeley) 6/22/90 # $FreeBSD: src/etc/MAKEDEV,v 1.243.2.15 2000/11/07 11:02:04 truckman Exp $ # # Device "make" file. Valid arguments: # all makes all known devices, standard number of units (or close) # std standard devices # jail suitable for a jail(8) # local configuration specific devices # mach-4 mach4&lites+devices for Mach's XFree86 distribution # (see http://www.cs.hut.fi/lites.html for more info on LITES) # # Tapes: # wt* QIC-interfaced (e.g. not SCSI) 3M cartridge tape # sa* SCSI Sequential Access Devices # # Disks: # acd* ATAPI CD-ROM disks # amrd* AMI MegaRAID # cd* SCSI CD-ROM disks # da* SCSI Direct Access Devices # fd* floppy disk drives (3 1/2", 5 1/4") # fla* M-Systems DiskOnChip # idad* Compaq Smart-2 RAID arrays # matcd* Matsushita (Panasonic) CD-ROM disks # mcd* Mitsumi CD-ROM disks # md* Memory (or malloc) disk # mlx* Mylex DAC960 RAID controllers # mlxd* Mylex DAC960 RAID disk volumes # scd* Sony CD-ROM disks # vn* vnode disks # wd* "Winchester" disk drives (ST506,IDE,ESDI,RLL,...) # wfd* IDE floppy disk drives (LS-120) # # Console ports: # vty* virtual console devices for syscons/pcvt/codrv # # Pointing devices: # mse* Logitech and ATI Inport bus mouse # psm* PS/2 mouse # sysmouse Mousesystems mouse emulator for syscons # # Time devices: # refclock-* serial ports used by xntpd parse refclocks # # Terminal ports: # tty* general purpose serial ports # cua* dialout serial ports # ttyA* Specialix SI/XIO dialin ports ('*' = number of devices) # cuaA* Specialix SI/XIO dialout ports # ttyD* Digiboard - 16 dialin ports # cuaD* Digiboard - 16 dialout ports # ttyR* Rocketport dialin ports # cuaR* Rocketport dialout ports # # Pseudo terminals: # pty* set of 32 master and slave pseudo terminals # vty* virtual terminals using syscons/pcvt/codrv console # # Parallel port: # lpt* Printer # ppi* Parallel port i/o # pps* Pulse per second timing interface # pcfclock* Parallel time sync interface # # I2C and SMBus: # iic* I2C devices # smb* SMBUS devices # # USB devices: # usb* USB bus control device # ugen* generic USB device # uhid* Human Interface Device (HID) # ulpt* printer # umodem* modems # ums* mouse # urio* Diamond Rio 500 # uscanner* USB scanners # usio* USB serial devices # # SCSI devices (other than CD-ROM, tape and disk): # ch* SCSI Media-Changer (juke box) driver # worm* WORM driver # pt* Processor Type (HP scanner, as one example) # pass* CAM Passthrough device # ses* SES (SCSI Environmental Services) and # SAF-TE (Scsi Accessable Fault-Tolerant Enclosures) device # # PC-CARD (previously called PCMCIA) support # card* PC-CARD slots # # ISDN devices: # i4b isdnd call control device # i4bctl debugging control device # i4btrc* trace data interface(s), one per passive card # i4btel* telephony interface(s) # i4bteld* telephony dialout interface(s) # i4brbch* raw b channel access device(s) # # Special purpose devices: # apm Advanced Power Management BIOS # apmctl APM BIOS control device # bpf* packet filter # speaker pc speaker # tw* xten power controller # snd* various sound cards # pcaudio PCM audio driver # socksys iBCS2 socket system driver # vat VAT compatibility audio driver (requires snd*) # gsc Genius GS-4500 hand scanner # joy pc joystick # tun* Tunneling IP device # tap* Ethernet Tunneling device # snp* tty snoop devices # spigot Video Spigot video acquisition card # ctx* Cortex-I video acquisition card # meteor* Matrox Meteor video acquisition card (pci) # bktr* Bt848 based video acquisition card (pci) # labpc* National Instrument's Lab-PC and LAB-PC+ # perfmon CPU performance-monitoring counters # pci PCI configuration-space access from user mode # ipl ipfilter control devices (ipl, ipnat, ipstate, ipauth) # kbd keyboard devices # agpgart AGP interface # if [ -n "$MAKEDEVPATH" ]; then PATH="$MAKEDEVPATH" else PATH=/sbin:/bin fi umask 77 # Usage: die exitcode msg die() { echo $2 exit $1 } # Convert integer to partition name dkitop() { local p case $1 in 0) p=a;; 1) p=b;; 2) p=c;; 3) p=d;; 4) p=e;; 5) p=f;; 6) p=g;; 7) p=h;; *) p="?";; esac echo $p } # Convert integer to slice name dkitos() { local s case $1 in 0) s="";; 1) s="";; *) s=s$(($1-1));; esac echo $s } # Convert disk (type, unit, slice, partition) to minor number dkminor() { echo $(($1 << 25 | ($2 / 32) << 21 | ($2 % 32) << 3 | $3 << 16 | $4)) } # Override mknod(2) to add extra handling to it. mknod=/sbin/mknod for i in `IFS=':'; echo $PATH`; do if [ -x "${i}/mknod" ]; then mknod="${i}/mknod" break fi done mknod() { rm -f "$1" || exit 1 case $# in 4) "$mknod" "$@" root:wheel || die 2 "$mknod $@ failed";; 5) "$mknod" "$@" || die 2 "$mknod $@ failed";; *) die 2 "bad node: mknod $@";; esac } # Convert tape (ctrl, unit, mode, access) to minor number saminor() { echo $(($1 << 29 | ($2 / 16) << 16 | ($2 % 16) << 4 | $3 << 2 | $4)) } # Convert the last character of a tty name to a minor number. ttyminor() { case $unit in [0-9]) m=$unit;; a) m=10;; b) m=11;; c) m=12;; d) m=13;; e) m=14;; f) m=15;; g) m=16;; h) m=17;; i) m=18;; j) m=19;; k) m=20;; l) m=21;; m) m=22;; n) m=23;; o) m=24;; p) m=25;; q) m=26;; r) m=27;; s) m=28;; t) m=29;; u) m=30;; v) m=31;; *) m="?";; esac echo $m } # Raw partition for disks dkrawpart=2 # Compatibility slice for disks dkcompatslice=0 # Raw slice for disks dkrawslice=1 # Standard umasks disk_umask=037 # allow group operator to read disks tape_umask=017 # allow group operator to read/write tapes for i in $*; do case $i in all) sh MAKEDEV std # standard sh MAKEDEV fd0 fd1 # bdev, floppy disk sh MAKEDEV da0 da1 da2 da3 # bdev, SCSI disk sh MAKEDEV ad0 ad1 ad2 ad3 # bdev, ATA disk sh MAKEDEV ar0 ar1 # bdev, ATA RAID disk sh MAKEDEV acd0 afd0 ast0 # bdev, ATAPI devices sh MAKEDEV wd0 wd1 wd2 wd3 # bdev, OLD disk sh MAKEDEV wcd0 wfd0 wst0 # bdev, OLD ATAPI devs sh MAKEDEV vn0 # bdev, virtual disk sh MAKEDEV cd0 matcd0 mcd0 scd0 # bdev, cdrom sh MAKEDEV sa0 wt0 # bdev, tape sh MAKEDEV vty12 # cdev, virtual tty sh MAKEDEV cuaa0 cuaa1 cuaa2 cuaa3 # cdev, serial tty sh MAKEDEV pty0 # cdev, pseudo tty sh MAKEDEV ttyd0 ttyd1 ttyd2 ttyd3 # cdev, serial tty sh MAKEDEV kbd0 kbd1 # cdev, keyboard sh MAKEDEV mse0 psm0 sysmouse # cdev, mouse sh MAKEDEV pcaudio speaker # cdev, noise sh MAKEDEV lpt0 lpt1 lpt2 # cdev, printer sh MAKEDEV ppi0 ppi1 ppi2 # cdev, parallel port sh MAKEDEV iic0 iic1 # cdev, I2C device sh MAKEDEV smb0 smb1 # cdev, SMBus device sh MAKEDEV usb usb0 uhid0 ums0 ulpt0 ugen0 # cdev, USB devices sh MAKEDEV urio0 uscanner0 umodem0 # cdev, USB devices too sh MAKEDEV bpf0 bpf1 bpf2 bpf3 # cdev, network sh MAKEDEV ipl tun0 tun1 tun2 tun3 # cdev, network sh MAKEDEV tap0 tap1 tap2 tap3 # cdev, network sh MAKEDEV ch0 perfmon tw0 # cdev, miscellaneous sh MAKEDEV apm apmctl card0 card1 card2 card3 # cdev, laptop sh MAKEDEV pass4 xpt2 # cdev, CAM sh MAKEDEV i4b i4bctl i4btrc0 i4btrc1 # cdev, ISDN sh MAKEDEV i4btel0 i4btel1 i4bteld0 i4bteld1 # cdev, ISDN sh MAKEDEV i4brbch0 i4brbch1 # cdev, ISDN sh MAKEDEV agpgart # cdev, AGP ;; # a much restricted set of the above, to save precious i-nodes on the # fixit floppy fixit) sh MAKEDEV std # standard sh MAKEDEV fd0 # bdev, floppy disk sh MAKEDEV da0 # bdev, SCSI disk sh MAKEDEV ad0 # bdev, ATA disk sh MAKEDEV acd0 afd0 ast0 # bdev, ATAPI devices sh MAKEDEV wd0 # bdev, OLD disk sh MAKEDEV wcd0 wfd0 wst0 # bdev, OLD ATAPI devs sh MAKEDEV vn0 # bdev, virtual disk sh MAKEDEV cd0 # bdev, cdrom sh MAKEDEV sa0 # bdev, tape sh MAKEDEV vty2 # cdev, virtual tty sh MAKEDEV cuaa0 # cdev, serial tty sh MAKEDEV pty0 # cdev, pseudo tty sh MAKEDEV ttyd0 # cdev, serial tty sh MAKEDEV kbd0 # cdev, keyboard sh MAKEDEV mse0 psm0 sysmouse # cdev, mouse sh MAKEDEV lpt0 # cdev, printer sh MAKEDEV ppi0 # cdev, parallel port sh MAKEDEV iic0 # cdev, I2C device sh MAKEDEV smb0 # cdev, SMBus device sh MAKEDEV ums0 # cdev, USB devices sh MAKEDEV tun0 # cdev, network sh MAKEDEV tap0 # cdev, network sh MAKEDEV ch0 # cdev, miscellaneous sh MAKEDEV apm apmctl card0 # cdev, laptop sh MAKEDEV pass1 xpt1 # cdev, CAM sh MAKEDEV i4b i4bctl i4btrc0 i4btrc1 # cdev, ISDN sh MAKEDEV i4btel0 i4bteld0 # cdev, ISDN sh MAKEDEV i4brbch0 # cdev, ISDN rm -f fd/[1-9]? ;; std) mknod console c 0 0; chmod 600 console mknod kmem c 2 1 root:kmem; chmod 640 kmem mknod mem c 2 0 root:kmem; chmod 640 mem mknod null c 2 2; chmod 666 null mknod random c 2 3; chmod 644 random mknod urandom c 2 4; chmod 644 urandom mknod zero c 2 12; chmod 666 zero mknod io c 2 14; chmod 600 io mknod tty c 1 0; chmod 666 tty mknod klog c 7 0; chmod 600 klog mknod stdin c 22 0; chmod 666 stdin mknod stdout c 22 1; chmod 666 stdout mknod stderr c 22 2; chmod 666 stderr mknod pci c 78 0; chmod 644 pci mkdir -p fd (cd fd && i=0 && while [ $i -lt 64 ]; do mknod $i c 22 $i i=$(($i + 1)) done ) chmod 555 fd chmod 666 fd/* ;; jail) sh MAKEDEV std pty0 rm mem kmem pci io klog console # for security ln -sf null mem # for libkvm (ab)users ln -sf null kmem # --//-- ln -sf null console ;; mach-4) mknod iopl c 22 0 mknod kbd c 23 0 mknod mouse c 24 0 mknod time c 25 0 mknod timezone c 26 0 ;; # Create device files for new Archive/Wangtek QIC-02 tape driver (vak) wt*) umask $tape_umask u=`expr $i : '..\(.*\)'` if [ -z "${u}" ]; then u=0; fi # default density, 512b blocks mknod rwt${u} c 10 `expr 0 + $u` root:operator mknod nrwt${u} c 10 `expr 4 + $u` root:operator # default density, 1024b blocks # mknod rWt${u} c 10 `expr 64 + $u` root:operator # mknod nrWt${u} c 10 `expr 68 + $u` root:operator mknod rwt${u}b c 10 `expr 16 + $u` root:operator # 60 megabytes mknod nrwt${u}b c 10 `expr 20 + $u` root:operator mknod rwt${u}c c 10 `expr 24 + $u` root:operator # 120 megabytes mknod nrwt${u}c c 10 `expr 28 + $u` root:operator mknod rwt${u}d c 10 `expr 32 + $u` root:operator # 150 megabytes mknod nrwt${u}d c 10 `expr 36 + $u` root:operator # mknod rwt${u}e c 10 `expr 40 + $u` root:operator # 300 megabytes? # mknod nrwt${u}e c 10 `expr 44 + $u` root:operator # mknod rwt${u}f c 10 `expr 48 + $u` root:operator # 600 megabytes? # mknod nrwt${u}f c 10 `expr 52 + $u` root:operator umask 77 ;; # Individual slices. ad*s*|ar*s*|afd*s*|amrd*s*|da*s*|fla*s*|idad*s*|md*s*|mlxd*s*|twed*s*|vn*s*|wd*s*|wfd*s*) umask $disk_umask case $i in ad*s*) name=ad; chr=116;; ar*s*) name=ar; chr=157;; afd*s*) name=afd; chr=118;; amrd*s*) name=amrd; chr=133;; da*s*) name=da; chr=13;; fla*s*) name=fla; chr=102;; idad*s*) name=idad; chr=109;; md*s*) name=md; chr=95;; mlxd*s*) name=mlxd; chr=131;; twed*s*) name=twed; chr=147;; vn*s*) name=vn; chr=43;; wd*s*) name=wd; chr=3;; wfd*s*) name=wfd; chr=87;; esac case $i in amrd*s*|idad*s*|mlxd*s*|twed*s*) unit=`expr $i : '....\([0-9]*\)s'` slice=`expr $i : '....[0-9]*s\([0-9]*\)'` part=`expr $i : '....[0-9]*s[0-9]*\(.*\)'` ;; afd*s*|fla*s*|wfd*s*) unit=`expr $i : '...\([0-9]*\)s'` slice=`expr $i : '...[0-9]*s\([0-9]*\)'` part=`expr $i : '...[0-9]*s[0-9]*\(.*\)'` ;; *) unit=`expr $i : '..\([0-9]*\)s'` slice=`expr $i : '..[0-9]*s\([0-9]*\)'` part=`expr $i : '..[0-9]*s[0-9]*\(.*\)'` ;; esac case $unit in [0-9]|[0-9][0-9]|[0-4][0-9][0-9]|50[0-9]|51[0-1]) case $slice in [0-9]|[1-2][0-9]|30) oldslice=$slice slice=$(($slice+1)) slicename=`dkitos $slice` minor=`dkminor 0 $unit $slice $dkrawpart` mknod $name$unit$slicename c $chr $minor root:operator ln -f $name$unit$slicename r$name$unit$slicename case $part in [a-h]) case $oldslice in 0) slice=$oldslice ;; esac for part in 0 1 2 3 4 5 6 7 do minor=`dkminor 0 $unit $slice $part` partname=`dkitop $part` mknod $name$unit$slicename$partname \ c $chr $minor root:operator ln -f $name$unit$slicename$partname \ r$name$unit$slicename$partname done ;; "") ;; *) echo bad partition for disk in: $i ;; esac ;; *) echo bad slice for disk in: $i ;; esac ;; *) echo bad unit for disk in: $i "(unit=$unit, slice=$slice, part=$part)" ;; esac umask 77 ;; fd*) umask $disk_umask unit=`expr $i : '..\(.*\)'` name=fd; chr=9 case $unit in 0|1|2|3) mknod ${name}${unit} c $chr `expr $unit '*' 64` root:operator ln -f ${name}${unit} r${name}${unit} # Fake BSD partitions for i in a b c d e f g h do ln -f ${name}${unit} ${name}${unit}$i ln -f r${name}${unit} r${name}${unit}$i done # User-readable and programmer-readable name sets mknod ${name}${unit}.1720 c $chr `expr $unit '*' 64 + 1` \ root:operator ln -f ${name}${unit}.1720 r${name}${unit}.1720 # ln -f ${name}${unit}.1720 ${name}${unit}135hs21 # ln -f r${name}${unit}.1720 r${name}${unit}135hs21 mknod ${name}${unit}.1480 c $chr `expr $unit '*' 64 + 2` \ root:operator ln -f ${name}${unit}.1480 r${name}${unit}.1480 # ln -f ${name}${unit}.1480 ${name}${unit}135hs18 # ln -f r${name}${unit}.1480 r${name}${unit}135hs18 # ln -f ${name}${unit}.1480 ${name}${unit}96hs18 # ln -f r${name}${unit}.1480 r${name}${unit}96hs18 mknod ${name}${unit}.1440 c $chr `expr $unit '*' 64 + 3` \ root:operator ln -f ${name}${unit}.1440 r${name}${unit}.1440 # ln -f ${name}${unit}.1440 ${name}${unit}135 # ln -f r${name}${unit}.1440 r${name}${unit}135 # ln -f ${name}${unit}.1440 ${name}${unit}135ds18 # ln -f r${name}${unit}.1440 r${name}${unit}135ds18 # ln -f ${name}${unit}.1440 ${name}${unit}96ds18 # ln -f r${name}${unit}.1440 r${name}${unit}96ds18 mknod ${name}${unit}.1200 c $chr `expr $unit '*' 64 + 4` \ root:operator ln -f ${name}${unit}.1200 r${name}${unit}.1200 # ln -f ${name}${unit}.1200 ${name}${unit}96 # ln -f r${name}${unit}.1200 r${name}${unit}96 # ln -f ${name}${unit}.1200 ${name}${unit}96ds15 # ln -f r${name}${unit}.1200 r${name}${unit}96ds15 # ln -f ${name}${unit}.1200 ${name}${unit}135ds15 # ln -f r${name}${unit}.1200 r${name}${unit}135ds15 mknod ${name}${unit}.820 c $chr `expr $unit '*' 64 + 5` \ root:operator ln -f ${name}${unit}.820 r${name}${unit}.820 # ln -f ${name}${unit}.820 ${name}${unit}96hs10 # ln -f r${name}${unit}.820 r${name}${unit}96hs10 # ln -f ${name}${unit}.820 ${name}${unit}135hs10 # ln -f r${name}${unit}.820 r${name}${unit}135hs10 mknod ${name}${unit}.800 c $chr `expr $unit '*' 64 + 6` \ root:operator ln -f ${name}${unit}.800 r${name}${unit}.800 # ln -f ${name}${unit}.800 ${name}${unit}96ds10 # ln -f r${name}${unit}.800 r${name}${unit}96ds10 # ln -f ${name}${unit}.800 ${name}${unit}135ds10 # ln -f r${name}${unit}.800 r${name}${unit}135ds10 mknod ${name}${unit}.720 c $chr `expr $unit '*' 64 + 7` \ root:operator ln -f ${name}${unit}.720 r${name}${unit}.720 # ln -f ${name}${unit}.720 ${name}${unit}96ds9 # ln -f r${name}${unit}.720 r${name}${unit}96ds9 # ln -f ${name}${unit}.720 ${name}${unit}135ds9 # ln -f r${name}${unit}.720 r${name}${unit}135ds9 mknod ${name}${unit}.360 c $chr `expr $unit '*' 64 + 8` \ root:operator ln -f ${name}${unit}.360 r${name}${unit}.360 # ln -f ${name}${unit}.360 ${name}${unit}48 # ln -f r${name}${unit}.360 r${name}${unit}48 # ln -f ${name}${unit}.360 ${name}${unit}48ds9 # ln -f r${name}${unit}.360 r${name}${unit}48ds9 mknod ${name}${unit}.640 c $chr `expr $unit '*' 64 + 9` \ root:operator ln -f ${name}${unit}.640 r${name}${unit}.640 # ln -f ${name}${unit}.640 ${name}${unit}96ds8 # ln -f r${name}${unit}.640 r${name}${unit}96ds8 # ln -f ${name}${unit}.640 ${name}${unit}135ds8 # ln -f r${name}${unit}.640 r${name}${unit}135ds8 mknod ${name}${unit}.1232 c $chr `expr $unit '*' 64 + 10` \ root:operator ln -f ${name}${unit}.1232 r${name}${unit}.1232 # ln -f ${name}${unit}.1232 ${name}${unit}96ds8 # ln -f r${name}${unit}.1232 r${name}${unit}96ds8 # ln -f ${name}${unit}.1232 ${name}${unit}135ds8 # ln -f r${name}${unit}.1232 r${name}${unit}135ds8 ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; ad*|ar*|afd*|amrd*|da*|fla*|idad*|md*|mlxd*|twed*|vn*|wd*|wfd*) umask $disk_umask case $i in ad*) name=ad; chr=116;; ar*) name=ar; chr=157;; afd*) name=afd; chr=118;; amrd*) name=amrd; chr=133;; da*) name=da; chr=13;; fla*) name=fla; chr=102;; idad*) name=idad; chr=109;; md*) name=md; chr=95;; mlxd*) name=mlxd; chr=131;; twed*) name=twed; chr=147;; vn*) name=vn; chr=43;; wd*) name=wd; chr=3;; wfd*) name=wfd; chr=87;; esac case $i in amrd*|idad*|mlxd*|twed*) unit=`expr $i : '....\(.*\)'` ;; afd*|fla*|wfd*) unit=`expr $i : '...\(.*\)'` ;; *) unit=`expr $i : '..\(.*\)'` ;; esac case $unit in [0-9]|[0-9][0-9]|[0-4][0-9][0-9]|50[0-9]|51[0-1]) for slicepartname in s0h s1 s2 s3 s4 do sh MAKEDEV $name$unit$slicepartname done ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; ccd*) umask $disk_umask name=ccd chr=74 unit=`expr $i : '...\(.*\)'` case $unit in [0-9]|[0-9][0-9]|[0-4][0-9][0-9]|50[0-9]|51[0-1]) for part in 0 1 2 3 4 5 6 7 do minor=`dkminor 0 $unit 0 $part` partname=`dkitop $part` mknod $name$unit$partname c $chr $minor root:operator ln -f $name$unit$partname r$name$unit$partname done ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; # SCSI processor type driver pt[0-9]*) chr=61 name=pt unit=`expr $i : 'pt\([0-9][0-9]*\)'` if [ -z "${unit}" ]; then unit=0 fi unit=`expr $unit + 1 - 1` mknod ${name}${unit} c $chr $unit ;; # SCSI SES/SAF-TE type driver ses[0-9]*) chr=110 name=ses unit=`expr $i : 'ses\([0-9][0-9]*\)'` if [ -z "${unit}" ]; then unit=0 fi unit=`expr $unit + 1 - 1` mknod ${name}${unit} c $chr $unit ;; # SCSI target mode sample driver targ[0-9]*) chr=65 name=targ unit=`expr $i : 'targ\([0-9][0-9]*\)'` if [ -z "${unit}" ]; then unit=0 fi unit=`expr $unit + 1 - 1` mknod ${name}${unit} c $chr $unit mknod ${name}.ctl c $chr 0xffff00ff ;; # CAM transport layer device xpt*) # This major number is temporary chr=104 name=xpt units=`expr $i : 'xpt\(.*\)'` if [ -z "${units}" ]; then units=1 fi i=0 while [ $i -lt $units ]; do dname=$name$i rm -rf $dname r$dname mknod $dname c $chr $i root:operator i=$(($i + 1)) done ;; # CAM passthrough device pass*) # This major number is temporary chr=31 name=pass units=`expr $i : 'pass\(.*\)'` if [ -z "${units}" ]; then units=1 fi i=0 while [ $i -lt $units ]; do dname=$name$i rm -rf $dname r$dname mknod $dname c $chr $i root:operator i=$(($i + 1)) done ;; pty*) class=`expr $i : 'pty\(.*\)'` case $class in 0) offset=0 name=p;; 1) offset=32 name=q;; 2) offset=64 name=r;; 3) offset=96 name=s;; # Note that xterm (at least) only look at p-s. 4) offset=128 name=P;; 5) offset=160 name=Q;; 6) offset=192 name=R;; 7) offset=224 name=S;; # This still leaves [tuTU]. *) echo bad unit for pty in: $i;; esac umask 0 case $class in 0|1|2|3|4|5|6|7) i=0 while [ $i -lt 32 ]; do # This was an awk substr() before. c=$(echo 0123456789abcdefghijklmnopqrstuv | dd bs=1 skip=$i count=1 2>/dev/null) mknod tty$name$c c 5 $(($offset + $i)) mknod pty$name$c c 6 $(($offset + $i)) i=$(($i + 1)) done ;; esac umask 77 ;; sa*) umask $tape_umask unit=`expr $i : '..\(.*\)'` chr=14 case $unit in [0-9]|[1-9][0-9]|[1-9][0-9][0-9]|[1-9][0-9][0-9][0-9]) mknod sa${unit}.ctl c $chr `saminor 1 ${unit} 0 0` ln -f sa${unit}.ctl rsa${unit}.ctl for m in 0 1 2 3 do mknod sa${unit}.${m} c $chr \ `saminor 0 ${unit} ${m} 0` root:operator ln -f sa${unit}.${m} rsa${unit}.${m} mknod nsa${unit}.${m} c $chr \ `saminor 0 ${unit} ${m} 1` root:operator ln -f nsa${unit}.${m} nrsa${unit}.${m} mknod esa${unit}.${m} c $chr \ `saminor 0 ${unit} ${m} 2` root:operator ln -f esa${unit}.${m} ersa${unit}.${m} done ln -f sa${unit}.0 sa${unit} ln -f sa${unit}.0 rsa${unit}.0 ln -f sa${unit}.0 rsa${unit} ln -f nsa${unit}.0 nsa${unit} ln -f nsa${unit}.0 nrsa${unit}.0 ln -f nsa${unit}.0 nrsa${unit} ln -f esa${unit}.0 esa${unit} ln -f esa${unit}.0 ersa${unit}.0 ln -f esa${unit}.0 ersa${unit} ;; *) echo bad unit for tape in: $i ;; esac umask 77 ;; ch*) umask 37 unit=`expr $i : '..\(.*\)'` case $i in ch*) name=ch; chr=17;; esac case $unit in 0|1|2|3|4|5|6) mknod ${name}${unit} c $chr $unit root:operator ;; *) echo bad unit for media changer in: $i ;; esac umask 77 ;; ast*) umask 2 ; unit=`expr $i : '...\(.*\)'` chr=119 case $unit in 0|1|2|3) mknod rast${unit} c $chr `expr $unit '*' 8 + 0` root:operator chmod 640 rast${unit} mknod nrast${unit} c $chr `expr $unit '*' 8 + 1` root:operator chmod 640 nrast${unit} ;; *) echo bad unit for tape in: $i ;; esac umask 77 ;; acd*|cd*|mcd*|scd*) umask $disk_umask case $i in acd*) units=`expr $i : '...\(.*\)'`; name=acd; chr=117;; cd*) units=`expr $i : '..\(.*\)'`; name=cd; chr=15;; mcd*) units=`expr $i : '...\(.*\)'`; name=mcd; chr=29;; scd*) units=`expr $i : '...\(.*\)'`; name=scd; chr=45;; esac if [ -z "${units}" -o "${units}" -le 0 ]; then units=1 fi if [ "${units}" -le 31 ]; then i=0 while [ $i -le $units ]; do dname=$name$i rm -rf ${dname}* r${dname}* mknod ${dname}a c $chr $(($i * 8)) root:operator mknod ${dname}c c $chr $(($i * 8 + 2)) root:operator ln -f ${dname}a r${dname}a ln -f ${dname}c r${dname}c i=$(($i + 1)) done else echo "$i is invalid -- can't have more than 32 cd devices" fi umask 77 ;; matcd*) umask 2 case $i in matcd*) unit=`expr $i : '.....\(.*\)'`; name=matcd; chr=46;; esac case $unit in 0|1|2|3|4|5|6|7|8|9|10|11|12|13|14|15) mknod ${name}${unit}a c $chr `expr $unit '*' 8 + 0` \ root:operator mknod ${name}${unit}c c $chr `expr $unit '*' 8 + 2` \ root:operator ln -f ${name}${unit}a r${name}${unit}a ln -f ${name}${unit}c r${name}${unit}c chmod 640 ${name}${unit}[a-h] r${name}${unit}[a-h] mknod ${name}${unit}la c $chr `expr $unit '*' 8 + 128` \ root:operator mknod ${name}${unit}lc c $chr `expr $unit '*' 8 + 130` \ root:operator ln -f ${name}${unit}la r${name}${unit}la ln -f ${name}${unit}lc r${name}${unit}lc chmod 640 ${name}${unit}l[a-h] r${name}${unit}l[a-h] ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; wcd*) umask 2 ; unit=`expr $i : '...\(.*\)'` chr=69 case $unit in 0|1|2|3|4|5|6|7) mknod wcd${unit}a c $chr `expr $unit '*' 8 + 0` root:operator mknod wcd${unit}c c $chr `expr $unit '*' 8 + 2` root:operator ln -f wcd${unit}a rwcd${unit}a ln -f wcd${unit}c rwcd${unit}c chmod 640 wcd${unit}[a-h] rwcd${unit}[a-h] ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; wst*) umask 2 ; unit=`expr $i : '...\(.*\)'` chr=90 case $unit in 0|1|2|3) mknod rwst${unit} c $chr `expr $unit '*' 8 + 0` root:operator chmod 640 rwst${unit} ;; esac umask 77 ;; iic*) unit=`expr $i : 'iic\(.*\)'` mknod iic$unit c 105 $unit ;; smb*) unit=`expr $i : 'smb\(.*\)'` mknod smb$unit c 106 $unit ;; pcfclock*) unit=`expr $i : 'pcfclock\(.*\)'` mknod pcfclock$unit c 140 $unit ;; ppi*) unit=`expr $i : 'ppi\(.*\)'` mknod ppi$unit c 82 $unit ;; pps*) unit=`expr $i : 'pps\(.*\)'` mknod pps$unit c 89 $unit ;; usb) mknod usb$unit c 108 255 root:operator chmod 0660 usb$unit ;; usb*) unit=`expr $i : 'usb\(.*\)'` mknod usb$unit c 108 $unit root:operator chmod 0660 usb$unit ;; uhid*) unit=`expr $i : 'uhid\(.*\)'` mknod uhid$unit c 122 $unit ;; ums*) unit=`expr $i : 'ums\(.*\)'` mknod ums$unit c 111 $unit ;; ulpt*) unit=`expr $i : 'ulpt\(.*\)'` minor=$unit mknod ulpt$unit c 113 $minor minor=`expr $unit + 64` mknod unlpt$unit c 113 $minor # and the 'no prime' version ;; ugen*) unit=`expr $i : 'ugen\([0-9][0-9]*\)'` endpoint=`expr $i : 'ugen.*\.\([0-9][0-9]*\)'` if [ -z "${unit}" ]; then echo $i - Invalid unit number fi if [ -z "${endpoint}" ]; then # ugen0 & ugen0.1 - ugen0.15 mknod ugen$unit c 114 $(($unit * 16)) i=1 while [ $i -lt 16 ]; do mknod ugen$unit.$i c 114 $(($unit * 16 + $i)) i=$(($i + 1)) done else minor=$(($unit * 16 + $endpoint)) mknod ugen$unit.$endpoint c 114 $minor fi ;; urio*) unit=`expr $i : 'urio\(.*\)'` mknod urio$unit c 143 $unit ;; usio*) unit=`expr $i : 'usio\(.*\)'` minor=$(($unit + 128)) mknod usio$unit c 138 $minor ;; uscanner*) unit=`expr $i : 'uscanner\(.*\)'` mknod uscanner$unit c 156 $unit ;; umodem*) unit=`expr $i : 'umodem\(.*\)'` mknod umodem$unit c 124 $unit ;; lpt*) unit=`expr $i : 'lpt\(.*\)'` mknod lpt$unit c 16 $unit mknod lpctl$unit c 16 `expr $unit + 128` ;; # Use this to create virtual consoles for syscons, pcvt or codrv # ttyv0-b # use as MAKEDEV vtyNN to create NN entries vty*) chr=12 units=`expr $i : 'vty\(.*\)'` i=0 while [ $i -lt $units ]; do mknod ttyv$(printf %01x $i) c $chr $i i=$(($i + 1)) done ln -fs ttyv0 vga # XXX X still needs this pccons relic ;; bpf*) nbpf=`expr $i : 'bpf\(.*\)$'` unit=0 while [ $unit -le $nbpf ]; do mknod bpf$unit c 23 $unit unit=$(($unit + 1)) done ;; speaker) mknod speaker c 26 0 ;; cuaa?|cua?) umask 7 unit=`expr $i : 'cua.*\(.\)$'` m=`ttyminor $unit` mknod cuaa$unit c 28 `expr $m + 128` uucp:dialer mknod cuaia$unit c 28 `expr $m + 32 + 128` uucp:dialer mknod cuala$unit c 28 `expr $m + 64 + 128` uucp:dialer umask 77 ;; tty0?|ttyd?|tty?) unit=`expr $i : 'tty.*\(.\)$'` m=`ttyminor $unit` mknod ttyd$unit c 28 $m mknod ttyid$unit c 28 `expr $m + 32` mknod ttyld$unit c 28 `expr $m + 64` ;; cuac?) umask 7 portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q r s t u v" major=48 card=`expr $i : 'cua.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=`expr $card \* 65536 + $minor` name=$card$unit mknod cuac$name c $major `expr $minor + 128` uucp:dialer mknod cuaic$name c $major `expr $minor + 32 + 128` uucp:dialer mknod cualc$name c $major `expr $minor + 64 + 128` uucp:dialer done umask 77 ;; ttyc?) portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q r s t u v" major=48 card=`expr $i : 'tty.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=`expr $card \* 65536 + $minor` name=$card$unit mknod ttyc$name c $major $minor mknod ttyic$name c $major `expr $minor + 32` mknod ttylc$name c $major `expr $minor + 64` done ;; # RISCom8 'rc' driver entries cuam?) umask 7 unit=`expr $i : 'cua.*\(.\)$'` m=`ttyminor $unit` mknod cuam$unit c 63 `expr $m + 128` uucp:dialer umask 77 ;; ttym?) unit=`expr $i : 'tty.*\(.\)$'` m=`ttyminor $unit` mknod ttym$unit c 63 $m ;; # Specialix SI/XIO. # Note: these are 'base 1' to match the numbers on the panels, and to match # the manual that comes with the system. ttyA*) major=68 nports=`expr $i : 'ttyA\(.*\)$'` port=1 while [ $port -le $nports ]; do minor=$(expr $port - 1) name=$(printf %02d $port) mknod ttyA$name c $major $minor mknod ttyiA$name c $major `expr $minor + 65536` mknod ttylA$name c $major `expr $minor + 131072` port=$(($port + 1)) done # For the user-mode control program, 'sicontrol' mknod si_control c 68 262144 ;; cuaA*) umask 7 major=68 nports=`expr $i : 'cuaA\(.*\)$'` port=1 while [ $port -le $nports ]; do minor=$(expr $port - 1) name=$(printf %02d $port) mknod cuaA$name c $major `expr $minor + 128` uucp:dialer mknod cuaiA$name c $major `expr $minor + 128 + 65536` \ uucp:dialer mknod cualA$name c $major `expr $minor + 128 + 131072` \ uucp:dialer port=$(($port + 1)) done umask 77 ;; # Digiboard PC/?? 16 port card. # The current scheme of minor numbering is: # # unused{14} CARD{2} major{8} CALLOUT{1} LOCK{1} INIT{1} PORT{5} # # CARD bitfield in future versions may be extended to 3 bits. # # See dgb(4) # ttyD?) portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" major=58 card=`expr $i : 'tty.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=`expr $card \* 65536 + $minor` name=$card$unit mknod ttyD$name c $major $minor mknod ttyiD$name c $major `expr $minor + 32` mknod ttylD$name c $major `expr $minor + 64` done ;; cuaD?) umask 7 portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" major=58 card=`expr $i : 'cua.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=`expr $card \* 65536 + $minor` name=$card$unit mknod cuaD$name c $major `expr $minor + 128` uucp:dialer mknod cuaiD$name c $major `expr $minor + 32 + 128` uucp:dialer mknod cualD$name c $major `expr $minor + 64 + 128` uucp:dialer done umask 77 ;; ttyM*) portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" modulelist="a b c d" major=101 card=`expr $i : 'tty.*\(.\)$'` for unit in $modulelist do moduleminor=`ttyminor $unit` moduleminor=`expr $moduleminor % 10 \* 16` modulename=$unit for unit in $portlist do minor=`ttyminor $unit` minor=`expr $card \* 65536 + $minor + $moduleminor` name=$card$modulename$unit rm -f tty*M$name mknod ttyM$name c $major $minor mknod ttyiM$name c $major `expr $minor + 64` mknod ttylM$name c $major `expr $minor + 128` done done ;; cuaM?) umask 7 portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" modulelist="a b c d" major=101 card=`expr $i : 'cua.*\(.\)$'` for unit in $modulelist do moduleminor=`ttyminor $unit` moduleminor=`expr $moduleminor % 10 \* 16` modulename=$unit for unit in $portlist do minor=`ttyminor $unit` minor=`expr $card \* 65536 + $minor + $moduleminor` name=$card$modulename$unit rm -f cua*M$name mknod cuaM$name c $major `expr $minor + 262144` \ uucp:dialer mknod cuaiM$name c $major `expr $minor + 64 + 262144` \ uucp:dialer mknod cualM$name c $major `expr $minor + 128 + 262144` \ uucp:dialer done done umask 77 ;; ttyR?) major=81 BOARD=1; Rnum=0 MINOR=$(($BOARD * 65536)) controllers=$( dmesg | while read first rest; do case "$first" in RocketPort[0-4]) echo "$first" ;; esac done ) rm -f /dev/ttyR* /dev/ttyiR* /dev/ttylR* for i in $controllers; do ndevices=$( dmesg | while read first bar ports rest; do case "$first" in $i*) echo "$ports" ;; esac done ) echo -n "Creating $ndevices devices for $i: " dev=0 while [ $dev -lt $ndevices ]; do mknod /dev/ttyR$Rnum c $major $MINOR mknod /dev/ttyiR$Rnum c $major $(($MINOR + 32)) mknod /dev/ttylR$Rnum c $major $(($MINOR + 64)) Rnum=$(($Rnum + 1)) MINOR=$(($MINOR + 1)) dev=$(($dev + 1)) done BOARD=$(($BOARD + 1)) MINOR=$(($BOARD * 65536)) echo " " done ;; cuaR?) major=81 BOARD=1; Rnum=0 MINOR=$(($BOARD * 65536)) controllers=$( dmesg | while read first rest; do case "$first" in RocketPort[0-4]) echo "$first" ;; esac done ) rm -f /dev/cuaR* /dev/cuaiR* /dev/cualR* for i in $controllers; do ndevices=$( dmesg | while read first bar ports rest; do case "$first" in $i*) echo "$ports" ;; esac done ) echo -n "Creating $ndevices devices for $i: " dev=0 while [ $dev -lt $ndevices ]; do mknod /dev/cuaR$Rnum c $major $(($MINOR + 128)) uucp:dialer mknod /dev/cuaiR$Rnum c $major $(($MINOR + 128 + 32)) \ uucp:dialer mknod /dev/cualR$Rnum c $major $(($MINOR + 128 + 64)) \ uucp:dialer Rnum=$(($Rnum + 1)) MINOR=$(($MINOR + 1)) dev=$(($dev + 1)) done BOARD=$(($BOARD + 1)) MINOR=$(($BOARD * 65536)) echo " " done ;; mse*) unit=`expr $i : 'mse\(.*\)'` chr=27 mknod mse$unit c $chr `expr $unit '*' 2 + 1` # non-blocking for X11 ;; psm*) unit=`expr $i : 'psm\(.*\)'` chr=21 mknod psm$unit c $chr `expr $unit '*' 2 + 1` # non-blocking for X11 ;; mouse*) name=`expr $i : 'mouse\(.*\)'` if [ ! -c $name ]; then $0 $name # make the appropriate device fi ln -fs $name mouse ;; pcaudio) mknod pcaudio c 24 0 mknod pcaudioctl c 24 128 ;; socksys) mknod socksys c 41 0 mknod spx c 41 1 ln -fs socksys nfsd chmod 666 socksys nfsd spx ;; snd*) # # changes from Linux voxware # minor Linux FreeBSD # 8 sequencer2 (aka music0) music0 # 17 patmgr0 sequencer1 # 33 patmgr1 sequencer2 # unit=`expr $i : 'snd\(.*\)'` chr=30 # XXX write this less verbosely, like std snd_security_hole=0 # XXX umask $snd_security_hole ln -fs mixer$unit mixer ln -fs sequencer$unit sequencer ln -fs dsp$unit dsp ln -fs audio$unit audio ln -fs dspW$unit dspW ln -fs music$unit music ln -fs pss$unit pss mknod mixer$unit c $chr `expr $unit '*' 16 + 0` mknod sequencer$unit c $chr `expr $unit '*' 16 + 1` mknod midi$unit c $chr `expr $unit '*' 16 + 2` mknod dsp$unit c $chr `expr $unit '*' 16 + 3` mknod audio$unit c $chr `expr $unit '*' 16 + 4` mknod dspW$unit c $chr `expr $unit '*' 16 + 5` mknod sndstat c $chr 6 # minor number 7 is unused mknod music$unit c $chr `expr $unit '*' 16 + 8` mknod pss$unit c $chr `expr $unit '*' 16 + 9` # minor numbers 10-15 are unused umask 77 ;; vat) mknod vatio c 25 128 chmod 660 vatio ;; gsc*) unit=`expr $i : 'gsc\(.*\)'` mknod gsc${unit} c 47 $unit mknod gsc${unit}p c 47 $(($unit + 8)) mknod gsc${unit}d c 47 $(($unit + 32)) mknod gsc${unit}pd c 47 $(($unit + 40)) chmod 666 gsc${unit}* ;; apm) mknod apm c 39 0 root:operator chmod 664 apm ;; apmctl) mknod apmctl c 39 8 root:operator chmod 660 apmctl ;; card*) unit=`expr $i : 'card\(.*\)'` chr=50 mknod card$unit c $chr $unit chmod 644 card$unit ;; ttyx?|ttyy?|ttyz?) case $i in *0) unit=0;; *1) unit=1;; *2) unit=2;; *3) unit=3;; *4) unit=4;; *5) unit=5;; *6) unit=6;; *7) unit=7;; *8) unit=8;; *9) unit=9;; *a) unit=10;; *b) unit=11;; *c) unit=12;; *d) unit=13;; *e) unit=14;; *f) unit=15;; esac case $i in ttyy?) unit=`expr $unit \+ 16`;; ttyz?) unit=`expr $unit \+ 32`;; esac mknod $i c 42 $unit ;; cronyx) mknod cronyx c 42 63 ;; joy) mknod joy0 c 51 0 root:operator mknod joy1 c 51 1 root:operator chmod 640 joy0 joy1 ;; spigot) mknod spigot c 11 0 chmod 444 spigot ;; ctx?) unit=`expr $i : 'ctx\(.*\)'` mknod ctx$unit c 40 $unit chmod 444 ctx$unit ;; meteor?) unit=`expr $i : 'meteor\(.*\)'` mknod meteor$unit c 67 $unit chmod 444 meteor$unit ;; bktr?) unit=`expr $i : 'bktr\(.*\)'` mknod bktr$unit c 92 $unit mknod tuner$unit c 92 $((16 + $unit )) mknod vbi$unit c 92 $((32 + $unit )) chmod 444 bktr$unit tuner$unit vbi$unit ;; tun*) ntun=`expr $i : 'tun\(.*\)$'` unit=0 while [ $unit -le $ntun ]; do mknod tun$unit c 52 $unit uucp:dialer unit=$(($unit + 1)) done ;; tap*) ntap=`expr $i : 'tap\(.*\)$'` unit=0 while [ $unit -le $ntap ]; do mknod tap$unit c 149 $unit root:network unit=$(($unit + 1)) done ;; sysmouse) mknod sysmouse c 12 128 mknod consolectl c 12 255 ;; snp?) unit=`expr $i : 'snp\(.*\)'` mknod snp$unit c 53 $unit ;; # dufault@hda.com: If I do much more work on other A-D boards # then eventually we'll have a "ad" and "dio" interface and some of these # "labpcaio" ones will be gone. # labpcaio: D-A and A-D. # labpcdio: Digital in and Digital out. # labpc*) umask 7 case $i in labpcaio*) name=labpcaio unit=`expr $i : 'labpcaio\(.*\)'` all="0 1 2 3 4 5 6 7" offset=0 ;; labpcdio*) name=labpcdio unit=`expr $i : 'labpcdio\(.*\)'` all="0 1 2 3" offset=8 ;; *) die 3 "Don't know LabPC type $i" ;; esac if [ -z "${unit}" ]; then unit=all fi case $unit in 0|1|2|3|4|5|6|7) mknod $name$unit c 66 `expr $offset + $unit `  . ..MAKEDEVconsolekmem" memnull" random urandom zero" io ttyklog"stdin"stdoutstderr pci fd fd0rfd0fd0arfd0afd0brfd0bfd0crfd0cfd0drfd0dfd0erfd0efd0frfd0ffd0grfd0gfd0hrfd0hfd0.1720 rfd0.1720 fd0.1480  rfd0.1480!fd0.1440! rfd0.1440"fd0.1200" rfd0.1200#fd0.820#rfd0.820$fd0.800$rfd0.800%fd0.720%rfd0.720&fd0.360&rfd0.360'fd0.640'rfd0.640(fd0.1232( rfd0.1232) da0)rda0*da0a"*rda0a+da0b"+rda0b,da0c",rda0c-da0d"-rda0d.da0e".rda0e/da0f"/rda0f0da0g"0rda0g1da0h"1rda0h2da0s1"2rda0s13da0s2"3rda0s24da0s3"4rda0s35da0s4"5rda0s46 ad06rad07ad0a"7rad0a8ad0b"8rad0b9ad0c"9rad0c:ad0d":rad0d;ad0e";rad0e<ad0f"<rad0f=ad0g"=rad0g>ad0h">rad0h?ad0s1"?rad0s1@ad0s2"@rad0s2Aad0s3"Arad0s3Bad0s4"Brad0s4Cacd0a"Dacd0c"Cracd0aDracd0cEacd1a"Facd1c"Eracd1aFracd1cGafd0"Grafd0Hafd0a"Hrafd0aIafd0b"Irafd0bJafd0c"Jrafd0cKafd0d"Krafd0dLafd0e"Lrafd0eMafd0f"Mrafd0fNafd0g"Nrafd0gOafd0h"Orafd0hPafd0s1Prafd0s1Qafd0s2Qrafd0s2Rafd0s3Rrafd0s3Safd0s4Srafd0s4Trast0"Unrast0V wd0Vrwd0Wwd0a"Wrwd0aXwd0b"Xrwd0bYwd0c"Yrwd0cZwd0d"Zrwd0d[wd0e"[rwd0e\wd0f"\rwd0f]wd0g"]rwd0g^wd0h"^rwd0h_wd0s1"_rwd0s1`wd0s2"`rwd0s2awd0s3"arwd0s3bwd0s4"brwd0s4cwcd0a"dwcd0c"crwcd0adrwcd0cewfd0"erwfd0fwfd0a"frwfd0agwfd0b"grwfd0bhwfd0c"hrwfd0ciwfd0d"irwfd0djwfd0e"jrwfd0ekwfd0f"krwfd0flwfd0g"lrwfd0gmwfd0h"mrwfd0hnwfd0s1nrwfd0s1owfd0s2orwfd0s2pwfd0s3prwfd0s3qwfd0s4qrwfd0s4rrwst0"s vn0srvn0tvn0a"trvn0auvn0b"urvn0bvvn0c"vrvn0cwvn0d"wrvn0dxvn0e"xrvn0eyvn0f"yrvn0fzvn0g"zrvn0g{vn0h"{rvn0h|vn0s1"|rvn0s1}vn0s2"}rvn0s2~vn0s3"~rvn0s3vn0s4"rvn0s4cd0a"cd0c"rcd0arcd0ccd1a"cd1c"rcd1arcd1csa0.ctlrsa0.ctlsa0.0"rsa0.0nsa0.0nrsa0.0esa0.0ersa0.0sa0.1"rsa0.1nsa0.1nrsa0.1esa0.1ersa0.1sa0.2"rsa0.2nsa0.2nrsa0.2 sa0esa0.2ersa0.2sa0.3"rsa0.3nsa0.3nrsa0.3esa0.3ersa0.3rsa0nsa0nrsa0esa0ersa0ttyv0"ttyv1" vgacuaa0"cuaia0cuala0ttyp0"ptyp0"ttyp1"ptyp1"ttyp2"ptyp2"ttyp3"ptyp3"ttyp4"ptyp4"ttyp5"ptyp5"ttyp6"ptyp6"ttyp7"ptyp7"ttyp8"ptyp8"ttyp9"ptyp9"ttypa"ptypa"ttypb"ptypb"ttypc"ptypc"ttypd"ptypd"ttype"ptype"ttypf"ptypf"ttypg"ptypg"ttyph"ptyph"ttypi"ptypi"ttypj"ptypj"ttypk"ptypk"ttypl"ptypl"ttypm"ptypm"ttypn"ptypn"ttypo"ptypo"ttypp"ptypp"ttypq"ptypq"ttypr"ptypr"ttyps"ptyps"ttypt"ptypt"ttypu"ptypu"ttypv"ptypv"ttyd0"ttyid0ttyld0kbd0"mse0"psm0"sysmouse consolectllpt0"lpctl0ppi0"iic0"smb0"ums0"tun0"tap0" ch0 apmapmctlcard0"pass0"xpt0" i4bi4bctli4btrc0i4btrc1i4btel0i4bteld0i4brbch0 ... ... ... ... . .. fixit_crunch catchmodchroot cp dd dfechoexprkill ln lsmkdir mv rmrmdirsleepsyncchownclri disklabeldmesgfdiskmknodmountrebootrestoreswaponumount mount_msdos mount_cd9660rrestorechgrp ftptelnet vigrepview extar supported} i1 {Medium type four supported} i1 } # Notch page (0x0c) 0x0c "Notch and Partition Page"; 0x01 "Read-Write Error Recovery Page" { {AWRE (Auto Write Reallocation Enbld)} t1 {ARRE (Auto Read Reallocation Enbld)} t1 {TB (Transfer Block)} t1 {RC (Read Continuous)} t1 {EER (Enable Early Recovery)} t1 {PER (Post Error)} t1 {DTE (Disable Transfer on Error)} t1 {DCR (Disable Correction)} t1 {Read Retry Count} i1 {Correction Span} i1 {Head Offset Count} i1 {Data Strobe Offset Count} i1 {Reserved} *i1 {Write Retry Count} i1 {Reserved} *i1 {Recovery Time Limit} i2 } 0x04 "Rigid Disk Drive Geometry Page" { {Number of Cylinders} i3 {Number of Heads} i1 {Starting Cylinder-Write Precompensation} i3 {Starting Cylinder-Reduced Write Current} i3 {Drive Step Rate} i2 {Landing Zone Cylinder} i3 {Reserved} *t6 {RPL} t2 {Rotational Offset} i1 {Reserved} *i1 {Medium Rotation Rate} i2 {Reserved} *i1 {Reserved} *i1 } 0x07 "Verify Error Recovery Page" { {Reserved} *t4 {EER} t1 {PER} t1 {DTE} t1 {DCR} t1 {Verify Retry Count} i1 {Verify Correction Span} i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Verify Recovery Time Limit} i2 } 0x0E "CD-ROM Audio Control Parameters Page" { {Reserved} *t5 {Immed} t1 {SOTC} t1 {Reserved} *t1 {Reserved} *i2 {APRVal} t1 {Reserved} *t3 {Format of LBAs / sec.} t4 {Logical Blocks per Second of Audio Playback} i2 {Reserved} *t4 {Output Port 0 Channel Selection} t4 {Output Port 0 Volume} i1 {Reserved} *t4 {Output Port 1 Channel Selection} t4 {Output Port 1 Volume} i1 {Reserved} *t4 {Output Port 2 Channel Selection} t4 {Output Port 2 Volume} i1 {Reserved} *t4 {Output Port 3 Channel Selection} t4 {Output Port 3 Volume} i1 } # SEQUENTIAL ACCESS DEVICES 0x10 "Device Configuration Page" { {Reserved} *t1 {Change Active Partition} t1 {Change Active Format} t1 {Active Format} t5 {Active Partition} i1 {Write Buffer Full Ratio} i1 {Write Buffer Empty Ratio} i1 {Write Delay Time} i2 {Data Buffer Recovery} t1 {Block Identifiers Support} t1 {Report Setmarks} t1 {Automatic Velocity Control} t1 {Stop on Consecutive Filemarks} t2 {Recover Buffer Order} t1 {Report Early-Warning} t1 {Gap Size} i1 {EOD Defined} t3 {Enable EOD Generation} t1 {Synchronize at Early-Warning} t1 {Reserved} *t3 {Buffer Size at Early-Warning} i3 {Select Data Compression Algorithm} i1 {Reserved} *t5 {SCSI-3 Associated Write Protect} t1 {SCSI-3 Persistent Write Protect} t1 {SCSI-3 Permanent Write Protect} t1 } 0x0f "Data Compression Page" { {Data Compression Enabled} t1 {Date Compression Capable} t1 {Reserved} *t6 {Data Decompression Capable} t1 {Data Decompression Report on Exception} t2 {Reserved} *t5 {Compression Algorithm} i4 {Decompression Algorithm} i4 {Reserved} *i4 } 0x00 "Vendor-Specific"; #!/bin/sh -p # # Simple replacement for tar(1), using cpio(1). # # Copyright (c) 1996 Joerg Wunsch # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # # THIS SOFTWARE IS PROVIDED BY THE DEVELOPERS ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE DEVELOPERS BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # # For use on the fixit floppy. External programs required: # cpio(1), find(1), test(1) # # # $FreeBSD: src/release/scripts/tar.sh,v 1.5.2.1 2000/05/19 16:03:36 joerg Exp $ # archive=${TAPE:-/dev/rsa0} blocksize="20" device="" mode="none" verbose="" usage() { echo "usage: tar -{c|t|x} [-v] [-b blocksize] [-f archive] [files...]" 1>&2 exit 64 # EX_USAGE } # # Prepend a hyphen to the first arg if necessary, so the traditional form # ``tar xvf /dev/foobar'' will work, too. More kludgy legacy forms are not # supported however. # if [ $# -lt 1 ] ; then usage fi case "$1" in -*) break ;; *) tmp="$1" shift set -- -$tmp "$@" ;; esac while getopts "ctxvb:f:" option do case $option in [ctx]) if [ $mode = "none" ] ; then mode=$option else usage fi ;; v) verbose="-v" ;; b) blocksize="${OPTARG}" ;; f) archive="${OPTARG## }" ;; *) usage ;; esac done shift $(($OPTIND - 1)) if [ "X${archive}" != "X-" ] ; then device="-F ${archive}" # else: use stdin or stdout, which is the default for cpio fi case $mode in none) usage ;; t) exec cpio -it $verbose $device --block-size="$blocksize" "$@" ;; x) exec cpio -idmu $verbose $device --block-size="$blocksize" "$@" ;; c) if [ $# -eq 0 ] ; then # use current dir -- slightly bogus set -- "." fi find "$@" -print |\ cpio -o -H ustar $verbose $device --block-size="$blocksize" exit $? ;; esac # $FreeBSD: src/etc/group,v 1.19 1999/08/27 23:23:41 peter Exp $ # wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: news:*:8: man:*:9: games:*:13: staff:*:20:root guest:*:31:root bind:*:53: uucp:*:66: xten:*:67:xten dialer:*:68: network:*:69: nogroup:*:65533: nobody:*:65534: ...# # Internet protocols # # $FreeBSD: src/etc/protocols,v 1.13.2.1 2000/09/24 11:26:39 asmodai Exp $ # from: @(#)protocols 5.1 (Berkeley) 4/17/89 # # See also http://www.isi.edu/in-notes/iana/assignments/protocol-numbers # ip 0 IP # internet protocol, pseudo protocol number #hopopt 0 HOPOPT # hop-by-hop options for ipv6 icmp 1 ICMP # internet control message protocol igmp 2 IGMP # internet group management protocol ggp 3 GGP # gateway-gateway protocol ipencap 4 IP-ENCAP # IP encapsulated in IP (officially ``IP'') st2 5 ST2 # ST2 datagram mode (RFC 1819) tcp 6 TCP # transmission control protocol cbt 7 CBT # CBT, Tony Ballardie egp 8 EGP # exterior gateway protocol igp 9 IGP # any private interior gateway (Cisco: for IGRP) bbn-rcc 10 BBN-RCC-MON # BBN RCC Monitoring nvp 11 NVP-II # Network Voice Protocol pup 12 PUP # PARC universal packet protocol argus 13 ARGUS # ARGUS emcon 14 EMCON # EMCON xnet 15 XNET # Cross Net Debugger chaos 16 CHAOS # Chaos udp 17 UDP # user datagram protocol mux 18 MUX # Multiplexing protocol dcn 19 DCN-MEAS # DCN Measurement Subsystems hmp 20 HMP # host monitoring protocol prm 21 PRM # packet radio measurement protocol xns-idp 22 XNS-IDP # Xerox NS IDP trunk-1 23 TRUNK-1 # Trunk-1 trunk-2 24 TRUNK-2 # Trunk-2 leaf-1 25 LEAF-1 # Leaf-1 leaf-2 26 LEAF-2 # Leaf-2 rdp 27 RDP # "reliable datagram" protocol irtp 28 IRTP # Internet Reliable Transaction Protocol iso-tp4 29 ISO-TP4 # ISO Transport Protocol Class 4 netblt 30 NETBLT # Bulk Data Transfer Protocol mfe-nsp 31 MFE-NSP # MFE Network Services Protocol merit-inp 32 MERIT-INP # MERIT Internodal Protocol sep 33 SEP # Sequential Exchange Protocol 3pc 34 3PC # Third Party Connect Protocol idpr 35 IDPR # Inter-Domain Policy Routing Protocol xtp 36 XTP # Xpress Tranfer Protocol ddp 37 DDP # Datagram Delivery Protocol idpr-cmtp 38 IDPR-CMTP # IDPR Control Message Transport Proto tp++ 39 TP++ # TP++ Transport Protocol il 40 IL # IL Transport Protocol ipv6 41 IPV6 # ipv6 sdrp 42 SDRP # Source Demand Routing Protocol ipv6-route 43 IPV6-ROUTE # routing header for ipv6 ipv6-frag 44 IPV6-FRAG # fragment header for ipv6 idrp 45 IDRP # Inter-Domain Routing Protocol rsvp 46 RSVP # Resource ReSerVation Protocol gre 47 GRE # Generic Routing Encapsulation mhrp 48 MHRP # Mobile Host Routing Protocol bna 49 BNA # BNA esp 50 ESP # encapsulating security payload ah 51 AH # authentication header i-nlsp 52 I-NLSP # Integrated Net Layer Security TUBA swipe 53 SWIPE # IP with Encryption narp 54 NARP # NBMA Address Resolution Protocol mobile 55 MOBILE # IP Mobility tlsp 56 TLSP # Transport Layer Security Protocol skip 57 SKIP # SKIP ipv6-icmp 58 IPV6-ICMP # ICMP for IPv6 ipv6-nonxt 59 IPV6-NONXT # no next header for ipv6 ipv6-opts 60 IPV6-OPTS # destination options for ipv6 # 61 # any host internal protocol cftp 62 CFTP # CFTP # 63 # any local network sat-expak 64 SAT-EXPAK # SATNET and Backroom EXPAK kryptolan 65 KRYPTOLAN # Kryptolan rvd 66 RVD # MIT Remote Virtual Disk Protocol ippc 67 IPPC # Internet Pluribus Packet Core # 68 # any distributed file system sat-mon 69 SAT-MON # SATNET Monitoring visa 70 VISA # VISA Protocol ipcv 71 IPCV # Internet Packet Core Utility cpnx 72 CPNX # Computer Protocol Network Executive cphb 73 CPHB # Computer Protocol Heart Beat wsn 74 WSN # Wang Span Network pvp 75 PVP # Packet Video Protocol br-sat-mon 76 BR-SAT-MON # Backroom SATNET Monitoring sun-nd 77 SUN-ND # SUN ND PROTOCOL-Temporary wb-mon 78 WB-MON # WIDEBAND Monitoring wb-expak 79 WB-EXPAK # WIDEBAND EXPAK iso-ip 80 ISO-IP # ISO Internet Protocol vmtp 81 VMTP # Versatile Message Transport secure-vmtp 82 SECURE-VMTP # SECURE-VMTP vines 83 VINES # VINES ttp 84 TTP # TTP nsfnet-igp 85 NSFNET-IGP # NSFNET-IGP dgp 86 DGP # Dissimilar Gateway Protocol tcf 87 TCF # TCF eigrp 88 EIGRP # Enhanced Interior Routing Protocol (Cisco) ospf 89 OSPFIGP # Open Shortest Path First IGP sprite-rpc 90 Sprite-RPC # Sprite RPC Protocol larp 91 LARP # Locus Address Resolution Protocol mtp 92 MTP # Multicast Transport Protocol ax.25 93 AX.25 # AX.25 Frames ipip 94 IPIP # Yet Another IP encapsulation micp 95 MICP # Mobile Internetworking Control Pro. scc-sp 96 SCC-SP # Semaphore Communications Sec. Pro. etherip 97 ETHERIP # Ethernet-within-IP Encapsulation encap 98 ENCAP # Yet Another IP encapsulation # 99 # any private encryption scheme gmtp 100 GMTP # GMTP ifmp 101 IFMP # Ipsilon Flow Management Protocol pnni 102 PNNI # PNNI over IP pim 103 PIM # Protocol Independent Multicast aris 104 ARIS # ARIS scps 105 SCPS # SCPS qnx 106 QNX # QNX a/n 107 A/N # Active Networks ipcomp 108 IPComp # IP Payload Compression Protocol snp 109 SNP # Sitara Networks Protocol compaq-peer 110 Compaq-Peer # Compaq Peer Protocol ipx-in-ip 111 IPX-in-IP # IPX in IP vrrp 112 VRRP # Virtual Router Redundancy Protocol pgm 113 PGM # PGM Reliable Transport Protocol # 114 # any 0-hop protocol l2tp 115 L2TP # Layer Two Tunneling Protocol ddx 116 DDX # D-II Data Exchange iatp 117 IATP # Interactive Agent Transfer Protocol st 118 ST # Schedule Transfer srp 119 SRP # SpectraLink Radio Protocol uti 120 UTI # UTI smp 121 SMP # Simple Message Protocol sm 122 SM # SM ptp 123 PTP # Performance Transparency Protocol isis 124 ISIS # ISIS over IPv4 fire 125 FIRE crtp 126 CRTP # Combat Radio Transport Protocol crdup 127 CRUDP # Combat Radio User Datagram sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS # Secure Packet Shield pipe 131 PIPE # Private IP Encapsulation within IP sctp 132 SCTP # Stream Control Transmission Protocol fc 133 FC # Fibre Channel # 134-254 # Unassigned divert 254 DIVERT # Divert pseudo-protocol [non IANA] # 255 # Reserved  ... . ..share0 . ..misc0 . .. scsi_modes# # Network services, Internet style # # Stripped-down version. # # $FreeBSD: src/release/fixit.services,v 1.4 1999/08/28 01:33:10 peter Exp $ # # WELL KNOWN PORT NUMBERS # echo 7/tcp echo 7/udp discard 9/tcp sink null discard 9/udp sink null systat 11/tcp users #Active Users systat 11/udp users #Active Users daytime 13/tcp daytime 13/udp chargen 19/tcp ttytst source #Character Generator chargen 19/udp ttytst source #Character Generator ftp-data 20/tcp #File Transfer [Default Data] ftp-data 20/udp #File Transfer [Default Data] ftp 21/tcp #File Transfer [Control] ftp 21/udp #File Transfer [Control] ssh 22/tcp #Secure Shell Login ssh 22/udp #Secure Shell Login telnet 23/tcp telnet 23/udp # 24/tcp any private mail system # 24/udp any private mail system smtp 25/tcp mail #Simple Mail Transfer smtp 25/udp mail #Simple Mail Transfer time 37/tcp timserver time 37/udp timserver domain 53/tcp #Domain Name Server domain 53/udp #Domain Name Server bootps 67/tcp dhcps #Bootstrap Protocol Server bootps 67/udp dhcps #Bootstrap Protocol Server bootpc 68/tcp dhcpc #Bootstrap Protocol Client bootpc 68/udp dhcpc #Bootstrap Protocol Client tftp 69/tcp #Trivial File Transfer tftp 69/udp #Trivial File Transfer gopher 70/tcp gopher 70/udp finger 79/tcp finger 79/udp http 80/tcp www www-http #World Wide Web HTTP http 80/udp www www-http #World Wide Web HTTP sunrpc 111/tcp rpcbind #SUN Remote Procedure Call sunrpc 111/udp rpcbind #SUN Remote Procedure Call auth 113/tcp ident tap #Authentication Service auth 113/udp ident tap #Authentication Service nntp 119/tcp usenet #Network News Transfer Protocol nntp 119/udp usenet #Network News Transfer Protocol rmt 411/tcp #Remote MT Protocol rmt 411/udp #Remote MT Protocol https 443/tcp https 443/udp # # Berkeley-specific services # exec 512/tcp #remote process execution; # authentication performed using # passwords and UNIX loppgin names biff 512/udp comsat #used by mail system to notify users # of new mail received; currently # receives messages only from # processes on the same machine login 513/tcp #remote login a la telnet; # automatic authentication performed # based on priviledged port numbers # and distributed data bases which # identify "authentication domains" who 513/udp whod #maintains data bases showing who's # logged in to machines on a local # net and the load average of the # machine cmd 514/tcp shell #like exec, but automatic # authentication is performed as for # login server syslog 514/udp printer 515/tcp spooler printer 515/udp spooler talk 517/tcp #like tenex link, but across # machine - unfortunately, doesn't # use link protocol (this is actually # just a rendezvous port from which a # tcp connection is established) talk 517/udp #like tenex link, but across # machine - unfortunately, doesn't # use link protocol (this is actually # just a rendezvous port from which a # tcp connection is established) ntalk 518/tcp ntalk 518/udp utime 519/tcp unixtime utime 519/udp unixtime efs 520/tcp #extended file name server router 520/udp route routed #local routing process (on site); # uses variant of Xerox NS routing # information protocol uucp 540/tcp uucpd uucp 540/udp uucpd uucp-rlogin 541/tcp uucp-rlogin 541/udp klogin 543/tcp # Kerberos (v4/v5) klogin 543/udp # Kerberos (v4/v5) kshell 544/tcp krcmd # Kerberos (v4/v5) kshell 544/udp krcmd # Kerberos (v4/v5) # SCSI mode page data base. # Copyright (c) 1995 HD Associates # (contact: dufault@hda.com) # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. The name of HD Associates # may not be used to endorse or promote products derived from this software # without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY HD ASSOCIATES ``AS IS'' AND # ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE # IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE # ARE DISCLAIMED. IN NO EVENT SHALL HD ASSOCIATES BE LIABLE # FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL # DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS # OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) # HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT # LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY # OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF # SUCH DAMAGE. # # $FreeBSD: src/share/misc/scsi_modes,v 1.6.6.2 2000/10/29 01:01:01 mjacob Exp $ # # The ordering is alphabetical by page name, as it appears in the SCSI spec. # 'i' is a byte-sized integral types, followed by a field width of # 1 through 4 (1 to 4 bytes). # # 'b' is a bit-sized integral type # 't' is a bitfield type- followed by a bit field width # # 'c' values are character arrays # 'z' values are null-padded strings # # # '*' suppresses assignment (for 'seeking'). # Bitfields are MSB to LSB. # ALL DEVICE TYPES 0x0a "Control Mode Page" { {Reserved} *t7 {RLEC} t1 {Queue Algorithm Modifier} t4 {Reserved} *t2 {QErr} t1 {DQue} t1 {EECA} t1 {Reserved} *t4 {RAENP} t1 {UAAENP} t1 {EAENP} t1 {Reserved} *i1 {Ready AEN Holdoff Period} i2 } 0x02 "Disconnect-Reconnect Page" { {Buffer Full Ratio} i1 {Buffer Empty Ratio} i1 {Bus Inactivity Limit} i2 {Disconnect Time Limit} i2 {Connect Time Limit} i2 {Maximum Burst Size} i2 {Reserved} *t6 {DTDC} t2 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 } 0x09 "Peripheral Device Page" { {Interface Identifier} i2 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 } # DIRECT ACCESS DEVICES 0x08 "Caching Page" { {IC} t1 {ABPF} t1 {CAP} t1 {DISC} t1 {SIZE} t1 {WCE} t1 {MF} t1 {RCD} t1 {Demand Retention Priority} t4 {Write Retention Priority} t4 {Disable Pre-fetch Transfer Length} i2 {Minimum Pre-fetch} i2 {Maximum Pre-fetch} i2 {Maximum Pre-fetch Ceiling} i2 } 0x05 "Flexible Disk Page" { {Transfer rate} i2 {Number of heads} i1 {Sectors per track} i1 {Data bytes per sector} i2 {Number of cylinders} i2 {Starting cylinder-write precompensation} i2 {Starting cylinder-reduced write current} i2 {Drive step rate} i2 {Drive step pulse width} i1 {Head settle delay} i2 {Motor on delay} i1 {Motor off delay} i1 {TRDY} t1 {SSN} t1 {MO} t1 {Reserved} *t5 {Reserved} *t4 {SPC} t4 {Write Compensation} i1 {Head load delay} i1 {Head unload delay} i1 {Pin 34} t4 {Pin 2} t4 {Pin 4} t4 {Pin 1} t4 {Medium rotation rate} i2 {Reserved} *i1 {Reserved} *i1 } 0x03 "Format Device Page" { {Tracks per Zone} i2 {Alternate Sectors per Zone} i2 {Alternate Tracks per Zone} i2 {Alternate Tracks per Logical Unit} i2 {Sectors per Track} i2 {Data Bytes per Physical Sector} i2 {Interleave} i2 {Track Skew Factor} i2 {Cylinder Skew Factor} i2 {SSEC} t1 {HSEC} t1 {RMB} t1 {SURF} t1 {Reserved} *t4 } 0x0b "Medium Types Supported Page" { {Reserved} *i1 {Reserved} *i1 {Medium type one supported} i1 {Medium type two supported} i1 {Medium type three (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x ELF FreeBSD44 (UUUFreeBSDh U WVSҍu^|=~)}t#E8t8/u H @8ut Rn ht^ WVSPyi U=u@v@С8ut hr~ÍvUUthrhrG~ÐUU WVS} ?t8uj/7 pu7;t(3VA u;tWuCvVh uh-uhn_ e[^_ÉUVS]j/S ޅtp=t$3V~ u  v;u1e[^ÍvUVSu] SNVe[^ÍvU WVSh uh`uhn 1=tS;׍7Ohuhn^ 3huhnE ;uhuhn( j.g Uuu uÐUVSu] hIwjd v$wrrvrrnr`rTrr>jhXnQw (rh`whn. j4f hJwSV 1SÃ=ru-=ru$=ru=ru=ru =rt SD ShXnO thwj]& 5re U WVS]nrw;t[ƿwt7hwPa- ƃu%3hw' r.nrV$nt V萂 ;ue[^_UWVS}EE   uj=rtM}u9 `nxXnڈXnvhXnS:Y ZE$=rt==ru4 =rt)EEPhwhXn dn@E u^=r}$ `ny `n;pn|XnʈXnvhXnj$X , =r^ `ny `n;pn|XnʈXnhXnj^X =I `ny `n;pn|XnʈhXnjI=rÀvSH  l4%M `ny `n;pn|XnʈXnhXnjMUW u- `ny `n;pn|XnʈXnvhXnj- W )vSG  l4%^ `ny `n;pn|XnʈXnhXnj^V ?t @ `ny`n;pn| t Xnʈ/hXnQ: `ny`n;pn| tXnڈXnhXnSV t*OyW|  vPG @t$5rhwg# rg dn@thwj! e[^_U WVS]5nrw;t_ƿwt7jjP ƃ}(3hw" r4v5nrV.n9t V_ ;we[^_ÍvUlWVS=fn=rEPW* t5rhwj E=srPT ruKhwjL 1t6SrPWQ_ }hwj v)ƅũ5r5rEP,_ Ã}5rhw! re[^_Uuu uÐUUrh jEPURm EE =vt@UB<@ %Ph(: }Gh(hV}j vE%f=@t"9 h(hV}j v=,stjEp ttte[^ÍvUS=ttx5thY ttJJ;tr3: t;tr&t)CSP5t輿 tttt t]ÐUS] hBj : S: jhj; hj; hL v348=4u=8uZj< U VS=tutCt5jj5tҡ tu5thIjd htw=8 u!=4vtuh`j0 =tutthatHuP5t) tuPhatHuP5t t tu5thIj ht`tu=uD2uRPjC9|ƒ􋅔Pc( vEPU 2諮 }@o E 0nǃU 2he DžE%f= u61ۃPU 2Pu tE%f=`ZE 0ǃEU uhh ƃuhw DžpVso ǃuVh DžShujWhN tK1ۃPU 2mu tWŭ V SWh uƅPSU 2he DžjW莰 WQ V5 ovE 8PW }Whe Dž6}uFщRPE E 8yx[^_U WVSjEP x 19}7EPEP(< u EL vF9|1e[^_ÐUWVSE}u"=vujPw E EEE 9E}sURE4F-u2/2=wu`%v1u1Bt'H9rtU vEEe[^_UUHw r ÉU WVS}?tf?u_˘ j jw É識 8thzj2 w5 _we[^_ÍvUVSuHvAj Ãuhjj vFVRPhS ^e[^ÐUE8%ÐUWS48u 1v44߰uPh tIW߰u3{=u-<u$SWPe[_ÉUVS];uC C%,1C8tSщ‰ t C Cue[^ÐUS] hj7 4 H8uPHQRhHph 5H>]ÐUhj vUVS]u S uV% Se[^ÉUVS]u SuVt&SV jjvV؍e[^ÉU WVSu} VuWt9VW wv3 1RP>VSWJ F;GuF;G1QRÃVW؍e[^_ÉU WVS}u WuVt9WLVC vwg 1RPBWV~ G;F uG;Fv QRÃWV؍e[^_ÉU WVSu} VuWt=V|Ws wv 1RP|à KVW G;F uG;Fv QR/ÃVIW@؍e[^_ÉU WVSu} V$uWtMVW wv Љ҉1RPà MvVW G;FuG;Fw QRKÃVeW\؍e[^_ÉU WVS}u W@uV0t9WV vw 1RPBWV G;FuG;Fw QR{ÃWV؍e[^_ÉU WVSu} VpuW`t9VW wv 1RP@V/W& F;GuF;Gt QRÃVW؍e[^_UWVSEU M]u}uvuv uv }}| v1[^_ÐU WVSu} Vhщƒ tWRщƒ uhj FVGWRPÃCSRPGWRPFVRP(0thzjv VW؍e[^_U WVSM] EUuu|1u}WV؃RPSQe[^_ÐU WVSu} V\щƒ tWFщƒ uhj FV+GWRPÃCSRPGWRPFVRP(0thzjj VW؍e[^_UVSUM ]u tQREURP跁 9u9t1e[^ÍvUWVS]u S`щƒ tVJщƒ uhj KfEUCFEFCEEURPǃGWRPFVRPCSRP0thzjR SVe[^_USEU M]uuuu v1[ÍvU WVS}u WTщƒ tV>щƒ uhj F Fuhj FVRPGWRP RPÃCSRPFVRPGWRP 0thzj> WVz؍e[^_U WVS}u Wxщƒ tVbщƒ uhj F Fuhj FVRPGWRP`} RPÃW V؍e[^_ÐU<WVS}W\E PP jE puV9 t&hSVP Shҟj vjEPjwEPE u>E Eu6}|WEEGP6E؋U+EURP!}ujj hÃWE P EP* ؍[^_ÐUVS$u v'ہ'~'D58)tPR P tmDp8=TtP5Ty vP t(T0$DDX,1ve[^U WVS<(X=Du D8T01fu=X}hX} Xu^Xy];Xui8;,r G884]f000PX=(? (4ut0Xx( ;Xu=(uh<=((8E^tcx[Sf<]uG;,r > 884]f000PH8;D80d=XX<])0@Ce$@HO0@@<00p00p00p600p00p00p^00p*00pv00pb00pN00p:00p&00p00p"@?8)‰У80)0<]̖udu`88f00@=X}X} X=Xv}t$x 9u  4}Z8;,r Zu*88f000@ph՟g1e[^_ÐUuu uÐUWVS] }EM3M}~b}=wu`%1u-j EP3P E8tE8t3hj v}~EEHv 3KE4h"- j vhXnGjm 3&uKM}h@ eָatRLE8-vR  l4%t3 E}qb=wu`%1tH`h7h`p\[hhU RSU{ uSu 4u )øu=ptsl==pt-dtt Jt'AjhmE 0P  jU r2{P u \EPS4 tShoj E%f=@tm1E 9t jSU 2 ǃE u 9uW{ vUlWVS} =puLEPEP謆 t EPE%f=@uU~ EPv}u"EPW] uKE%f=@u=j/EP薍 uE@PWhrhS$G ߃ EPWօ %=`t tWO v=hhXn Whxhn' nHyP nnƃ t7t2nKyS nn tuԃytYthhn褉 _Ws uWEPlЃtWho #=\tEPdPWh 1[^_ÍvUhhhhhn j Uuu uÐUE @PE@P ÉUE@PE @P ÉUUE H9t,fx2u#=uu u63xЍe[^ÍvUWVS}19s"vȉډF9rȉ[^_ÐUVSutPv{ t@vv S  `nxXnXnhXnj [ue[^UE=Жu =t P '=uPhȧ] vPÐU,WVSUfx2t8=u =t&UBH15Ph˧ E8UU w<=tvEp h֧ =t6 AF8V<SQRPV] RPUrhܧ聭 EPFP_ _sUr3r,F Pr$EPhF 0=ܖtsUrh$ F%f= tf=`u4F0=vPFPhcF0PFPh NvExt/F0V4RPEP(Rh)Ph覬 F0V4RPUr(hܧ般 =tv=t v( vv G@P=ؖtFP1F%f=u W `nxXnXnvhXnj e[^_ÍvU =Ȗt +E0;~9E}(EP PSjP]Sd hXnS蕭 ]UU%=w=t`=@t!$==  `ny `n;pn|Xn/vhXnj/  `ny `n;pn|Xn|vhXnj| `ny `n;pn|Xn@vhXnj@ `ny `n;pn|Xn=chXnj=j `ny `n;pn|Xn%3hXnj%:ItC `ny `n;pn|Xn*XnhXnj* 1USUfz2u B@PhȧhP, 'B@PBph9hP+ hPSm u#gb 0贿 PSh?hno !hL襥 SU WVSu1ӁvRx vl4%t* `ny9`n;pn| u'hXnR8? `ny `n;pn|XnXnvhXnj? FG^e[^_U WVS}1] Kt=GvR  l4%tFvsĉe[^_ÉU WVS}1ӁvRX vl4%tN"tI\tD `ny`n;pn| tXnXnhXnR F=\ `ny `n;pn|XnXnhXnj\ ÃU$\ `n`n;pn|hXnj\v" `nY`n;pnHhXnj"Uva `n%`n;pnhXnja!vb `n`n;pnhXnjbvf `n`n;pnhXnjfvn `n`n;pn}|hXnjnvr `ny]`n;pn}PhXnjr`t `ny5`n;pn}(hXnjt8v `ny `n;pn|XnXnhXnjv %P0 `ny`n;pn| tXnXnhXnR P0 `ny`n;pn| tXnXnvhXnRV ؃P0 `ny`n;pn| tXnXnhXnR \ `ny `n;pn|XnXnvhXnj\ %P0 `ny`n;pn| tXnXnhXnR P0 `ny`n;pn| tXnXnvhXnR: ؃P0 `ny`n;pn| tXnXnhXnR G]e[^_ÍvUhhnh j Uuu uÐUWVSu] EEFpt# ?t4mt -vt%EEvhSV,W uSÃ;u}u HvEPh ƃuEPh jԞ hV V E;}tW3DW3c }3h" 1v=t3h% u E2}t,W3f u3h"谞 E;NEP U|WVS}E fEfEE;/uCE1v;u ;/{u}t&jUd fE%?PCd E tEP(d EPWa tEY 8uftEPWLb |H=t\Wh%Μ IE%f=@t:tAY  3Y Wh"c Evu/C}uu EP]c Ex[^_ÍvUh@hne j@ Uuu uÐU|WVSu \vit ft$Fvt3=+7 hDVEPS uS)E4} EPEt` uE%f=@t#}~v6TP E|H=v6h`j EtS ߰HÃt{/t /CDžMvװЍTJ;tz/tvJ;tz/uװЍH=~6h` Dž1APRSv[ P6- t DžMP􋅘P9 U|WVS}=jE Pa oEPW*^ &1ۃ=t'hE Phhnb jE P:a tEPE P] uhEPEPKK hE Pju Pju P} uPEPhhnb 0nHyP nnƃ t7t2nKySj nn tuԃytYth¬hna 1E PW] u =tۃE PWhӬ ǍvT 8unSWbM uSWhݬ?vPS\ u;PS u$hG mE PWhEPW[ tWh& 4vE%f=uEPE PWvE PWCx[^_UWVS}jjEP`; ƃ}EPh;G@=t5 w@ u-h: E G@:R 8uE Pz_ tE Ph VjhE P: E|S5EP5 9r55V) Ã}ZEPh艖 E P^ tE Ph-b V EP V _ww EP"[ t:ww E Ph@  tPE PhΖ fgGPEPZ tPE Ph谕 dQ wDEP\ t'CQ 8-uDtwDE Ph׭h GEG EEEEPE PY tE Ph# EPp tE Ph"vEPP] tEPh-ؔ !=tE PEPhӬޓ 1e[^_UAP …uOju EP=tPh hlK hhS j%W jEPRM uhhvEthh@EtPh/e …u=jEPhh hJ hh诓 jV jEPR uhh:Ethh@#vEu1EPhh`? Uhhhhn[ j@ Uuu uÐU WVS] j/3^ u@ƿu%}uCP~5$( K 1 ~&wp$a K 3 % hSEPQI eS)E}= t1cv{ S %Y ;t0j. tS) vSS5$ e[^_U WVS1=t= u=u=tu=t jPu=. ƃjj< C4H $vs٩ Pshj = t {>s蟩 Pshi $ v= u3sE%f=@uS-Q %v= tEPSvST ƃt.= t 3H 8tShd $=tuShh $e[^_U|WVSDž} u]SEPO !] U B%f=>jjEP`/ PRO =} Dž􋕜R̽ uhj蘉 PhRa E X0p4gv;u;w RPR: 9)օuw􋅘PWR jjjR> щƒ PjR E X0p4gv;u;w RPRf 9)օuw􋅘PQ jjjRj щƒ PhR E X0p4`;u;w RPR 9uO)օuw􋅘PP u(􋕘RA u􋅔P7 7$t􋕔R EPh薈 x[^_ÍvUWVS}u=tWhhnP =t8F%f=t)ju SO u FFuFDt =u 2EPFP[9 vD à ujj+ vW;tP;tPjv Pjv P} uPEPhhnO 0Sͺ hnA nHyPc nnƃ t7t2nKyS. nn tu1ytYue[^_ÍvUVS1];tnj/3Q ƒBu:.uGzt z.u;zu5Fuh b $Cu땃됍ve[^ÐUh@h`hhnN j@ Uuu uÐU WVSu] 1?tpu vhgSV = uСS9u1;tC3J }3hi脅 t3 ƃ;uV UWS]߰ЍDH9v8/t@4H9v8/t@SI }Shi j/S1P u1e[_ÐUhhn@M jF Uuu uÐUWVS]u vkhVS; u䡈S)Í4t@EvEvRm  l4%@tE͐1E8-uG vE8+uEE=wu`%1t&j EPu ~ 1ɉMEE8.u[]gfffvEE=wu`%1t!EC)‰uu}}~jEP裛 j Uhhn|K j Uuu uÐUI jO Uuu uÐUWVS}] j/3=N PuHzo%@(E/v7w`$EOE1BE164)8Ev(shMSW,9 xS)ǃD=4t5}t}uth`jۀ vt}t0,=@tDj:3` uj.3M t@P3( 3jWS( ǃujj+ v1eC4H $v=4?jSW% +s蚙 Pshd  8sr Psh<  v}=,t S<,;B u=0S<0;B}t<505,sIC tZ=8uQsXv505,sG t=8usRv=(tsh~ W? à ; 8thj} Vü vUS];t1<S uhSUv@0]ÍvUS];t)S uh¶S@,]ÍvUVSuT: j EPVg 8: 8tVhǶj| E8tu Vhʶj} ؍e[^ÍvUTS]9 8u =,t'=uE tShǶjL| =0ts=uj=uaLE tSEPjC M0 x;u=}5<hj| ShǶr} ]ÐUh h`hhhnE jȺ Uuu u)ÐUhhnE j芺 U WVS}E E jjPa }Rhjz jjh QG }Phjz h PRչ = tQhj{ \Tt"hT\Ph jU{ S0E M 9vE 0 ƃU 2h`j{ Vhz ׉C!CS{xK`Kd t1 jRPQ }Phjsy vRPQ臸 ;tPhj2y {x(VlB1 VljؙRPP^ }Rhjx QPP׷ ;tRhjx QA E E 8BRo j虷 Uuu uÐU,WVSDž1v8$d=ltB&l=lt&&lc=lt &lG=lt%l+!=lt%l%h0E PUR:0 S)EM M =t=lu4l(=lu l}.%U 8/tCjcPh<hB5h萷 hװУh =l%P5 3 8ug8/t]Ph<hI5 װh=l%PR }5hNju =ll$Hv}t#RÃQSZvDžPhmdPk= hQj u }tu#RÃShXn S&/=t7}u1hjM q$Ehh> }t"hbE p{ uU rhNjVt hPnu ju QhhÉ߾EShP Nv}u U ZE}t:"hSM q*PhhIÉ߾E SDžPhmdR; hQj5s QÍE}uhjE pmRhhÉߍES uShP>Rʱ U WVS]uhuEP0/ uMQhmjBs ߉E=uD{t>C8/tPhhh sh舩 =uC{t=C8/tPhhh賲 sh< jsV; } tjE PV詋 e[^_ÐUVSu]SWEVǃWEVfǃS f =ShfdVI9 }"e. 8t[. 8thjjjV< EEPhmdV8 }hQSr u V讯 ;u)=t655V腯 ;thq LEEPhmdVo8 -ShgdV]8 }h1e[^ÍvUS]M- tRtmtSt`ShNr hSh 6r h`hn9 0Shr jcShr j q ]ÐUSE=h hP^ =5hNj o vwg=WEVuWEVt"vwA;WEVu큻WEVuw%;WEVuWEVuSft޿ u5Q M fANv޿ uEP }SRQVU BPv޿uaQF }1SPRhhnt% >M AT+v<{ŸM 9vPh1U u QwSiuSe }$SPhhn$  u'Rh`hnf$ SSuS }$SQhhn $  GSpLs$tSPl tELr=wu`%1t"S! -EDžv,Sh PhAhn2# Dž G G  t uRh`vSQuSM GsuQh`CSS 1wG #vuPh`vSuS GuRh`SMuSI 1wG uQh`<vSS fG%uPh`vSuS GuRh`SUuSQ 1wG uQh`GSS fG4v-U fB!SQh`hn1 EPhP] 9U R%[^_UWVS}E(u h,u h0uhhn 4uhhnp EfHuhR8u G,G0G8<u G8G4G<uhhn Ev1w(thuh$hn E1w(th@fvjPh1faE;u{tsEPhEC;GEE}t =@tg u =0t5@u j =Dt j=<UKv=4t: 6 t5L5h&J hJ h  J =uSC~5~=4u =(t5= t^=4u=(u = tg=<uh`qI hdI jo=<uh t h#I jz Uh`hhhnI jO vUS]Uh H u,vShH S C~ S]ÉUWVSEjhWf uhOH G 1҉EUÉEEUEEEEEUEUGP PGPhG ?uPPEURPw wh G GPG$?%PWG$%RGPG$?%PWG$%Rh`WG e[^_ÍvUlWVS5,ujV ǃtEPW uVhjF EЋUԣ SQRPщ‰ tVhjF =t5z EЋUԣPy uVhjF 55W规 ÃtWl tVhjIE ډ;u ;HtVh#j'F ve[^_U WVS]F=\1߅u^=)ډV FPFPFPRS% FPFPFPF PFHPe[^_ÐUWVSEEPh@2E EP =4h_m r=0t;jS  }u'jhD j5EECPEPh tECsEPh tECs EPhp tEC h3sC$%CEC$?VEPh% tuEPEPh8tEEWEPhGt}C?$ˆSECsC$%CEC$?VEPhXtuEPEPhh`tEEWEPhtAt}C$?ЈCECRS'uCCPCPCPs sz CPCPCPC PCHPZ EPhe[^_UhqB 5555hLB 0=?= =~h B h` B 5555hA UVSh.txSEPht]CvhA Éh t1҉B~Cw De[^Uh@tÍvUShk]5ShtE5ShtE5ShtEh i]U WVS}u}u} uEMvE=)EE=)EEU?%‹M[^_ÐUtSEP5 Ãu5hE u5h KA =(u=$u= u}t1P5 u!8uD5hC*j t v5h`@ ]ÍvUSEU ]j RP5R~ =uB5S5| ;t5=~v5S5| ]ÉUSEU ]j RP5} 5S5Y| ]UhhedA5Z t^ s5h5? UWV=t5#q 5p u hX5jjƃu h2fUu1h@> e^_ÍvU WVS=t&jPvh< {v=Ǿ1+vPRPÃtGRPRPzӉ9u9w1e[^_UWVuh; hnjdh B װD= tUֿt9ֿt&ֿtֿu 1e^_ÍvU WVSu1ۉVEPh: hnjdh A װD = t&  At t tu1dAtBЃ w \Bv t uAt( t tth h: 0E e[^_ÉUVSu41ɺH9uB A9|.[^ÍvU WVSu ]1vR] vl4%@tCύv;;#CvRT] vl4%@uЀ;#vR]  l4%t VD2C=wu`%1t6EjEPS ‹FT0 ;]t ]F9e[^_U WVS}1ۋu UDvW5h@=t5h@ExS5ht8 1e[^_UWVSuEpEjS NKVSF$C <ujSv EuC15t_5;=r +9vEP5h7 +PsEPh 7 5sC C15;Cwho7 1+s;s tVs EPhL7 s { uEP5h`)7 CPCPCPs s CPCPCPC PCHPEP~t5h@6 *vF EHXEP5h6 Ee[^_ÉUSE1*1ҐB~DGxt5h)6 1 H AvQ5h6 ؋]ÉUdSEPuaEuEPF;u|ȃEP\j }t U11E 0 EuU 2hj+ vELP ÃtmEP3腀 u*ELPsl u}Ǧ*U 8/uxuhw þ;tEp0s EPEp0jUR EjEPURELPWE

uՃ(t>h" w(S t 0h w(h" =tP4u8tw8w4hi" u th;" h+" e[^_ÍvU WVS}jEP² X|GWEPv tWELPv u EKy1e[^_ÍvU WVS]u t>uth;tc߰҉‰URT ǃuhZjg! vVShEPW vV; ǃt S=U e[^_ÍvU WVSEU EP8tI8-u"UCj=P= t+@UƿrtUCChEP- uE e[^_ÐUWVS}uh&: vh E PhE P uEEEEJ ߹u E P ߹u EPSEPEhEPT ÃuEPS EPS 1EE v߰ЃPR ǃuhZjh fGSW< WVv WFS jSh uCPVFSV1ƃhEPs ÃFEPR e[^_U WVSE} t\8tWtS?tNƉu*SWrs t>,u;tFCFuN,hEP Ãue[^_ÐUh h`hhhnU jX\ U WVSEp0ƃVEnu~ou EEj=Vf6 t@] ;tdװЍxWRV uы<t<=uÃ;t*U{ tUE;Cu [ +vC!v=uVhj  v1hVƃEPL e[^_ÍvUSUM ˀ:tB:/uz/tBA:u)؃~ y/uA[ÉUtS] Sut3EPS uE%f=@t1Shj@9 01 PShj@ v]ÐUVSu] u#13*3Vl t;u=%e[^U WVS]u1;nu{ou 1؀8tv8,uF@8uPxJ ǃuhi 11؉ @Fj,P3 ue[^_ÐUuu uÐU WVShGj/E 08 PuE R tv11E1B2w4$D)"E@ #hLE PEPFu%=uh`j / trjj tVkjj vupO Åu P3 t=tj"jhG׾ Shj"jh軾 Shj裹 hhh}u jj uhj jjR jj uhj j_ }uh j_ P_ Cj j$ u 8t&~˃hhn V0. Pjj u(Rh?j7 vU=tGPhhn0 j6R Uuu uÐUVS j? }hI Ãu E PEPB+t$j P53 p8t5h>j' v=ph`j =(t(PRhj (j P5M ,8t5hjA =,8hj(   h*u uƒZS)EE =(uh@j hjAO ujj-O hjO ujjO hn[SG }uEE E j(&$vIj)joD gI=l~z= thlhXn V+DjU) %= thhXn h`jhj7,&!q"jv= thhXny jCj( = thhXnD h`jhj+V"$&j4 V'=t5= thhXn hxjhjc+jVy@oVBX +V " %j3&jV2@ (Gj'jB M}hVE 0E  Vrà thSV*M}uv?Gj]'jB M}t`hVE 0E  VTrà t'=t V9ihxSV*M}u~"m$j2=t%j7Uh`hh h`hhhn j7UWVSE 0UNM9-wP@ ËE t(}@P@ EEujjS vEU:vMuUPh >ЃP? ujj -MB6P=C %}uE-EEUMEEE82}tUM u؋U +HMe[^_ÐU@ WSEEE@E$E쀲EEEhPhh@N t7}tEEEPAv 40(EPhPPPv 93$װHPhR~ WnÃ=t WehxSPy&װHPhR WLnÃS2uWhhno rPP@ UװHPhRn P$5t@uPhhn hpP]%װHPhR cj-=t 0jvװHPhR~ hhh@h`hhhh h`hhhhh@h`h|hhhn PװHPhR޴ [PPxװHPhR蒴 uhhn$ 'vPhhn װHPh"װHPhR wװHPhR³ ?= t"hhnT  Mhhn2  /vװHPh%RF j]+װHPh.R JװHPh3Rʲ uK=t"h9hn` YhMhn> ;vPh`hn [_ÉU WVS] u~=4vhphn hn%$ 5hhh Z h@ u=  t@ tC ЍP t  u H8 t8 t@Sh K^48u$UREPUR  EUD4h 548u 44= /uEPURh 1h EPh{hS UREPSFFPjj@URc }v4hhn> ~tSFFEPFV)‹F4UR EUDN~uFPbn [^_ÍvUVS]vC; t; tu n;\uC;uhhn L;'t;"t CF<C v CF8t;uCuPhhnJ K; t ; t;u؍e[^ÍvU WVS]޿tjhSA uU +;/uU fU fB} ҉ЍD;Erhhn j,vSU Rs ] ރ;t#C/u;/tF;uN>/u] ;tsCC;/t;u)u>.uNSVd8 )uƒjhV" uNE @9vN>/uSV$8 뉐e[^_U<WVSuVdÃ=uHd= u ;|V$DžEPSVR} ʉˉЉU9u[13P0EǰHfE tvDžR"ÃuQG$RP>3 uhhn7 dV#uhdVh3hn DžhVS hhS ߰Hډv=uJd= u5;sst{C=~hCPRh8hn =CPCPP R SQ P ÃR^"u&hThnd Q=2 hj PR> QPitCs.;shThn R1 [^_ÍvUVSu ]FP-Cƒ:t= u <^v?B:uf+SfS=t!HdrC ^%uU(t@tC *C Fw$FPh`hn ;vC @6C =.C #&C %6"%u C /vC e[^ÐU,WVS} EEEME9s4;sC9E}E{ tE{ tE ;]r̃}tE}tE= t9Eօ~gfffvE)ƅUMTUEQ}EuEE|8}E19EU9UtM IM܋EE@U= t$3MQhhnt C@EfC}tDS nyn;n| tnnhnR- fCshhn }tBS nyn;n| tnnhnR- fCU܍;ErhThn `[;]}G ny n;n|nnhnj %- C;]|EE9EF;uoe[^_ÍvUVSuVoÃtf= u;t=uJdst2  C'C@PCPh(跺 v1e[^ÍvUVSu uRÃt1=uHds= u ;u!3!u fF@fF1e[^ÐUUE prM U=(iu=(tjh@%; h\u jR"ÐUVSu =؍FdsB= t&P}uKPhUhXnN uVhXhXn8 ؍e[^ÍvU|WVSu}=ЉUE Hdr&=VhahXn } u=(iu = =u/E Phv]Sb7 ރuU RVXE PT!ÃtSW#PVL t$WU RV#Ãu SSKEx[^_ÍvUS=؋E Hds)u!t`Hxt P$؋]ÐUVS= th{hXn荿 jh Ãtl= t_hhXn\ HvsCPJsdsSVS$ u;5tVÃVrq=tS!PhhXn裾 {uSSS#$SPs C  [uF;5tSe[^UWVSEEE HdЉUEP ǃt3MwƃuhY9tEU RƃtM^[t9uEu^9tZ}uWqRWp" 7v=tWS PhhXnC WcO1eEt"t F;EuUt G;EtM}E$N=VVPUREP}uWQW! vWNURE PURÃ}u SPK=ASt}u Fu hu)S# h@h`k jDžƅƅffDž xt%f=@5d!A h@ l u%荡0 Phhn: =ht5h@ h@HuihIZ5`R5|[ Ãh\h. PIC`)‰S U-=t%f=@tÐUWVS] S ujSEPUvjSEPU҃hEPS E߰Ҹ)PhS ߰H rr5l5là t)su5lvEPh hnJ t'sHu5lURh`hn 5lǃ0C=v!hCPVhhn詫 ?CPCPV覫 UR3V pW5lH5lÃ5lGǃ Z[^_ÍvUVSuS{ ؀8/u8/t1vPV>Ãu1%3hPp t8uƉ؍[^ÉU WVSu u tbpp5lFЍx5lÃt!C9uWVCPk ủ1e[^_ÉUWVS=t?}} ]9ff;tVSLVS 9r81;u -]=tSh}:=t;t=uCCC)CuS9C $9= thhXn Ct= thhXn SC $9s!= t6PCPhhXnʨ = th?hXn謨 Cƃ;S[^_ÐUS]fC $fCCD=~;Hf+HfT5dhjQ襧DCPSDP DHCУD]ÍvUHf+HfT5dj5DQ+5dݴ `DU WVSU] 1BCjRsVZ ȈCfC $fCe[^_ÍvU WVS}] uW9tV)ySh`hn j%RP7  %GthG P7 Ge[^_U WVS]{uBhC P3 C%=hhnR C;C| C맍vsD3 EfxtP)9~(=tFUBPhhn *vMAC9u΃u1tduuh>KS+ƃuuV薢 EPV虢 EPV uVy cWj$jEPD G +G @th>WX5 e[^_U WVSu} WÃuVWh 9>hhVw} }NVhIhn; hn \0 PhNhn 1Iss5ll0 Njs ~SPW uL5x5|hhn艡 躔0 Phhng 0j=ukSPP( uL5x5|hhn F0 Phhn 0j W P [^_ÉUutÐU,WVS}u jj豟 Ãuh<Mb)Ѝ)‰{EC=hti}܋FENMb)‰UFENMb)‰UfEFdEFpEFtE5hj$jEP4؍e[^_ÉUMMb)Ѝ)‰Ћt 9Htu1ÐU(=@#th@ =@#th@ u( US]t;tr1'15ѡt 9Xt @ u1[ÍvUVSu] t;5trVh* t:15sC =t!9suhC S6[ ue[^US]t;trShR :15t9Xu@@ P @ uShn 9]ÍvU WVS]jƃt]CB;/t ;t9r9t;vt(W66) utCu vu1[^_U WVS}j/W ÃtWH/u1~tWh 8e[^_ÉUVS]~C9v7)ƃP3V j 9t#N/[S9wʃVh d8e[^ÍvU WVS=LtLC L1 'j$j蘛 Ãuh 8E$CMQƃub} ujtEPh 7MQ}ȈC[Sjj/MQs @PǰȈCsFC^ Mt6E PRƃu h 7M KFC^9v} t0E Pth 6SM Q6؍e[^_UVSuf~th' Vh3~u.~th: VK3~thW V43~tvvÃuhs V 39u)^S~t8vS'v[t9suFCuh V2V6LF 5Le[^ÐU WVSu} WÃuh V]2;^tVx^CFsj/Wr X6% S‰߰ȈFRV3,P% uN fߍe[^_UMQ9Ju AB/vRvRt9JuABuh Q1ÉUWS]uh 4߰H9t 9)$P ǃuh X4SW e[_ÉUWS]߰J [_ÉU\WVS= th hXn =Hh" EP& Eu9%0r Ph$ hnҗ EPh@ 3E` ;=twEvWÃt's FEPC$Pj3[uG;=tvuE;=tvW#Ãtj$SV4 EC$EC@ F{t C@ F{t C@ F{t C@ F{ t C @ F EPjj$VE[uG;=tb1;=s?<u E@ EEPjjEPG;=rE EtEԡEȋEEġlE̡`EСpE؋EPjjEP蠕E@ @t9=0 Phm hn EPh 1EPs( e[^_ÍvUWVS}= th hXn蒕 u[t%H jP謔 uh 1jjh ItjjW?p Ã}6K0 Ph hn Wh 0EPS/ }60N Ph" hn讔 Wh@ e0uVj͓ Euh :0VEPSe |jEPSO }6u0 Ph hn" Wh /(EH=w PU=wPPB!t RhhnQ jv=lth hn) jvh`u4=t5h`hXn h)h`7=`thhn詍 j?v @t=tPhhXnr tPj蝌 uh)h8hN =`thhn jtPj uh(dh8h =udUWVS}u`=Xt)}th@(=01=Xt j=(Rt=(rt =t]Dž1Dž`=u3hahvhhh hBhn蔋 hMhnz cfel#t+SVhfhn2 lfGC~hohn hqhn hnI 5hhV h@ u t@ t j?vV7J Ãhhnx ;0u Shhn< hhn* 5h hn hnn 5hhP h@ t jmIu \Kv t3P5 װD=dtj5)jj5Zd T=Tu-5hOhn 0v0! pA Pyu.=t5h`hXn豈 h_ ;0t&Phvhn胈 0L;`u;ltXP Phhn2 h`׵ Phhn 0  0 =t|5\hhXn躇 xu4|\V+ Kh|~^\B9|}M+|K=t#~PShhn KxV Ky=u=0h""tu,xt#~Vg Kh`2h` =`t`jh[^_ÐU=`t$=u5xh@hjм xzt|=`t`jh.ÉU=,=0=Xthhn虅 j/vfE,HE=dt,HPj3(AEPhm5T] }"sx0 Phhn ÉUhd農 PhhXn =hthh蒲 PhhXn迄 =tAhXhh5h hn茄 hh?hnr UWVSu5x AEyMb)‰UAEy)‰Uyd%=`(&=  =N/=@ti&v== =tPVhJhn衃 w= VhehXn| |=t3Vzt @YVhx Cv= tVhhXn 5|Vf $hh=$u%= VhhXn赂 jVh 0}v= tVhhXn| =t= t=u V1 PVu~ }nu0 PVhvptppV脁 PV苁 EPV} WVm = tVhhXn輁 == t Vz p(PV& }t0 PVh@.ptppVȀ PVπ EPV} WV (= tVhhXn =t= t V趀 hhV[ ‰|iptppR!} P5| h$h5D EPV<| WV~ V|s0 PVhdhn( 01e[^_ÉU=`t=`tÍvUh\h\ÍvU VSDž=`uhR=xlth6=`uhuR`1;5=,u  PP} 9 u wH PPSUDž~Kuv H PSEDž|u r PhU ҃Hu w=F;5}A=,u t SuF;5|vF;5gh`*uH u=v4=`=t55xhhXn=} ~" PPEЃh`r `[^ÉU=uYu u5 u=o0? P5x5|hhn| 0j&ÉUE jRP5 uCu>o0 P5x5|h@hn,| 0jvÉUU$E $=~/PRh 5xhhn{ jovRh  U5xhhn{ j4US] Su5s ]ÐUS] h]ÉUÍvU WVS;}h P61;p} p DC9|=u p5p 1=dtVPvVP5T Ã=XuB;p},~(=thhXnRz p=Xtu%~ip 9t]=Xt)ޅKDvt%= tp PSh hXny ؅} +hGhny <t5<t<t h^,hu 5xh5|hhnTy =u hCu jp Sj5 =dtjS?&jؙRP5T 1Ƀu ȅt/k0A Phhnx j4= thhXnqx =Xu10@0PEPrtp PWhhhPp h5EPo \e[^_ÉUS1;p}! pv DB9|=dtp P5Lp P55T? ƒ2cj0 Ph%hnw jvt,hh@Rhhnv jnЅ} p= tPhhXnv ]ÍvU=T|=dt35T> U WVS]=S{ltJs=l=u(= thhXnu S\=_ShPh xPhwvV11󫋅CC C CCCC fC "fC"$&(C(C,,CHTC0XC8\C@`hdPPl kuVxu 1LClC(S,u uG=v@C %f=@u1=(u1C(S,uthǪ (=(tC(S,щ‰ȉC(S,,Hwy$ C C(C,~,Qv1;}DA;|0xu C3h!=tC$C&=t S[^_ÍvUVSu>up<=t8Ph@hnr |t|hahnr hohnr l=lwT$(hx6h*5lh5lhhhn&r H9tP5hhnq hohnq 1҃>t+1;}! ,u<tB@;|Fle[^ÉU WVSxz|vExlt'pURtUB;`uًUH$v1ۋE;}5ǁǤ<;t VCU;|pEPbtUB;`uevE UB|Jt|>x<2xP&ha' 5`hy E8=p~5phhnp p[^_U WVS]1=u ;Nu3_ǃNuIu!5x5|Whhno 1e[^_ÍvUE Puhnnr USM] KxvAQKy[ÍvUSU] Kxv BJJBBJKy[ÍvUS]M ht89e0|`st# lt4NwtETPCEvuRQ=vuRQM uC1Ҁ;u]UEPhEEU WVS}j/W tXƀ>tQv>/uCW3Ãu'jW0WiÃS K/F>ue[^_ÉU WVSuF thV9N VPS 6 V@PrǰȈF0VLPSu[^_ÉUVS]1svF@t9uuhSsVhhh@ @e[^UVSu] =u9SV i }(_0& PSVhhnl = tSVhhXnfl e[^ÍvUVSu~thVV1Ã=uGhS!h }2= u)N@5_0肼 PSh hnk v= tShhXnk e[^ÐUS]{th)S"{th@S Kc߃SoÃ=u5SPg }%^0һ PSh hn1k v= tSh`hXnk ]ÍvUS]{thpSrKc߃SÃ=u4Sj }$]09 PSh hnj = tShhXnxj ]ÍvUlWVSu} = t=u W&j }uA=WVh L]0虺 PVWh}=WVi ÃEPV-e u3}t-jV5h uWVi ÃuVh }C\0 PVWhhn_i 1NvEPh 16v= t%VW/}u&Ph4hXni e[^_ÐUS]=u=jhSh }&\0[ PSh`hnh 1#= tShhXnh ]ÉUS]{thSKc߃SZÃ=u4S_c }$p[0轸 PShhnh = tShhXng ]ÍvUS];ts'St xt@u C;trۉ؋]US]v#St xt@uKwމ؋]ÍvUS]u hhnYg SMPh hn=g 0s,Phhng {t!sPh%hnf {t!sPh7hnf {t!sPhLhnf { t!s Ph`hnf ~{uyPhhnZf shhnEf SPh]ÉUS]@ @ B@ CthR C thh@ ٹ Cthh@ 边 Cthh@ 裹 Cthh@ 船 C@thh@ m A ]ÍvUVSuV1ۅttCdrVhhne ؍e[^ÍvUVSuVhhnd hn8 hHyPZ vhvh@ uI t1hHyP  uvh uytnayt1e[^UE Puhng =u>h u)h u vjvÐUWS]߰P DtSP DhLj =@| 1e[_ÍvUSh=xh]Sb x Džxx@PjjSx@P_ 0tQhS5x ~0| uRP5Dhj U VS=|h=$tP |u.=$tPhj va PB uhUj vj@5D` Ãt/5DVu j CD v0h, ÃuhhxSV0|@PhD8@0}V5Dhv5Dh hn` p E=~EE vE}~%jEPhh5@b] |˃jEPhh5@=] E jEPjj5@] }h@  EjEPjj5@\ } hc ٖ e[^ÉU WVSu>t[Àu5vS萺 vl4%u_t-tWhz 1 F>ue[^_ÐUVSuu Vh hS t SVn[^U=tuh h CtÍvU,WVSu h j]St Sh  ƃ |819}0v)PEP5@ ÃU9|Ӊe[^_ÐU,WVSu Vh j]S ߰HPS5@N VEP5@8 h e[^_ÍvU0WSuh j]S ߰HPS5@ e[_ÐUu u5@ Uh AÍvUdSu uh jP]S Sh ]ÉUVS=tt12vh h z1CFKve[^ÉUSE |3Puh hS Sh vÍvUWS] ߰HPS5@ ‰߰H9t9u e[_ÍvU,WVSjEP}Et}FuWhSSuh  bOÃEP }Fu tVv}AtA]ډ߰ΉЍ\9v K; uEPh!1`EPM [^_ÉUjEP5@ tEÍvU WVS}u ~< u C0vCNh@!Whi! e[^_ÐUuu uÐU WVSu1%Cƿ@%t*ƿC%tƿF%EPs]ushI%! EPs}u~{Ph ǃuh`%j8 sW EP1ۃ EPW<utރW A Å1e[^_ÍvU\WVSuDžDžDžDžDžPPPV l_DH~|/tPPPVW VP uhn%j j@VV ÃS{R Huhn%jb )PV2CPK :QPVkK 􋕰R1 DH~|/tDPPPV RV5 SV t$PPPSuIu@QVؿ Phu% 􋕴R. L􋍴Q u uDžDž# uhn%j聇 j:R3 Ãt<Q2 uh%ĉ CjPjjjPjjF P=P3 Ã0uhn%jӆ vjPj S tTPc t8Sh$ jPj.SS #1t u'jPjjJ u1ۃRa5O th%X v=th%Z EEEEEfEA vPB0]EPEG DžDžDžPRPjhSN Ã0uh%@c vS DžDžCQRjhQh8.jSЃ th%Sa .jtEPR uQPh%莆 z R P PBЃ CS@1[^_ÐU WVS}]=uh'=uJj@PL tj@PL uh&j- $&Kv}uNWP u+<t }t%fj/CPK Eu}ShJ$hV3 _;.u#{t {.u{uVS47j/SAK EuVS4u1vEEE8.u:xuvE8.u$x.uxu@/VS24랃VS4tЍX}ЍxD=W~uWEPFP? D>!v3/WEPD3P? De[^_UhE Pu* Uh@&h&h&hn1G j7 UVSu] u#13*3V t;u=%e[^U WVS]u1;nu{ou 1؀8tv8,uF@8uPd ǃuh '~ 11؉ @Fj,Pݙ ue[^_ÐUSht'hv'7 Ãt6u ujo Ph'SE S 1]ÐUWVSh'hv'҂ uU88u1hv'h'j 1h'jm 􋅌P 1vDžmW88#F8 =8 4h'P< Ã; ; t}h'P ǃt ? t? uWTh'P ƃt > t> u V'vj jS迕 78"uSzh ÃhWCP< ƃhVP; ƃǃ PhcPa n􋅌P7 h[^_ÍvUWVSh'hv'腀 Euhv'h'EtwvstctRWV3h'EPB =tWVh'F{ PCPdEuEPX }u/hv'vB uhv'h'j 1e[^_ÍvU WVS} ue ƋCtoVP u^u=t=Vh'*WP u/=tWVh'Az hCPA uV藬 e[^_ÍvUStPm ؃u]ÍvUuh (jh ÐUuu uÐU,WVS]u DžDžDžDž|Dž#vǃ< $)52Dž5Dž5ZfDžt5|P Sv5|P/vPPh5Z 3vhK)VS.S9tSPt| SS& |Dž tDž Džtt urPWq: uWh[)jGt u (u ,u$fPhc)!ǃtlhc)tBhc)thi)jG%t {Phc)ǃth)jGt v|PPP@= }Sh)jGs j US]S) t@Qڀ:t.=wu`%1tC;u؀;u R" Rh*jCDt ]ÍvUS]St@Qڀ:t.=wu`%1tC;u؀;u R Rh*jCs ]ÍvUVSu1ۺ<wCjEP5y ƒt |E8tVh*j@ps e[^ÉUh*h@+h+hnm< j@s vUWVSE Dž\8/u Ph+h`S Eh+S8y XuSh)jBq vDžPDžTELvPtPP蠦 jj\PjXPCÉP u\TPh+jAIr vR vl4%@tCύv;cEPEPEPEPEPEPEPLPh+SG 0t\TPh+jAq 1ɋTuƄ]9fVA~TTDžTEHPPi jj\PjXPUBÉP0u\TPh ,jAq vR vl4%@tCύv;oEPEPEPEPEPEPEPHPh+SF 0t\TPh`,jAp 1ɋTuƄ]92A~TTDžTEDvPP5 jj\PjXP!AÉP0u\TPh,jAo vR謓 vl4%@tCύv;oEPEPEPEPEPEPEPDPh+SE 0t\TPh,jAQo 1ɋTu]92A~TTPP XP ([^_ÐUVSu] Sj蛪uSh)jNm 1ۉڀʀvR l43ڀʀvRR l43C~e[^ÐUWVSut Eujjm u>nu~ou EEj=V變 t@] ;tdװЍxWRV uы<t<=uÃ;t*U{ tUE;Cu [ +vC!v=uVhl-jSm v1hj-VƃEP7 e[^_ÍvUSUM ˀ:tB:/uz/tBA:u)؃~ y/uA[ÉUtS] Su"t3EPS:1 uE%f=@t1Sh-j@l (0) PSh-j@cl v]ÐUuu uÐUWVSu] DžXDž`Dž\}XEv7w|$d/`pv`dv`Xv`P\Php52`(v5F EXh.SVX#\S)ƍt`;PsWW\E}E`E }uTW3Eu$Xth.j EXtuh.oj dPh/8ǃtkh/tAh/th /jG0 ǃtV K|8uIx%Dt|Ȇ[^_UWVSû Eujjng u>nu~ou EEj=V t@] ;tdװЍxWRV< uы<t<=uÃ;t*U{ tUE;Cu [ +vC!v=uVh 1jg v1h 1VTƃEP菛 e[^_ÍvUSUM ˀ:tB:/uz/tBA:u)؃~ y/uA[ÉUtS] Suft3EPS+ uE%f=@t1Sh(1j@f 4#0聀 PSh<1j@f v]ÐUuu uɞÐUVSEu ~a6h1Ff 1=t 3Ph1 f 1;uh1C.r#h@sh1e r;t3v賺 u;uvh1e rSv{ tC 8tPsh1 sh2]u3h@s CNTOe[^ÐUVS]5XOu;TO=du} u XO=t;Xt8t ;Xu8uSh 2tf Ku#=sthsph1\vph2\uTO5XOe[^UH{1hDjÍvUH1hDjÍvUHd1hDjÍvUh@Ih`2c rUhNh2c rUh_h2c rU WVS1}uEU BBG}h3E PEPϺt(}h3E PUR譺t}~$E 0h 3c rvE XHMPܾurU 9Zt 9ZuBBE 8atK3=`ItF3P3tH=htE p)‹E Pt"=TntE p2+‹E P1ҋE 9XuM9HtRE ppVbE ;Xt pF e[^_ÉU<WVS}>hU3E PEPYu"E 0ha3a rE h_hRjQ hn =`n>u_=_VE 0=u=r;t;vR vl4%uC;ù;uxtdvvR輄 vl4%t)vRy l4CGu=htSo'Ã=TntS)Ã19u =NuPSVK3=`ItF3P_=_u>=hnt5NNhx3h}3кt_Njju ƃ5Q;uz=dO=_TE 40V9=htE 4P&E =TntS'1ҋE ;u =NuRSE 4K3=`ItF3P^=_=hnNNhx3h}3藹t_Nmv1 󫍅Pjh E 4u u+E 4h3_ P =_7E 0=ht7$v=TntS&19u =NuPS7K3=`ItF3PV]=_u>=hnt5NNhx3h}3Gt_Nt ?PF;uPj賚 _[^_ÉUh3ju u4ÉUi i3t3Rju uÐUWVS1Dž}uEU BB}h3E PEP辳t(}h3E PUR蜳t}~E 0h3[ +vE HPPϷur1BvE H)=rX;t@vvR vl4%uC;ù;E XtdvvR0 vl4%t)vRzs l4CFuE PtH=htE p!‹E Pt"=TntE pj#‹E P}PE p  }u;}E ph3[ 04ii3vu,jE pltf9 | DžRW1ҋE 9Hu 9HtRuE pph35gii 9t P迍 [^_ÉUVSj `nxXn XnhXnj U hXnw =_tm=hntdN5hNh5hh}3ݳtN5hjhn[vN5h_jhn3vUWVS}>h3E PEPu"E 0h3HX rE h_hRjٕ hnv :u_n=__PE 0ò@=rgGӁvR{  l4%t*ӁvRo l4؋Fu=htV/ƃ=TntVƃj1;u =NuPh3PVh3>d =_u>=hnt5NNh3h}3英t_Nj5`nu 赮TRj _[^_ÉU4}t3ÍvUS=ht,5_A2=hu4Ph4U vh(4=`nuHj艁=ht5_h@4U he4jN5`OPnz48tR5lI%Ph4;U 5NPh4U 0h_hNh@sh@Ih4T 5dOP5NP5hP5XOPh 5T 05hnP5`I_Ph`5uT 5I=Ph5VT 5rP5rPh5%T =hthIhrh5T h53=Tnthdhnh6S h65iP5\n5duPh@6S 5iSPh{6lS 5r4Ph6MS =PO~Ah6t1ۃ;PO}'vIPh6 S C;PO|r]ÐU WVS]} u>%buCh3wG u<uh4w# u7h6qR &}t61PEPh6FR e[^_Uh6hhu u1rÉUh6hru u r裻ÐUh6hNu urÉUSE] u=d%dt3h7lvh3s tkh4s udRj EPsO ƒ~E8tsh@7Q rg\nd5dPha7P =dt5\nhw7P h7dr]ÉUh7hXOu urÉUh7hiu uurÉUh7hiu uQrÉUh7hNu u-rÉUVS]u ~6h7=lI%lI uSh3vO ulIu'h4v# ulIuwj EPvr ÃwE8t!vh8=O r=`Ot5`OQ Sh'8h`OhvhGh PnlI=lIt,=Pnt Pn8uh@8N lI45`OPnz48tR5lIJPh4`N lIre[^ÍvUhw8hdOu uArÉUh8hIu urÉUSE] ~3h8vh3s[ udh4s4 u d]j EPs ƒ|E8tsh8ZM rmd=d%d=dt h %hdPPPh8L =d%r]U}h8E PEP;t}~E 0h 9L rbE ph&9Du8=ru,=XOth@9E phi9uDu dnU WVSUu  BFt6hq9K r~FPѧurvv }"vh3rL rLvhSD4 tSh9cK vh9$L r;~t vo [^_U}h3E PEP臢t}~E 0h9J rE ph9CÍvUS}?h3E PEP"u#E 0h3J rE h_hRj Ehn蹌 ;u_yv=_tmSE 0tXSh94B=_u>=hnt5NNh9h}3ͤt_Njju ÃZEPjL _]ÐU}h9E PEPנt(}h9E PEP赠t}~ E 0h9I r0E ph:-AuE ph :AUWVSE] @C@C:~3h :H r3G:1t ER:uEM:CEƿ:t"CP6urCEƿ:t;8|t6CPtshW:u r.jjh3ssEP=U hXnif E9Cts{ E9Et EP{ e[^_U WV}h3E PEPўt"}@h3E PUR诞u$E 0h:G rvUE DEEE Du:t2E8|t*EP蹢tuhW:財tE ƿ:1tҀUh_hRj) EhnɈ uEwEajjEPE 4uM:}tR:PS =_u>=hnt55NNE 0h}3ߠt_5NG=_t EH9fEPjd _U9Ut uy e^_ÐUWVSjj$ jj ǃ ÅZS[ C~jjڂ jj΂ h:{ u Dž:j/P Ãuƅ-hCSP^ E޺:1t tƅ+=dtP hXnc }~)j5 ih:PW jPPWh:D rjE ~Vˆ9uPjw Wjl uh:gD r vr[^_ÍvU\WVS1}h:E PEPʚEv$E 0h:*C rvE ph ;=;}h;‹E PEE ph;:us}VhXnh$;9H hXnXa hnjO]SI ߰DE X EE p h.;:Fth6;x )u}uE p h.;O:he[^_ÐUSXOXOhD;:u&=ruh`; h;9XO]ÍvUShSR* tSh;qA vh;3B rÐU}h;E PEP諘t}~E 0h; A rSE ph;%9u8=ru,=XOth; E ph <8ÍvU}h;E PEPt}~E 0h;h@ rSE ph<8u8=ru,=XOth <_E phI<A8ÍvU} rE pph<B6USE XOXOp<}u<P 6XO]ÍvUSE XOXOp<}u<P5XO]ÍvUSE XOXOp=}u =P5XO]ÍvU=htjj5jh=htjjjS{ vU=htXh=5=xt5x趘 xh=`nu POÍvUUE ~0h=`< r*u@h4=Ph.;b4Uj蔥=`nu jg=ht s  sjgjh Om~U WVS}=h==E PEP u!E 0hE=; rE p~Eu+hX=hXnZ Urvv}u hl=Ex u+h~=NhXnY r1h OW}tr h(pjx ƃjf Uz tM=huDh(4hXnBY jQfVj.x rvh=h_ Ã~-_)R_Rh_w E PEHPUBЃ=ht  s  sjeVjw e[^_ÐUh=hru urÉUh=hru urÉUVS]u u%hh=hrWhhrjvhrvR ru IjvhIJR  Ie[^U WVSEI=ItEU<t~];tav11Ҁ=rtB:ru;U}.I$Br<t:uG;U} IFuFC;u[^_ÐUS}u'Tnh=LTnr}h=E PEPat}~$E 0h=7 rvTnrj 5 i|T Ã=`ntC; t ij SUT Ãh5 ihnP C; thShdP ]ÉUWVSMn1E1U@~<$t<\uRF:tX~0~>@95F:Ft(>ύD(L(A9tF:uE F:tE}t,9tA}t >tF}t9t >k}u9t Ed=dE<[t' <$`<\X~SFHF>$F=wu`%1tfF>0uU:XBA:uH>ύ|+T+܉߉}E;BAE;8u>>,>]}}v>\uF>$u{F=wu`%1tVF>0uU:tSBA:uFv>ύ|(t/T(܉lj}];tvBAE;u >tFA>t>,t >]V>uh=vEN}t& >\u~tFF>tɀ>]u>빉F<,E<]N7vF=wu`%v1tVF>0uU:tMBA:u@v>ύ|+t)T+܉߉}E;tBAE;8uAF>u=t Eh[^_ÉU1=XOt>PhNu uYrÉUh>h`Iu u5rÉUh,>hhu urÉUh;>+u2=ru&=XOth@>hj>*u dnÉUSE] ~3ho>w2 ruGj EPsI щƒ|E8tsh>/2 i ii iuh>BiiRPh>1 ]ÐUh?*ÍvU WVS=POuh ?}hN?E PEP t}~E 0hY?n1 =Nth?jE pPOIPJ POIuTIOch??rRIPON4IPOr%vPODI@IPO4I_tjnOyWv vnnQ؈< u$PO;IJ~HF_unvNyV vnn tuЃt2nHyPЉ  t뮉nn uh@re[^_ÉU1=XOt(@PhIu urÉUVS}h>@E PEPņt}~ E 0hG@&/ r;jE p舋ÉփutVSE ph[@. re[^U}h>@E PEP7t}~E 0hG@. rLjE pEt)EP+! Pu- PE phc@H. ErÉUE pq@}~i@PO&ÐUS] h3jSuntssh@- ]ÍvU WVS}h>@E PEP4t}~#E 0hG@- rE PUPgurh@Sc Ãu@߰@P_` ǃuh@j7- vSh@Wm d5XOXOdjjh3E pWh3@:0W` d5XOE U;Pt p` e[^_ÐUUE 02? ÉUWVS}HUzTMyu60Sb S5iz} U0HDž;Jv߰H9s42:u,MB߰H9s2:t;sM;Qr9vJRVScD S5ixu_X `nxXn XnvhXnj ] hjEp0k UR>[^_ÉU WVS tE}ЍpP =P tFװH9w&VREP u3EPt;uEPu EP|ÃjEP8tÍe[^_ÐUWVS]j/Suƅ.ƅAv9uƅ/ƅ )VSSB Pq u rsCsCtHS9wbHPSP: u2SB uh Cj( PPxrPZ Ã9PZu Pu Pà jPsrÍ[^_ÐU,WVSuDžDCDžDžDCDžj/Vuƅ.ƅ4K;/u9w)CSVV@ 3=dnuh"P8| =!tj5!xqp!_Džk=_ta;u_Pj/St@v؃PA uh`Cj& vP5!pPjP~Ãqt hCA& vPh"\ dno1!;ps{JH9w@HPSPA uSPoF!;rrPu PÃjPoÍ[^_ÐU WVSuNj_)ÃS7h_h> ƃ_)lj_rr*O*h=OE*;ru5*;Ou(Pr4h&$ u E&5Orr4h&= &O=ruEPRr0gƃV װЍX9rvC~3TvRG  l4%tr9rrV D/wr$CvEPh&%U=hthC8vEPh&?%EPh&%e[^_ÐUWVSDž0Dž,}.hDE PEPQzuE 0hDavDž444;PO}"j IPE p uʋ4;POu$E phDU" rh_8PX 4I;I0vRF vl4%@tC;}̾_;<$t<\CC=wu`%v1tZ1C=wu`%v1t|PΉKE9|nE tVW E |7{iuJDž,C0;U}9E 4VW E 0<ЍtF;t C;dr0CdǃuhD=ruhDr t&=huhDr=XOth_rr05iGЃ=htDt> `ny `n;pn|XnXnvhXnjR 8Ph_vV ciErE 4I;t C;,t00;E1[^_ÐUWVSDž|DžX1DžTEP9 duhEj( jh#EdRF ud`Njh+EdP ud`dQh2Ej j/`P_; ƃt>u URh`E Ft>u MQhE j/V5\t\\\t \8uZ URhE| } M Q&8 Xuh Fj jh#EXP u X9jh+EXQ tE PhEFX``t `9uE PhEFF/j/`R9 ƃt>td`9[u)j]QÃtC`;:t#1 j:`PÃtC=dt \RVS`Qh`Fl tڀ:u_}1EEtPEPR`P| ËtTtWS/| P`QhF j05 P`PhF} l}tvStp pp| |u't@tuhF/ =h\Ott[t C;Buu\Oss|P.uBt@tudj"jjj]Wssp< WhF ntpp|P}Ft@tt|PX `RhF0 vTQz XuEPhFvU RMQhF VFXtFPhFh|S趟 h PS|P X ;hshG [v|1󫍽|G|9s(jW|PW ? tӀ? uƅ{j |P56 ǃGjhGW tWh!G|1|G|9s-jW|P-W e? tӀ? uˀ uƅ{||vR1 vl4cujh;GW tG?u?ttj W25 pj pPW, hh=h=hp8}vhhhh\Q l}\PhLGb 9Džxh`sYt&xxPjU hxjT xhh\nÉjav hhh| )hǃht'hQWlPT 0uȃ=dtu=iulH# `ny `n;pn|XnXnvhXnj#I \n;5h u;hvhXn4 h|P|PgT h=d=i=h=h\n;h uF;hv> `ny `n;pn|Xn#XnhXnj#H  `nxXn XnhXnj mH hXn3 htheG vjft=XOthyG1xPjR |PR lRR XtXQH dPH 1hG)\RhZG< `QhG  |t|PcR XtXPTH dRBH TtTQ3t 8[^_ÍvUjD}hG hXnk2 jh`sDVULWVSEh nUt!=ht jjtE@$vhj Q hj P hH.I hHI Dž uvDžDž1DžEU 43- uh@Hj vjh#EP u'RP%jh+ER謽 t(PRwhj/S. ƃhfHSF tf8/ta9t 8@uEU 4hjH vhfHR t8/uDžwvt8t8:t@t;tÃj:S2. ǃt=G7v;[uj]S<t Cj:@Pj:S- ƃK;Bt3Ft->t(j/Vt@ 1=dt(PVWSRPhH h*Sye Sh*G =htjjXE]Et?t}E=Ot OEPR`=O=ht'=huARPSFdu#ShHa E@vjj EHEFEEPj=dnDž1=dOtUt>thHVv t*:thHRI t Džt8>t3u/EHuEEPj=dnt 8uDž=XOu#RuFPhH[ t*PVhIhS EIUEu t.NNE IEPjYNEPj rQ)ƒt E@RA E@Eu&E;E}j:EU 4R* _=htt jjM[^_U$S]jh+ESn tkjh#ESW tT;[u#j]Stx:%4vEPSj tj:S) u1]ÐUlWVS];[uSj]StA߰ЃPCPh+% ߰ƀ+:v߰HPSh+l% ߰ƀ++}1EEEEEPEPu Vvl ÃtMSk PVh IM u0[% PVh I' r]{thsh+$ _+uSBs ssbǃ }%[uփh'I r=htc\OvRt B;Cuu\OrrWu([tWH \h.IvssWtv{tdj"jjj-Vss+ Vh3I [j"jjj-Vss+ 0VhII W0H hWIKssh0tYB uj E EPhsW}h_Ir r<=su1EjEPjjW} }hkI) hIW`b shIWMb x =stuhI 3=XOt5_hI j~C=st5sd =xt5xd rGvEjEPhhW }=dt hI+ _ WwF 1e[^_ÐUjq `nxXn XnhXnj %; hXn& =tjhstJÉU WVS}=dhXnhI' u jWhI uhXnhI 7jWhI uhXnhI VW `nxXn XnhXnj %: hXn% =xu!hI r1vhjuD Íu VW5x 5xhJ 5x8% hI J%P5ƃ=tt jӃSjC e[^_ÍvU,WVSDžDžDžDžJhjC DžrDž1CvsHyPq_ s~6sHyP%_ sSh2sHyP^ sShhh J5x 5xu# UGuF} D=XOth JhXn4# r =XO=XO~z5uq~l= st)tu=XOu5_h`J  `ny`n;pn| tXnXnhXnS6 5=wu`%1trDCУrtjt%drv!=rDždDž=wu`%1t^Dž t#)tNs.Džv~(u Džu-ut ruE9sFsHyP=\ s =XO=XO~V5uM `ny`n;pn| tXnXnvhXnS4 hXn u6)ÁvSPht ƃtt'9rtr1t hIPj> =rt u}@=t"tt jЋ,v Pjw> r1[^_UE EE@Pjjuj ÉUji_hJ hXn jhtBUWVS\nEUhJDžhhhhi=XOt?}t9} tU :-tRhJ }tMQhJ| =`ntEPU RMQ.~ vTO;Ntj5N DžDžDž|DžDžxIhtiA=hItj=hIu=|5< tPjP< |t|Rj 3< gQj< Qhj; hj; u J1t  uDžniE 8|jj ; |hI] CSTR u?ShJmRjL; |Qj 8; PiiDž(vhIU R uFM QhJPj: Rj: r DžPEPAPs|E%f=tJE PhJ RjT: Qj@: 􋅐PmX pEЋUԣhhJtRRj: Qj9 |t|Pj 9 rhtc>i iuJtuJTOuj5iP 1|-(|#ji iQRAP: }E PhJ "iiRPhJNt&􋕐RDžxK}t|EPURh KQjj8 PjY8 |t|Rj <8 o􋍐QrMQhJtgPj7 Rj7 |t|Qj 7 􋅐PxQ$jYjj j7 | TOK1hh)~VSBPs7 ǃڃ=d=it =hE;h|E;huE;hwfEv# `ny `n;pn|XnXnvhXnj#+ \nEUډEUzhXn/ hPAP6 ƃ=d=it =h=h=h\n;h uG;hv? `ny `n;pn|Xn#XnvhXnj#*  `nxXn XnhXnj * hXn- }E PhJ)sD kE# `ny `n;pn|XnXnhXnj#* hXn \nEUډEU=dt;=it =h})E;hE;hdE;hR@ @ JyB;B| Rj m) hhJyB;B| t  RV.) hhOy􋅐PO  0=d=it =hE;hE;huQE;hwEAv `ny `n;pn|Xn#XnhXnj#i(  `nxXn XnhXnj 9( hXn B @tM QhJ@ @t.]8 thKhhjSt􋕐Rу􋅌PjP jL Rj2 Qj1 |t|Pj 1 =h=hjXRj1 Qj1 |t|Pj u1 =hIur=|51 t􋕌RXO j7rtt􋍐Q҃=h u=hv jW iiiX[^_ÉUj8\_h Kۺ hXnK jht$5UWVSE lDžhDždDž\\nEUhUKhhEhhitIpu^K%EEtZ=XOtQ}tKlt(}u l:-tlPhJ }tURhJr =`nt&EtEPlREP 0vDž`DžXDžT1=ru E%Ehtn3=hItj=hIu=|5. XtXRjT. \t\Pj7. tipIr:hj. Xhj- \ }u&lƿJ8|jlRַoj/lPO8t7B8 t-lRhJmXPjL- tj;ltcKtlveKPAƃt/}9lPhJXRj, \Pf=huh膫8 uUhlR}:lPhJXRju, \Pv=hts8 uilRN#luM=ht?lP$#lu#XRj+ \PvEu=TOtLjj؈;TO;Ntj5N跈jURRJhh t3XPjn+ \Rj]+ rw ht/ Et3i it&iiRPhJz# }t@UREPh KSt@XRj* \P vURhJ hId] }lJu$DžhXniI}url8|ugjj * ThIl@P@h ul@PhJPiIDž`(FURlPa hulRhJd Dž`PEPhBPG|}uEE;,vX=,t5, u ,uhgK,Ẹ,E%f=tiIjTJTOEi itsjiiRPhBP(* }MlPhJQtipI`C hR?vϦ1ؙhh=d=it =hE;h{E;huE;hweE# `ny `n;pn|XnXnvhXnj# \nEUډEU{hXn+ 5,5,dBP' Ã~'S5,hBPj' ƃ9=d=it =h=h=h\n;h uD;hv< `ny `n;pn|Xn#XnhXnj#  `nxXn XnhXnj  hXn  }.ͤ8 thnKhh9/lRhtK vEi ijjhP |e=i~5rgfff)ƒuthLt-LSthLb޿L rgfff)ƒuth MxPtPUEPEPEPRhFMhJWƃ 1UE% ‹E% ‹E% †Ptv޿L rgfff)ƒuth`MOMtt+xPtPpPUEPEPEPRlPhPhMhJ[ƃ0 hlp1UE% ‹E% ‹E% †PtmxPtPpPUEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPRlPhPhMhJsƃ`hlp1TtUE% ‹E% ‹E% †TtUE% ‹E% ‹E% †QUE% ‹E% ‹E% †QUE% ‹E% ‹E% †Q v޿LDžt rgfff)ƒut hNgPxPfPePdPh&NhJӰƃ uRdd:BuA:Bu<:Bu7Lt0t󥍅tPtP҉P!th@Nnftfx ІfNtLtPhLt5($hWILts=it fNt=t5 jjMtPҟ}h'I==iu3j|Pjh5Q }huN>=MtuG=I%`j`Pjj5 }hN=MtuG=I%`j`Pjj)5賞 }hN_LtPhLt5蕞} h.Iqht5j|Pjh5I }hLDž\\PhLt5}h_Ijj5̝}hN=i=Mtu[=TtuR=XtuI9\tu5EEEEENtfE`tEuLt~u]~ujjjj-EPPV t +F%PEPShNNFt t9VAPPBPBPBPFPhN }VAPPjBPBPB PB PB PB PB PBPBPBPBPBPBPBPBPFPjjhOM`u"=iuiDžX %Xt i=Mtu9Dž|j|Pjj5裛 } hkIO13v5 Xt i8[^_ÐU0VSusE=NEPEP5Ã}+hDO5  1b5 =Mtu1EjEPjjS覚 }hkIRV5- e[^ÐU=h u=hv j(9ÉUj=UWVS]hj Et%=`n6E-`n#=`n-E6`nhUh=_t#h5_CP ƃCM _ 0t0tu 󥍻s󥿠sus<U<sx@@xNDDNTOHHTOhILLhI`IPP`IhTThrXXrh\\hjhr`P ƃpE`Phr jhIqPY ƃEqPhI TnMTn hhnP ƃEPhnJ hhdP ƃ EPhd EPj =tjUҍe[^_Uj: `nxXn XnhXnj  hXn s_jhsHUWVSDžxE^KuǹuJ=htKOtNu=dIt=rt9TOtjSj=_t(hL:t _=_u'hLth`Oj=hu&hOݗjor9TOtjSEjhJhOu[hsh8j xEPEPh KJ t"xPj jjjE@E E PtPh Kujjjl joxPj6 jAEPE PhOF tjj u^K1t t=`nu j%vu^Ku=`nt j=hIu6Eu&E PtPh Ke=hIt ju=`n%PF=hIEu{E PtPh Kst[j=hIt jj=st rxPj =hIt j=`n%P=hIh|S覕 sP@ j S *}hO=st r j j =`nt jj=st rxPj X[^_ÉUVShEPĔ us@ jVÃ}hO2r tj*h[^ÐUWVS}j/W1EE1tj9t cKt eKPђƃt/})WhJ1hO1Wh@@V @@Hƀ@@.A@}0u{.uC1CKu7E}dtEC<9uE0Ejh@@ƃ}@@e[^_UWVS}=xu0h P=st rD vhhhh JS jjSx@P thOMhhCP5x貒 5x hSY sP@ tGWу j PM*}hO=st r,tBGبt#vhSGP jTu=r(u j6j)h[^_ÉU$S]{uu{uoSzufz u`9BuOEEEEEEBEBfECEjPR2 EC]ÐU\WVSEU DžDžh`PjWraP_eP`OhjP@ à tShxPh`Oܐ=`Ouh{Ph`O辐dONONIIXOilIrir\n rhPj hu hPj/1VÃu vCÃhP thPPp t N޿Pu N޿P u lIhP Pnt8u Pn`P=lIt$Pn8uhP#lIhQU Ãt޿Qu 1ۃnPz hntXOu rfnPF ĩB$(Q i hdrdO}NqOeNYrMh 5N)IXOXO3 h QPR{ S)hI`nri=h1DžPPjP# ÃtRS2# PRhQ u q0 PhxP j& \OTTÅtSe4uߊP5t qP j+hj &j:0 tN􋕼2-u7 iQP?P+ vh nt j hjM hj >  ~BP)P*h ng؅t$hj hj vS7Uj*jh n5Uj)=htv=xt/jx@PDž5xE x =|+j5蓅5A  hj=htB=xt/jx@P;5x x h sjjU4RÉUWS}Q=rD `nxXn Xn$hXnj Y  M_E< uu}h:R*nKyS EnEn} }urEP5iEǃt}ujj-ME<8 t=v!h:R膆}_uWS EWj5rP $=ir0nÃu hVR)u hjR{ t=huh|R~vhr05iCЃ=htC{t= `ny `n;pn|XnXnhXnjU {=rp=hnt#hXnnP hXn hnhh_ ujj~_HErhjO hj @ e[_ÐUWVSuu1}E1EP  P tHA8uv:tCBA8t:u );E~ E] );EuG u E v[^_ÉUWSh_I@ixr@iiyÃS5ru݁=r_urO7v=rt+irr|HOe[_ÐUVS1ۋh5I:!t:$uuxttWexhh;ru ir+ I OrR:! Rvxh i< t 2< u,B;ruߡir+IOr뼡xtt x x i< 6,< $b<"t0<\uXB;ruSir+IOr0B;rukir+IOrH AB;ru!ir+IOr;vtr<"u6B;r!ir+IOrvAB;ru!ir+IOr늉tA Iht*xtt xx i1[^ÉU WVS}"ÃR=`ntRPhRS P &>t=`nt~ t6S9P 9rȃSjSdSE E Srƃu ShRu ShR v6j hS请 Oe[^_ÍvUPPPPh Shnπ j U|WVSDžhSQ ÃuS߰Ѓ=v!j? PShTĸ1QShShS< hTST @DuWs8tShT舷몉hP5 }ƅj.Pm 0DžT!t tDž h`DUR` h`D5_` j.5_ ƃtLPVX` u5_)Ph`DRa u+_`D1j.URj ƃ1PV_ +]Sh`DUR` `D t vrCE 8u/h`D6 U chTjϳvh`DE 0 O/U :t2.T t-P@D@Px| ?\E8h`D UhTjvP@D@Px| ?cE8Wh`D U:hUj覲=`n_v@DHyPU @Dt t̓ tȃt uh&U5=POPOII16Àu*vS  l4%@u8FG/@DHyP v@Du t8@DHyPa @DV uɃH=POu/IO>vPOVIPOvPODI@IPO4I_tY@DHyP @D u ~iF_u_u"hUh`DhUt: t5$*h@T۲hTJ5@D h`U hU'yh@T菲hT育 5@D x[^_ÐUS@D@ `?@DHyPq @D Bvǃ tƒ,t`D"/\u'@DHyP  @DC@DHyP v@Dtx"uq\u'@DHyP  @DC@DHyP v@Dt t t t,u=`Du1>vC6v=t h`D3% t҃;u ]UVS=ht5_h V9v}hKVE PEPIEv#E 0hNV詮 r=lIt `O vr}~E p ƒ=lIt0=Pnt Pn8uhVjfR5Pn RE p荡=lIt>E phV.n=XOt5PnhVέ h_V@sVfDsNTONVVNBABfA_@IVV@IBfABAhV_W_XnWfsi=OtjjE pp5XO=du XOhWuetaEj ht Ãuj htt Ãt{.uKEhth WZ tEjh$WhtX uc=`ntr dIN@s6W6W@sBfABAt`Qh@Wԫ P=`ntr vdIt(j hbWht2X u hWs5XOe[^ÐU|WVSDžDž} u8PEPE PEP}r1} t }= i1Df@~<E u$#sPau E WE hP) u hWhSV0 ]E W } u<ÅurPttSEPhWvMQhW hnjOV D}u] MM } hu hWƒup}uhWc-EuhXšƒu=uhX'-hX胡ƒu-u8t/hXTth!Xê=`nueh1һ4XB;PO}I/Xt,jjP6ShX蟳 X>uۋ rQ)ƒt tt} t=`n%PXOdhXS HSn =Hu"uhXmX5HhhDT u5H/ Hjj hD tD[^_ÉUS]=N=hu ShX hXns hnhP觫 u1yvR vl4ntat#9pu3NhXtlhSh Y ÍvU@WS]=dOtg}1 EPjh 3u}u 3hCYuEP1!E0 EPae[_ÐU WVS=XO=du XOuhQY|upj ht ƒttBj EPR蜺É֋E8tUvR vl4%@u*} t=du htj=XO؉e[^_ÉUlWVSXOE rME=duEXOuhYY蒚]ShaYhttx1߰ЍxEu'jhjYSN umYE uYt }1 EPEPEPEPEPEPVEPw u=EEHE}t EEvMMEP E}u$} u =dtEPhY< &EE} t=du htTiM XO}uErEe[^_ÉU=Lu gLEPhwt@j,htE;Lu jÐU<WVSDž}u>jhHefHHHHiiHHjP%f=i=h=h5h=h5i=i hhSQRP{OÅ}1ۃd~dShY+PPP%  $s~WٺQ)ÃhY)PhYSh{Z+PP$  1ۉ vC  u vvBY u PYPQRhZ+P*Px$  H)H)É؉B}B@Bv;=H uV;5HvNHH5H=H~HHDžH)‰H)ȉB} B@Bۅۅ5Z=h=h;=hu ;5h~*؃hZ+P)hh+ii߭-hٽff f٭߽٭uC?~v;؃hZ+P*Pd" jhVS2Lt#PhZ+P)#hZ+P*P! jhVSIÃ<֙R)PhZ+P*P!  QPj }uh` jG j B}ut8tPB̕̕PFPhp菇 ÐU WVSuFh\E pVuh\U rVt_L=Lts3ha ;uha j\ hjh\ha'E pÃjhU rHWÃuE ph qS{WtU r{ tqE xuC 0v[U zt hqdvC {t&sC k8tkRhk {jCЃvthp讅 1vSVt E ph`qhnN 1{tU rCЃs 3hqQU B[ǹtPƒvC C PP3hq Pe[^_ÉU WVS} }hrh\w,Tuh\wTL=Lts3har ;uhaZ j hjh\ha6 1:vVh@r VhrhnaM 1E}v7VÃuyjhViTÃtSTu{ t5C {t&sC k8tkRhkx {tkjCЃ\SOT,{tjCЃs 3hr!C C PP3hq m e[^_ÐU jj"0:jj8 jj8ÍvU= tjj8jj"N9jj8ÍvU= tjj7vjj"9jj7ÉUU"uhr hs 18} tEUE EjjEPFÉUjuÍvUjuiÍvUShu| =t7v{t&C8tP3ha ha? ;u1]ÐUVSu }t huhjhvQÃu vhvSQtvh@vhnJ A{ t&=uh_褀 hs藀 {tsC1e[^ÍvU WVS}=tNv~ t=~t7F 8t h[ hjv# vhpv >uha L=LtJ8 tB{u'C PmP3hvv vs 3hv ;u5;}%E 4.ÃjhE 4Oƃ S=PuV-PtE 4hvu u E 4hv 1tC~ t=~t7F 8t h[ hjv~ vhpv~ tN;tI8 tB{u'C P5P3hvv|~ vs 3hvb~ G;} je[^_ÍvU@VS]u 1_~FP1_~gPhv~ ~F'hw} hnj2]S ؃ 8t̕=ȕu!̕PWPh6w} hXnP e[^U=Е%Еh`w]} k=ЕtkPhw9} hXn ÐU$SeEPEPl,؃jjDEPEPE, t"=tuE;EuE;Eta;(jqd]ÍvU$S|dEPEP+ЉUNt tvhwk| hwC Ãuwj/SHuv@}~jhahwPS3 jPS3hw{ jz?j达EPEP+ t$=t}uE;EuE;EtK`]ÐUWV=tJj5@hwJ{ 5* }uE pw tjh 虽e^_Ujhwhxh0j:yUjjB0 ÉUS=t7v{t&C8tP3ha ha[z ;ű]ÍvUjhuJÉUVSu }t hxXvÃuvh y6vSJus CBvh`yhnC 1e[^ÉUS=t7v{t&C8tP3ha hacy ;ű]ÍvUjhuIÉU WVS}u  h {AvÃuvh`{vSItvh{hnB 1bvC 9tB32_{ u1_Ps G1_9C }{Rh{hnA 1vv vCиe[^_ÐUVSut!vVs< u u1e[^ÐUWVS;t|kt p h9|6h9|a h&|1hF|$[^_ÐUVSuVÃt+{ts肪 { t>s n .j^ áC;tXVGCCVO C u > C ؍e[^ÉUSuVÃtES;tCB{ts { ts 謩 S蠩 ]ÍvUut@ÉUut@ÉUVSu'u Vh`|VÃuVh|hn+> ODsdDjFe[^ÍvUSt-vs s {t*Ph|{t u֋]ÐUU }t6@1v=t#xt9Ptܡu1Uuu1v@ ÍvUWV=35h|s }~E p| Z"t\h}s &}t }Ph)}ls &}t }Ph:}Is X<D= tu h`}!h}s =\th}r }t }Ph}r !t/&}t }Ph} h}r ̕P9Ph6wr hXn2 e^_ÉUjh|h}hX88 ÉUUBt t vBvBv1j.hyPBP躥 yÍvUMxu@t9Puu1ÐUlWVS] EEEEEEEEE=t(5h~Yq 9P9* }x`~`~fCh ~q hn߰Ҹ)P߰_Pw  `MMh\3!@h\3@3&~uMtwEg3)~uMl Y3,~uMt+E}u Mv}u;}Mh@~v}}t}}1E$EEEPuVj}WTÃuEEPVjW6ÃtUSPEPh}~hn8 +0 PMQh}~hnq8 }܉}E8@t8!uI=$tj:MQ;uj@}W:E E}u`E~%vM9-uE` `}1E$EEEPuV}W5Ãt{EEPVW5ÃtZS1P5h}~hnC7 k*0踇 P5h}~hn7 n}uN=| t+jjjhh`E؋@PEp tzhEP_v}th5FE؃xt/ph` 3E52hMQh`Z _`}؉}}}u$hEPh@y ?} E@yEEPEPEPEPMQu uH=$u'}u!EPeu Ei4P4u'}Wh~l j4Px4vEpPh~k Ep pp!24P*4 =}>=$u}uEP6h~k 3}t1uuuu5h1 }h~\k E؃xuV=} =t:jhjj51 }'8*th~j =t t+jjh59S}haj }EE܅t!UE܋@E܅t@;Bu}uMM܃Epp50uH=$u}uEP=h8j 5Epp5-0}vU؋Z}t[tC;BuEpxPh j t]؃5A&h@Ck5!.=]}W}tEP5MQ=l t\}u\h9| EtPÃt-C19Ct#61PtÃEt]}t!}Wh9|8h9|C jh|h}hX8vh uEP"G5jhf }tMQy}t }Wd1e[^_ÉUWVSM yAptpvCAupPCP׍X[^_ÐUS]jhxS:8ujh0S#8]ÉU WVSu }TO}u2 `nxXn Xn1hXnj ] jj jjܤ =Tu5 hf ti`~#`Fa< tvO~ FB< u1`t3J: u-`t%=Tumh`hf V=Tt5 hlf hnhh`bm u n`U=`R=t5WÃS6 t h*vu h{ t=uh_e h5`CЃ}u"=ujh $j:Me[^_ÉU WVS}h Fe x=xt}{ts3jhNe ;uXE E 0VJÃS5 t VhWu Vhs shd O1e[^_ÉU\WVSE}HE} Ѝp=p UR]S ]=pumhB ‰pt+װЃ wRhŚ hhG ph5pCj ǃ(+UU)Ev=`#}t@`vR聇  l4%@uE}`vRA  l4%@XEPURh`e uEPE`PXVU Rh`: uEP`P/vjhh`  hhgh`{ =` t=` t =` E=5ÃS.3 t5hb Uu5hb :v{ t=u5ha h5`CЃWhh`h t =`W蒽 e[^_ÉULWVS]u}t+}t%E8tIE܋@t tvU:M9vE8tUЋMUC}$EЋUEE̋M MԋExu+jU2E؃MԀ9@u)AEԀ8!u EԋUMEЋEԀ8@WEЋUEEԍ}1UBEEEvMyt1}:t@uv}@tUztՀ}:uF}u1EEP}WjMQÃuEEPWjEPÃtWSPURh}~hn( u#*0wy PMQh}~hn( UԋE1E܃xuj@PMQʈE܋@@UЉEtVuԋE܃xu&MQzU؍D ;EvvEЃ;Eu2E܃xujMQ͈U؋M@EEЋM*B<EHUEЋEЋM+Mu跾e[^_ÐUQDxK>Uh h3hGh`5 hhnf' ji U(Bt5Sh`9uh`t1e[^ÐUWVSuU 1ۉEFVV‰V [^_ÐUUBH;Bs B@J)ȉBÐUUB;t1vÐUE@ÐUUBE ;B r+BBBÐUSUM t`zt+Z)É؅|9|Z)ÉB9}B;B r+B J;Bu ;JrBB[ÍvUU;BuB;BrBB )ȅ}BÉUU;Br uB;Br BJ B )ȅ}BÉUUztB;uB;uB;BvBJJ)ȅ}BÉUUztB;u!B;r uB;BvJ JB;s J J)ȅ}BÉU WVS} utSEP9|EPSWEp誎 SEP )߃ ue[^_ÐUfnnhh` hh hh` <Uu u5Γ Uu u5Ɠ UÉUU89u 7199u= t7ސO8֐09u"th+9뺐:9u 8막?9u $5듉u/59u k5s39u 5\vÐUjhtfnPÐUWVh j   e^_UEHwx$8k9c0[3S5K<C=;13?+:#46> B1UWV0 ^_ÐUShh@3]ÉUS]} t'u uoud djh`djh`d jh`Shh@'3]ÉUS]} t'u totd$djh`>djh`'d jh`Shh@2]ÉUS]<t tt uy"w?$H@H@,=t $$>1tjSj./jS]ÍvUS]<t tu t tJtA= t7@H@%=t $$T$tjSjM."vu=t ]ÐUS]<t tt 'w{$܅jS%%hԅt@D jjR "jSp " Q zv1tjSDj:-LjS9"u3 jj " jj v]US]<t tu u?t6"u $tjSjr,]ÉUWVS} t8} H(wU  Rl,vE  E] v;|uEC;t;:uU PRw EEƃE}U}|t}:u|C}uK))B} tPWE P u U: vVEPW?t>}:E<|u CU|tE} t}} EZvUvR7g  l4%t)UvR  l4CEEU9Bu,ǰuB9rU^E8u6} tU U9sB9rE8u Ee[^_ÐU WVSu}׋] 9s#WEP3yu19rݸe[^_UWS=  = t=  t5 u hÃtYEPjS&uSh0 Bt(߰H(w SO)     8u e[_ÐU|WVS)‰ЃPhj ;8EPEPhhuujj hhhƆuV }а׍_@h`9}!SVh`GPEvh'? !;t4 t:t t"ĕ ĕ&jc&o"`;O=t2&=tI|+=t\v)PR)PRa)PRa)PR)PRyj)PRc;Pt' t=4$)PR1 #;8hԅƒtװH+vjj#hhRjj#hhhj2uVX }׍_0h`9}%SVh`GPEPj>*h'< x[^_U} hD< ^ E h`jv*jh h`Njh j>5*vh; ÐU}  h\; ÐU} htk; ^ E h`v*jh h`jh j>)vh ; ÐU}  h‡: ÐUM} 9tuz }u h` v,jh h`jh j>( hW: j"US\ sCC C r,jCt,C C PjCtPC  vC \jVCt\C  vC tj&CttC b vC jCtC  vC j CtC B vC j CtC  vC j fCtC  vC j 6CtC  vC j CtC  vC ȘjCtȘC  vC ԘjCtԘC  vC jvCtC  vC jFCtC  vC jCtC  vC DjCtDC b vC = u' j]ÐU= t = u Ph 6 ÉU "tUEu  v "t PÉUh` vQ}t#j h!h`jh!!vj h h`jh j>k$hB5 ÐUS O,sm{ tZ;u C vC C{tCPCP- ЉЉP rx j]U WVSu} >~Fjj VڊV: u؃Q9twufA$ 9uFFAPvA $9 F AFuA $<t A AAPAPWE } at je[^_ÉUS,smv{tYS:tP h`?2 ]ÉUS1ۺ,s.z}bztJ:t  rӉ[ÉU WVS11E8} ujbY;] }NUt,t%u tW'EtCt UFC;] |tWjoe[^_ÍvU=dth5de hGd d=du.h0 XdJdX'ÐU9=t @ÐU WVS]=dt;ufjjƻ Sjj謻Ãu߃jj藻 Sjj|ÃunS賻Ɖ߰ЍPt'D;Xw;XXXd)׃WR6d du2h9/ Xdd X)щʉ)щ XSt C7…|'~=u vCut1e[^_UWVEƿt_ƿԅtLƿt9ƿ t&ƿtƿu v1^_ÉUSd)Ã}u~rh`9~2S5dh`CPdPj> h`G- =dt,5dia Xd]ÉUWVSE1EhFOE=Q$(v0 u9u0=Еu'= =Ě u OBu/FOE==Ě (vu3 u.FOE=f=YĚ =u#=uĚ jh=Е==Ě =u#=uĚ jh%=Е==Ě "=u=hĚjhJ$L#hhhj @P@vv=o=bĚjhShhA-Shh%SShhS8 ShhS u !ĕ jShhyS jEvu+=tt=s'=s Shh4==s(=sh~P}}t"EPh@bEE5@h@Zǃ5}tEPh@1}u}te[^_ÍvU=!u1+!!jhj3UWVSE1EuH}t"EPhEE5hyǃFuOE=T=!t(!T9!E=!!.t 09u!!jhj*:9u!!jhj̕9u!WVj!}vT9t GNM‰Ӄ t u|!p=̕t[̕9uPt,u$%9t 9u FOE"WVjP!}!= t|9uq~-u$%9t v9u OFEB=%@D@j tRu!j tv tvtd jh`d jh`r!=u#d jh`8d!d jh`d jh` !Vu4djh`djh` djh`h`}tEPh1}u}te[^_U WVS1h`,t2=u$"u= tu th1hq t = 1Ƀ=uh@Eȃ=Ѓ}%PSVRWQà het Ãh@JtJ É؍e[^_ÉU=`jjjj jjjj jj!jj" jj'jj[ hԅ藬tjj#h=h t 5h  ub(juju8ÉUÍvUdjh`djh`d jh`j8 jhh@= ÍvUdjh`djh`p hhh@ =x tÍvUdjh`#djh` hhh@ Udjh`djh` hhh@6 Uadjh`~djh`b hhh@ÐU$Suh7 1cvEEEEEE]h`U)Ӄ9|!SRh`uCPEPj>[ !]ÍvUdjh`djh` hhh@=x t=tÍvUdjh`djh` hhh@~=x t=t!ÍvUdjh`djh` hhh@=x t'=tÍvUdjh`#djh` hhh@=x t=t)ÍvUdjh`djh` hhh@ Udjh`Wdjh`@ hhh@U$SEPEPxEEEEˆE]uE]EC]US]tjjt jj]US]tjjMt jji]Uhh hOt j9X hh h%t jX v7x U WVShrǃhÉރ ~}t vS5Ã~W=tS5j>r9u(9~$)ރ}uV5Țbƃ~Sh|9ut 1)@e[^_ÍvU1҃=ȕt tvu=ĕttt= t'u-=t!D;H~"t ÐUS]etPu]Uj`ÐUÐUVSuSvvS;  l4%t%vS蹢 l4Fue[^ÉUjEPuu uÐU WVS]=D#t=D#Xnt5D#9s tQ޿t>h S D#tSh`#M 2Sh hn5 D#Xn`#fe[^_ÍvUWVS} uEEEEPEPh/5D# = tM~9s.P ;u*Ph85D# C9rԃE=v ~ 9s!Ph?5D#I C9rE =D#XnuhDhXnvhG5D# 5D#\4 5D#J4 e[^_ÉUSMU ]=.u+w4!QhISQhSt4t$t1uvt[PQh]5D#- 'w4 "hdu hg Shm5D# vSRQhp5D# =D#Xnu#hDhXn 5D# 3 hG5D# ]US1ۍv<'wP4 "hy7wP4!hyPSh tJ'w4 "hw4!hSh'w4 "how4!hQSh͌FtD'w4 "hی&w4!hی Sh <'wP4 "h6wP4!hPShv tJ'w4 "h%w4!h%Sh3'w4 "hAow4!hAQShOFtD'w4 "h]&w4!h] Shk Cb]ÐULWVSE}=u!?=!E 8~ 1ÍvU51|%ÍvUM =1t 1v=1t 1PEE@H)1ÉUVSMA9u 9A=1t 10=1t1XvjQHA@;A4s vA4DP51tjjjj51_ SV51Șj515%e[^ÍvUVSEU @X$t`thj4whj/PjP7tW `ny `n;pn|Xn XnhXnj / hjِ1۾ `ny `n;pn|XnXnhXnj. C~1۾ `ny `n;pn|XnXnhXnj a. C~ `ny `n;pn|Xn XnhXnj . hXn v2 v1e[^ÍvUj51>%ÐUSEU M]@@$trtt3v<%1[ÐU WVS]} uVCHP51!t1sHVWh`jSOye[^_ÉUE@@$t12} tj516l51a%USE@X$@\}tGtijhPuRu hHhXn ,t"PhhXn 1]ÉUVhhnI jO2 vSVhhn+ j12 e[^ÐU塘@$ ǀÉU塘@$@U塘@$ǀÉU塘@$U WVS}u _$hm3 jh2 hPj=jh2 hPjujjhl2 uThPju7jh92 u!hPjj7thjjkuHhjjSu0hjj;uhjj#thߒjV,q1e[^_ÉU,WVS}u EE]EP1 EVSWbe[^_ÉUSEX$Pjj8Pjj% PjjSjj]ÍvUEǀX<ǀ\ǀ`pǀdǀhǀl`ǀpǀtԮǀxtǀ|ǀǀǀǀǀǀǀhǀǀ,ǀLǀÉUS] uhhn} tShhnc 葬0 Phhn> jA. U,WVSu }UBX$Eu @t(@tFTF H tF#v}F vtWEPEPEPjUR t }tuuEPF u1%PRSN@>tjjS%{ tC xtjpS1e[^ÍvUlWVSu} j3#ÃuhpEPS臡}ShwquEt}t'E %PS[}@t5Sh%E$%PS4}tShjV[1e[^_ÉUWVS]}t E11EPhht@jZtu}} tlthQ t@S8;4t-;!`tX@S8;NEU;VjjSW BCM;vVUM;uBQ)‰@v1PMq1W ECU;s%vVjjSW CM;rދUM;tVB@PjSWx 1ۋG }tlE1l4t/UvRfl4vUG@6t8VuE}tw$E1FPxFFe[^_USE1ۋ@@t_vBσwJ$$B2taF>:t>uF9sWRh̙hPJ  URQuDžt^@P: ƃujjEP=C;@PRVD U r M qE1[^_UWVS]CLCPEs tC @uvCLPSm'w{LuCLCPjj HP hҙS6 *dž t'CLPS&{LS BtBCLBCPHltd@S8<u dtS CLEEPjjsLS tCLCPXv}uCP;EvE}tCPCPPsLS«CPCTCLEUCPBjRj'Sc?e[^_ÍvU WVS}u uw_ GLCGPCKC{ s 謊thܙs jWDs C {}VWB09u CB4 CBWB09Cu B0 S{ts8 S, G Fxt5P@Ѓt%}uhsjWKDvVW&VW< FX uV~Lt%vL讉thvLjWC~Pt%vP胉thvPjWC~HtvHT ~TtvT@ ~LtvL8 ~PtvP$ V 1e[^_ÉUWVSu]FjV@v3EECCEC ECt F|@;EwE1e[^_ÍvUu h`ju,ÉU WVSuuF~?t8FX)v9t9{uEPE PS>uF9uӃ}u 1EPE PVe[^_ÐUS] CC C,C0C(C$jjhhjC t1hju6KX]US] {tCP@C{ts CC C,C0C(C$1]UMQBXt11z,tALB,APB01ALB,APB0jQÍvU VSu^{ wj C PsV1tuCSE jC,PC@P8Z C(EMACEE@ SjPQsBЃ t C(C(C$1hhVe[^ÐU,WVSu}^CXt1IcX{,tjV#C,uDEPEPju Vn tH} tu V EE!EPEPju V* E;C vPC PsVހCCjE PC@PX uuCPX C(EMACEEUP SjPQsBЃt C(C(C$1hhVye[^_U VSu^CXt1{,tjVC,{ wjC PsVttCCju C@PW C(EMACEE@SjPQsBЃ tC(C(C$1hWhVe[^ÐUvtMTt DžPjEPUMtZqMAȃB9A u A EPBUB$MAȃB9A uA vEPBUBtDžDž7t *t t 3P4twWhhS ߰HDžDžHjP$( tqjjjjR0 jjjj)90 jjjjD 0 jjjjH0 t@Q8 A4`tX@Q8XA8u5t,/ru2E8u*iqvltd@Q8 d@U u t QnfE8x tg@ xPn EUujE0M1p@ pE0諿UP(P$ ru @x x$u jƒ:@$0藻ƒ@tJ jjR˼MA|xtO As s{uPhhnO ;tCBS^lue[^ÉU WVS] ;‰Ѐ8+umxu#j蕸 ‰tr3Ѓ@P` ‰t=-BcFPBP»z8-urxuGj! ujbA0EPo`fP&xctxTt xttxwu xu;tֿ1e[^_US]uhhnM tShhnsM } t%@0PhhnHM hhn3M ]ÐUE @81ÍvUS] 9tABQQ׷ K8u1]ÉU WVS}u `u'VWÃtC9t4dEA{xw#hCxPstMQd{CtCtECxEUuEEEب1U\UM<}t E ;F FEE4h_jV" EEEPU<%DMQR uPV莲 E FUTUEPM1EP uPVV EEUEG# EMQmUBMQURjMQЃ 1}tUBtM;Htu UvEP茭 e[^_UWVSUB xHE1ۅtZt Ut>EEE;EvbPEPjURbEBE;CxvPCxPstMQanCtCtECxEUuUB X;tv;w@MQ]BvPEPE;w@MQBXPEPuPV茰 uC;uu:F FUtmz$tg1ҋMA$8t B8u~@Rjhd]SPVɷЍt:F FU1ɋ]C @t6`EPhySÃuSVɯ u UB @t,EPhRNÃuSV苯 u t,F FMA@XtEPhQEPh]SÃuSV1 uUB @t;t,F FEPhMQÃuSV u ]t@S8<uGEt;t,F FEPhURCÃuSV耮 u t:F FMEP]S}u,EPhͩSÃuSV uvEPhܩEPÃU 1uPuM QSVzЍt0=EPhUR[ÃM QSV;Ѝt  F+UU]Mt\ЋM;A8vRE9s$;/tvC;]s;/u)ڋMA89w;]u]C8)K K.K.K.)މuEPMUBuSjRЃ 1}tMAt];Xtu UEPt e[^_U,WVSu j/V2@ÃtY{uSh t8uh t&8t!PVhhS jjjjS u=,%hSj@DžjRPP‹B Ѓu utFP‹BЃ=,%t,%Kh@SjEPk3,%UBxht @hP@ЋUBPh1[^_ÉUExht @hP@ÍvUMU E$LPhiQuovPhQa[vPhQMGvPhުQ93vPhQ%vPh Q v vÉUWVS}] u=wu`%1C=wu`%1C=wu`%1tu{|uoEEES"E1ɅtOtCyht=QhjEPEPqhB Ѕu$Extt@HUEDEt߰H؍e[^_UWVS}u >t;vR茔 vl4%tF>ù>u E zvE@v}t&1}tUBtM;Htu UvEPH 1E}u"UR* Ev1ۃ}tMYt Ut5EEE;Ev_PEPjURXt@ECvM;KxvQCxPstEPXtCtStUCxEUdp]}Ou D>w@MQBX PEPBC:t9rF>t9r9Ee[^_ÐU<WVSEEEEUMjjjj?EP  UjjjjR~  M jjjjQX  E`jjjj3P2  Udh tRhhS߰HEjPURo tDž( h tRhhS&߰HEjPUR tDž = t+  BBB HEjPUR tDž 8 =t$BBfHEjPUR tDž=$t"$$BBHEjPURtDžQh0hGhSe߰HEjPUR9tDž v=Qt"QQBBHEjPURtDž.}=`tǾ`󥍽HEjPURctDž&hhhS1߰HEjPURtDž'vhhhS߰HEjPURtDž+^v=tǾfHEjPURAtDž2vhO õtRh˵hS߰HEjPURtDž4=ԵtǾԵ󥤍HEjPURjtDž5#=t+BBB HEjPURtDž6=t-BBB fHEjPURqtDž9*v=t$BBfHEjPURtDž<h"hhS߰HEjPURtDž>VvM t@Q8HEJu DžhhS߰HEjPURtDž0vMARQ`ЃXw DžLw Dž4E t@MQ8 UHh!hS4߰HEjPURtDžI1ۃ=-uvGtt-ttvjjjSMQ j6v[Ut0@ыQ8 v[PjjSEP v[Ut0@ыQ8<u_v[<tSj[Ut0@ыQ8[Pj SEP!  vC?U :tgM 90t40SoHEjPURSuE M 9u1/E h@jUR[^_ÉU;nu{ouESE}uSEP{uvUE}u uM Axu8?u E UBrvMA t}t hvUB t}uhSjMQ}t hMA }t=vUtMЋ@ыQ8 vvUЃ<uHvvMtUЋ@Q8<vMЃ<Ext!EPjURMQUBЃiEPjVMQNEPjVEP33UBURjVMQЃ}tjjjVEPjjjVUR) }th@SjMQku}u}uEEHU=wu`%1Lj EPMQEPSJǃEPSEPƃEPURMQà r tt28SVhcjEPSVhjURg / v}t.1}tMAt;ptu UV }1}tUBt;XtuU~vSϒ jvE8vRt vl4%EPSMQƃEPEPURsà SVhjMQa }t,1}tUBt;ptu U V }1}tMAt;XtuUvSב rvE@ @t}uhSjURMA u9vUtMЋ@ыQ8vUЋ;EMyt#EPEPURMQUBЃEPMQVEP(EPURVMQ角UBURMQVURЃujjVMQa}t"h@SjEP EVu}u}uEUJ1MA vUtMЋ@ыQ8<uYvvUЃ<tJMQvUtMЋ@ыQ8 vvUЋP轰MytjEPURMQUBЃugjMQVEPuPjURVMQ5u9UBjMQVRЃujEPjVURL tE? vE M x}tEPURgE؍e[^_U WVSU }uRMt@Q\8 RUt+VtƃujjMQet0 t u{t sw s3EC) tu;t 3I 3U1e[^_ÐUS]M It@S8It8u'}uhjS%1]ÐUWVSDžX EX8!DždXX~8UZ81X$d ~ʃ$d1dXDž\DžlDžp=_UPp-pA } 2$} t} vpC CvvUtP@ӋS8 vvP v]t!P@S<; cvE; IgvvMtP@Q8 vP v]tP@S<; vE; vMtP@Q<<uvE<vUtP@ӋS<vEPvUtP@ӋS8 vPP誫u'vM 觍 vv]p8H`pBt[rVvvMtP@Q8 vP<` vMtP@Q8 vPPhjtSp߰Ћ`T`vMtP@Q8<ugvvP<tUvMtP@Q8 vPǰЋ`T``d9`\4\l4lpp8\X9\~\XDžtGDžT9TTDžh(vhd)PhURhX9h}-PEP;\|T9T| ldhURKDžTl9T}TTPEPLTl9T}hMQl믍vh]SS8[^_U WVS]} 1騫Gtdr7It@S8<uI<t PhIt@S8vIP7h{It@S8<uDI<t5It@S8IP7hSƉe[^_ÐUWVSu E=0EEUB -Bt{rvMtU@Q8<u&M<tE0hV] oU2hɸVE WMtU@Q8 MPE0hӸV UtM@ыQ8<uU<hV M MvS;t  l4%u\u+\NyF;F| vVj\Ny F;F| t VSEEn=NyF;F|Vj=豂UtM@ыQ8UEMvS?s  l4%u\u+\NyF;F| vVj\Ny F;F| t VSEEn NxVj 轁F @tjjUREM91e[^_ÉU,WVS]]h^jj&h EP  t@]h_jjOhEP…t cv1\߰HEE=t0!2ߋMu }uU:t :|~׋Ee[^_Uhu juÉUUE 02XÉUUE 02<ÉU WVS] uE1UH}u0vt8@S8<u9 vv<u+jjjVS jjjVS jvt8@S8vPj VSl tjjjVSU yvt8@S<<uov<t`jvt8@S<vvPj VS tjjEPEFNEe[^_U WVSu1ۍ[t8@V8<u @[<t6[t8@V8 v[P, [t8@V<<uJ[<t:[t8@V< [P~ CNe[^_ÐUE8ujjjjCuo1ÍvUUE8w jh8w1hhjRbÍvUVS]u>u jh>vhh@jS"6jjjS >ǃltd@S8 dltd@S<; t= v;ht0ltd@S89 w9djjjjIS/ jjjjISHltd@S8 vdltd@S<; t9 v;ht,ltd@S89 w 4v9dv)HPjjjISy HPjjjISc1e[^ÉUhjut1Uuu1UW}Шt1hju&}US]S虘 1]ÍvUUE8t  1ÐUS]@t􍃰PFtP$1]ÉUE 1ÍvUW}Шt1hju:}UE8ujjjju1ÍvUS]CURS`Ѓt}wuuu S1]ÐUS]CURS`Ѓt#EP=wuuu SZ1]ÐUS]CURS`Ѓt}vuuu S 1]ÐUVSMu t@Q8H9s:H9r. t@Q8Hu1[^ÐU,WVSE} u&UB E hjӁvRi  l4%t.ӁvRN]l4vڋMA@E E t 8Pu} uMwÍ@MQBXvPEPԕPhjURpM YE8unEPUR6uσ}uQ,vssujMQ艤 uEE@\E 9u͋UB1M AtUE}uME@M0vssujUR .EMA\E 9uɋE@EPU2MQ -1jUEEPEPjuMQw 1}tEpt Ut=EEEC@;EvaPEPjUR+tEAvEC@;FxvPFxPvtMQ+DFtFtEFxEUu}t)Uz}tGtWuMQz }{tssVz s}tUB}t }O) v})1EM}t1}t {%UBP1MAE 9uVtWuV5z +EPEPuURZMAX;EwEAXA`iE @ E+uu1}tUrtM;NtuKUUB;FxvPFxPvtMQZ*FtFtEFxEU0vUB;Ev PEPMQEP*EuuUrrV7y tMAWuPy Ex+EPURuMQ<uqUBX;Et5EBXB`*vssujMQ٠ u:EE@\E 9u̓WVujUR誠 u MA\11}tUBtM;Htu U EP t ؍e[^_ÐU WVS}u Ehj5 ÃujjV߾EGGCC {C,CxCxC|uǃtY f}%t&SD)t&S )t"S(tMt|W^q ujjS`ujjVG~W;v SVzu; SVfuSVqu E1Se[^_ÉU WVSuN t1>t6VB9u FB FBVB9Fu B VV!rVet u3~$t-^$;t3p ;uv$p ~xtFxPhtp tp @t􍆰P tVp tPt!p tp V;Vo e[^_USUZKC 9t9tC9tavC9CtTK9u AC ABC9AuCQCCA9C uK CHKv1[ÐU WVSu]ExLw4EPUR um}uEt`jUR^PE t*u}tFU2:Fuy}tE0UujR E@UuPEPjjE>Fv:\u B9uBKBAKt9uB}tE)Uu}} Ut PEPEPEPSVEP^U@t U E1e[^_UwӋMAS< t%MvUB:Rw)<~ 9vv> u )<~ N9w F)SWR4_ 9u9)u} tAPMQ P^ thjUR10} u ATtP^ [^_ÐU|WVSjj+EPDt vUt@ыQ84 EVuhFhuhVjURTDžjh S'h)S%ǃsjGPjjMQ"n v ?WhS8&tpjheSuYj S;ƃtEWhS%t)jhQSfuj S;u%h@PjEP+vEPP(t!8u􋅜PyBEPGPPEP%Ph` Dž Wy􋕘Ru.uhk􋍘Qj1x[^_ÐU WVSjj+EPt vUt@ыQ8 E||Reuh|QjEPU RDžDžDžtDžxDžDžpvjh S+S|PhhpR7 jjpQǃjWjjEPk trMvDž DžWhS trjheSnu[j S8ƃtGWhSt+jhQS'uj Si8Ãu hpRjMQEPPt'8u􋅜P7/vPPo EPWpxt;UxtpQ4xu!jjEPəxv􍅠P4tu0jjUR茙xQaN xt HtVCN S:N Et􋕄R X vWW 􋍘Qq􋅘Pfxu!hRjMQtC~hjEP藘9~h@jMQsjtPE PURMt8xQ%M tPM 􋕄RV /MAxPPHTuU JHX@1X[^_ÍvU WVSjjEPؼtZ,1t&S>PE PV |4)ƅuh PPiV Ãu1hEPju聛[^_ÐUVS]uE HPSVV t'j S4tj)@RPV'W v1e[^ÍvUVSu V̝ÃuhujuEPV&؍e[^ÐUSEPhmthhmju薚-u hmhhS賜 SxÐU WVS] }Et 9rn=s7u VI VSbK Åujju辕t)PjRSN 7 1e[^_U VSuEPEPEPu ust}%@}t7;]s2U)U vBEM}t E8 t8 tЃ}uH1e[^ÉUS]j/St@؋]ÐUVSuFPH Ãujju豔tVu SM 1e[^ÍvU WVS} u]SVW/U8u !vw8"uE8u v1e[^_ÉU WVS} u]=SVW謝U"8u 5v 8"u&E8uU:u 1e[^_ÐU WVSE0~VtKss sVЃ;tCBSs H SH _luTtLJLJ# Wt@%PjVQWVUVt!ujvLVV<t4@V8<u 4t@t@V8<u t@FTSj:FxPV6 FTujjjVSiu,FTt h*V誟V- jtjPMJ VxzuLJ,LJvBBLJVt TFTujjjVhu)FTtFTh.jVT|E01e[^_ÍvULWVSE@E܋UUM܋I|MăytA ]܉Au@t,ELP}W+uGPEtU@ Mċj3jȃQPH u V}W9 EF1~%vUċB uMB /vS[4  l4%tuFNuEăx:u"vUJBB:tMăy"u4]Kt CC8 uuċF8 hFNVEăxtIvUċBvS3  l4%t MAIuË]ă{uJtuu }t.EP^&U܋R|zMf}ytyuA8t ]ĀEPuV}WP}=~tDUċBvS2  l4%u:u MAIuE]ă{C8|8 Ph>(+tsuCKz}ċ}EăxtCUċBvR1  l4%tMIAyuuċ^+]uhIj}W"U$M8EΊ:uAEE:t9lt9pt9+t9-t 9^t9#uk}ċG)ȉOG$8ljE@0bEMvRz%l4uS}W'UĉB uSu}ăt!GEH@xt UċB9tMċA+EP]SQuVD3"}ā u E@(/Uāz Xu MA(]ā{ u uF(}ĀKE@ UR( x`u#Mu@`YLCXdAPuĉFh}ĀEt@MQ8<u]tuĀN} }ĀEt2UċB @ u}t MċA 0hj]S؈vuċF @ }uEE}ċGG ht t t  |Eăx@8!uUBJJ}BBMăyv]ċCvR,  l4%tuNF~u}ăG8+wGOGEEȃUċBt tA[vwӋMAS<t#=uF:Rw.SV[u}ăvEOGG,vS+  l4%uEEUJBzGMċA+]ȉ]؉Auā~ t~ t ~ un}ċ}vEEUJBMăyCA\u+yv%x uEIAAuA 뮉 u}ā t  HEEăxvUċBvS*  l4%tEMIAyuuă~|!s~ t }`}ăSG8 GEH@x2UċB8 u"Māy 8ytC]ċCvR*  l4%tuNF~u}ċGvR)  l4%u UċB8|u+}ă$8}G(0f $G cUăztXBBJ]ă{t>uċF8\u~v FNv}ċG9uJEH@xtuEUăztB8 ȉM̋]ċ[]uă~}ċGt tAvwӋMAS<t#auF:RwRSVDXu@}ăv7G@E t|uCEUB EԋMIA] t|u ]ĀuN}EEH@x-UċJAMJJ]ZBB)ʋE@)‰ЋuĉF~ huMtv}?\uEHuUċw tV=MċA`: t/]C` tBEPuV>g}uCd}GLUĉBdMAL]ĉCduFP}ĉGhvE@`MċAlQpˉCdShuă~`t}ă`G`Exu Gl!vEălPURufM tyluAd ]CduFpFh}ċG`G`ExLuX tOEPURe1}uGlGd&vMAL]ĉClCdvuFL}ĉGlGdUBPMĉApAh)]C`CdShuĉFlVp}ă`2Eāx @`UJLAHdJL@t8@]S8 ȋu8}ĉGlUBPGpGhEPRd8}tUM;QLv Gl9vWl]C\C @ E8u>!u(}ăG8!GOO}Eăx*vUċBvR2$  l4%tMIAyu]ă{uF$0}ăQvUċB<^t8<+t* <#t41v<-t %v]K\6uĀN}}O)EĀH}UJ)MĀI}]K)uNF~k}ăvUċB<.t,<+t2<-t<=t<<^t,yvMĀI| :v]ĀK|@.vuĀN}"v}ĀO|vE83:UĀJ|MIAyu]ċC8+t8-t 8^t8#uj1uV`}ċG=wu`%v1UċBBQBJJ|EMċA=wu`%v1u ];+huċF8+t 8-T}ċG8-uO|UċB8+uJ|j EPMqEP }u ];0 uċF})lj)FEFE8auFlVpMĉAdQhEAdHAl E]ĉCXuĀN|v}wwWEP'EPEPEPURMQ s }` }! }tu]SP` EuĉFT-v}ăt+ %PwwWEP% 5UrrRMQ]CKuċFEE~}ċGt tA[vwӋMAS<t#=uF:Rw.SVOu}ăvOGGU4vS  l4%6ME]KC{CE+EPuuV}W#~JvUċBvS:  l4%tMIAyu]ă{CEE{vuċFt tA[vwӋ}GS<t#=UB:Rw.SRLNuMăyvIAA]u}OGEqE+EPuEPUR"NMqqQ]S'Eu>NЉE~ou }$UB$;EvM9w@]SBXuP}WKPUċB 0hjMQx E];uă~tI}ċGGvSO  l4%tEHu‹Uăzuh)MQ\t!]ċC ph,juV@xav}ċG`lu2uyEu udjjUr MQ ]sluV\u7C|u jjjVEP}Wl\EUĉBlMăydu3uR]u u=jjuv }WEpdUR[ujjjMQU]uu@}}G`tNUBLlt ;Glu ~twMċQlu]SLCP؃PPRSFuFL}ădt ;Gdu 6t/EċPduMQLAPȃPPRQ]ċCCCCut/}GLEUGPBjRj'WPt6Et@,Uztu R#]Mf}Q]{t>t5uTu)u y uj}WU܋|ЃMĀ]ċC SuV@Ѓu+FTujjjVLu-FTt!}TVEGUt RyMy]ă{\} C\9ALwjh@jQtuFLЋ};G\s jjjVUċB\MALPQXuhj]S|tvuċF\}GLExxLUĀz|}fb|Mtfa|]C|%6uLuu@t@V8<u v}tE@tt&UBLEE@QPPMQRc{ }]tu؋}Ȁ|7tZgvE؋UȀ|wT]CS<t0=uV}؋MȊD9:Rw$PVGu]KCCuċF+E؉F}~WURP, @MċAAAA]11ۋuF@|aUBPwH$LuDhjMQvu(hjuVhr v/* vEċEąu/'UhyvhjMQr5vh]sjuV2vjjj}W PjjEP UăzzMċAAtt>PwӋuFS<t#5}G:Rw&SWEuEăxv H@v t|uUăzvB MIl]ă{uE܃耋u9F|th@j}WqWe jEPlNthjURpEEMǁ]Ee[^_ÍvUWVSu] EC`{C2'$~ ClPVT{l%CdCpChC`15~tPC`t5t @t8FLCdFPChC`"vClSpCdShFLClFPCpC`C8;u9C`tt )t!/' vCdFLCh ClFLCpFPCKEPEPEPSVz E8Y}tqC`t)t Qt3IEUCdShC`3vEUClSpC`vClSpCdShEUClSp1C` tvtgFLCdFPChC`jvjjjV wjjjV gjjjV WYjjjV ?ClSpCdShFLClFPCpC`{`u!Cl;CdshjVmE1e[^_UWVS] EUMyu:CPh tjjjEP UC8$ ME@PURQCMj EPsEPƒtRj]EMACU)‰)CECM{uhjEP_ljMQC@PEPaiCC{vCx/t)x?t#hjMQlECKCv8/urvMALMMAPMAptpPEPssEPPMQ҃ uCU)‰)CECMEUBPMAzLu-QROt E8t UBLM{vaC@=wu`%v1t8C+6CvRm  l4%t CK{u1{C=wu`%v1uC8+t8-t 8^E8uUBLMBPA{CvR  l4%tCKuʃ{TC=wu`%1uC8+t8-t 8^C=wu`%1uBC@=wu`%1uC8+uFvNKCC8-t8^uCK1j EPsEPƒuC}}}4);E(!~}~);Ert Rj\vt+uvuCM))CECaE8tEtA}؋U;v/hSU9sjjjMQ=U21e[^_ÐU WVSEPUvEp|9u'UTv F=~3FP^tFBVV FHFVL RQP FLFCUBLFDCFP t1e[^_ÐU WVSExvCPtVKƉ91uAC@AB9quC<QQ  K<9uƃsH  ;tCBCS _|9sG|@1e[^_ÍvU WVS}1ۅt_t Ut.1EE@;EvMPEPjW{1E@;CxvPCxPstWUt_CtstCxEUE0Pu Vo hVjWui 1tGt;ptu U vV e[^_ÍvUS1ۃu u]t=xt=u؋]ÍvUSUE |!t1H1ۃPRt =؉؋]ÐUWVS=t0U:%M:uΉ׋M u ;u1[^_ÐUS]U MEt4rtt&jj}vhnh)b{uj1tPSgwb$4h`.EPSwHu;}t uhhjSc[ v2hjSuc]U WVSU Bxu5jjEPٶhjUR/ct U BtPTvR  l4%u*U BtP|_thjEPUvU Bt;t9vRH vl4%C;uȋU BtxpEvR  l4%u;_uE1SvR  l4%u{_u9}u^CNzjjE PtBpB0p0jjURhu7UBT1+vhvh@jURaae[^_UVSuE @tFTtjs3VPth3jVNev1e[^ÐUju u2Uju uUju uUWVSUE@E]{ujU B 0Smv] {dExLBwtOuHU zdt?jփlVӃdSjEP !jVSURI  ] {S[vօt > tFKu9uuIEt)Ѓu:.u Ft`KS)PRWGjUR@ t"FKujhWGjEP@ uhstU rE XUEjPU􋂠Ѓt#j] C 0EPbvU4thRljh]SmPSl hSlSm E @}u5U t@ӋS8<uEtU<t4@ӋS8<uE4t@EE@E@QjPUR5]$ssWGjEP? E9u֋UzLujRAt ]CL1e[^_ÐU WVSE xxu&Uz(t B(xuhGjM'E thxxuJMQ(zHPrU RMQiE PUR<M QEPvjU B|%%PMQ*E xxU u6z$t0Z$;t3v ;uMq$] E@(jU Bx@P蓥MA$ujjQ9\vEX$U rt&p0MQ'tŃxuUB$B(0Rt1ۋM3UB(pRjM@tH  M A}t$RjPEP-tUB(M1e[^_ÍvUVS]u EPSs t juS:uHFt0uƒt F}$%PjRut juu1jVS‹EP$P(EEC1e[^ÐU WVS]u C(;C$uhajSEZt3S(zHPrVSWupVS9ijF|%%PS*'uCC(pS t- F}t$RjPSuC(1e[^_ÍvUVS]u {$uhjSlYjjF|%%PS&uGC$C(0S t/ F}t$RjPSQu1ve[^UWVSu~$uhjVXEEE^$;v;HM;^(uUF8H9ErUEh}tEhV5fE;^(uP3;^(uPhVeF Tu+jjjVl/u FTu ;5hVe1e[^_ÐU WVS] tCxj@PEujjEPWut4u4}HPEPEPut:1=[t'vp0EPGtփxuEe[^_ÐUVSEu C$jPf CFtC$Fx1e[^ÐU WVSE}uVP. S$CVW0 S$CS$CpC$CU BtC$Bx1e[^_ÉUWVS}1ۅt_t Ut:EE}w[hEPuWE9{xwhCxPstW蹿tuCtCtECxEUEuEPEPEPuuuE PW0t91҅tWtE;Btu UvuA v}tX]u9s5vRvl4%tC9r9tuuE PW51҅tWtE;Btu U u 1e[^_ÍvUWVS}1ۅt_t Ut6EE}wahEPuWQt(EC{xw&hCxPstW)u yCtCtECxEUE EP]EjEPEPEPSuuE PW0jj4Wtzijj5W\zQ|tt@W8tE];tcvvRvl4%u2vR l4%uC;uEXuxt&NCPEPzt~vRpvl4%uCvRB l4%uPEPuCNutt0]EuSF;*uEPE PW 2EPEPEPWF tuuE PW<Ã1҅tWtE;Btu U u ؍e[^_ÍvUWVS}EEUvS1 l4%tEOu̅UuEME t tAKvwӋMAS<t#-UB:RwSR\%u vEO+vS l4%u EEOeMQEP1MQ$AMHMA}tgvE t>tGF>wMAS<t+*EP:RwPUR$uFFCMuMA$oUBM AtB$Ax1e[^_ÍvU,WVS]E 0U$EEE}kU<# lu8EPVF#t }uGlGdSE0EPGlPGdPWV3!UVL tFPFPPRV茨 vEFPuhDVK1e[^_ÐU WVS] UB@Xt)C}u#B @8/thjR=vCxt thvh3ubnP0ƒtztB8uhjMQ>=hRCt vP͆u 1+v{xCt:/xu :.xv!8.ux.ux/xUHt@@ыQ8 E@vF>t>:uF9sjQRh+hWB Wu/hW艥 h1WjEP5@V>xhORjMQ @[^_ÐU WVS}8u!E PW(t  v8U Btp~4vR vl4%@tNC̅]~7vvRvl4%@uNC̀;t;0vRvl4%@tC;ũEPuhjW:SU RW@Ѝe[^_ÉUWVSuhE }ЍX1t~t Ut/EE;]vVSEPjVߣt"E=v;_xv"SGxPwtV轣u GtWtUGxEUCPEPUREE8tPU RVQhEPHu1tFtU;Ptu U EP$1e[^_ÉU|WVSuEU ZxHPVRUR7E 9XxuhvURCU 9BxtjVEPbU Bt0EPV}tVjEPz8jE%f=@uVhVhhW> EPW}tWjUR!8Dž!j/VɄt ЍX7PjǃujjUR7G4G_ SVPEGWEP unRWEP2uSBtBxxGWURtjWEP 1Wx[^_ÍvUlWVS} hwhhSD= EPS | uЃFPG,ujjEP63vjjP[Ã|Vw,SS9t0hPjEPq:SSG,1ҋG,8tv8:uxtB@8ujBPG(tnÃhw,vhjwWUR) }t/MQMA BEPALB MQMAPBUBMHBUP MAUP}tMQ}t EPe[^_U WVSu ]JvRvl4%tFύv> VvR^ l4%Ea=at'a:tvEE8t:uU:uQha>w@MQBXvPEP<PhjUR/vNM~tAEvR l4%t EU:uNjM9uhBEP51U:"zzu}RvR l4%t2MQvRfl4 vEPMA@t8Put@PUxv}ЍxG#Pj wÃujjUR-tBCCC SSCB OKCWURPCD8K1e[^_ÉU<WVS8j VtVE phjUR- M qhV贴PPhV較uvE phVfj V0uCvU BHyrvM A5 u+1\vtS t Kvt+AװHvR5xF!hP;uzmϰЍXPPPRM QEP u u Dž1ۃD0Pj5tǃG(Gt+PW/BGRRPGOt#WBW _$CPPRvUMA G9QuyUB 8My EBU RMQ1ZjjEP)AU B@ t gM qhjEP-jU RMQ[^_ÐUlWVSuE x(?trUR7hhS/ EPSnu4U?HEU ;B%U?u[^_ÍvUuuÉU WVS}u tQ>tLVÃuVhW6fs3hW6s hW5Ah$W5=t!s3jh6W5 ;u1e[^_ÉUS]u1PjS]ÉUVSu] Uu9~Yv@t9uuRh`jV'{tsC{ ts /jEPs;tCBS{,ts,/{(ts(S1e[^ÉU WVSu} {thWVt1e[^_ÉU WVS}xuhW64+XtssVhW4 Fu1e[^_ÍvUWVS]} u~ u(vS u wj@vFEWEE@jjv$v PPSFm twjS2u ǃUSLCPCPPRS>1e[^_U WVS]߰Ѝp=t#vV7SRu ?u1e[^_ÉUVSu] CHys Ct >uЃujSVl>CHys>uC9u CHysb bC9N1e[^ÐUVSu] ~ujC 0V(ejClPCdP1C|tCQPV ujClPCdPVZuCdFLEPVuFL;EvEFL1e[^ÐU WVS]U BtctV btstktBtx0*HSBtx wm02Hu\SgBtxwE0>Hu4S9?Btxw0FHu SCj B pS跭e[^_ÉUVSuF@u! uhKjV"!vF@tyvC=wu`%v1uJC9CtjSVFTjjjVuFTuF@toC=wu`%v1tBC9CtjSVZFTuAjjjVCu FTu"uF thiSV 1e[^ÐU WVSU BtxPEu7M ywA@MQBXU BPMQ\PhEP.U z_wNtw;w@MQBXvPEPPUR.MATuLjjjQ!uUBTu*CshMQl.?E 9Ye[^_ÐU WVS}U Bxt tA_ t{}jWÃ1ENU Bt0WÃ1EU Bt0W vvE t VSPWgZU B|%%PWu2E%U B}t PjSWu1ve[^_ÍvUVS]uEPSs `t juS:u6}uEE @}$%PjVut\juubevUCBE@Ep EP C @fBUCLBLUCPBPvjS‹EP$P(EC1e[^ÐUS]E {uj@ 0S٨?tEPSt @dEuh'Sa+1]ÐU WVSuU ~ujB 0VgBxt}up^ Btr0V褈ǃu`{|sVzs8{c?KFjV rVЃ vjvLVv$1e[^_U0VSEMQMQ9ujj4EPCt FEEEUBE} tRFY} huEP(Y}hjMQWhuEuhjEP,nƃtvhjUR}tuExtp}tMQmv}tuExplv}tjubj]sbjsyb }tuExtpuu j/Epth@MQ8 UhPgu.Mpth@Q8Uh@jMQhPEpth@MQ8 UhPR hMpth@Q8 UhPjMQ_jq^}tuuE Hwy} uujEPEPURhMQ- tEEUB\} M9u EUEMvUBHXVÃt tBhjMQAu uESuhu u jD]jjjURMQPhEP0P]u} u URMQ,t?E6jEPEPURhMQ}, tEEUB\jjhSMQD tE}uH} uBjEPURjMQ设 ujEPURMQt E"E8v0UR uM UB`X1ۃj1} uM%PEPVURCu}t؍e[^U WVS]u jjuw,SM u@EPVSu+CTujjjSuCTtF @thjSV1e[^_ÐUU B}PRuÐUju uUu^EujjP avU@uojPjjRb tE뻃jEPEPEP)PVMQIb uEǀUBLEUMAPBjRj'QMhj]ƃujjEPOFtFBVv&V 7EPURaEEdEPEPjWMQ EEEEEjEPjuEP֏ƒ t t}%}EPRURi^@;]tG9C uC Zjj[ÃujjMQ7{ {EЉF@CU9Vt1uuF|UWVSjjhEPEPo v!uhURMA@|xt Q}Eh*ƃt1jjHPVhUR hƃt2jjHPVhUR hƃ>hVhh@S2 jjSEPMQ2 ttrtOkhVhh@S jjSEPEP u+SURv@PMQMUB@|xt R>|MEt@MQ8<uEjjh@PUR4 r tMjjh@PMQ u\@;Eu D;EtFhEP"@;Eu D;Et"hUR9t vMA@|xt Q${1([^_ÍvUWVSu dPjjjjj6lS HPVEPS-SEP*vjWE PtBpB0pSjjVPe[^_ÐUVSu] C}tPCtr0VRu1hCt0jVe[^US]M {ujA 0S97vQtxujAdPPSvh jSL]ÐUlWVS] Cxt t*E'vCtEPEP˸vC}u*EPEPFFuhEPj(vhhEP%ǃhWWÃu=0WRjhSEPVC @jhSEPUurC @uljhSEPUuTC @uNSEP.u:C @u4St =0.vhEPjEP13<0S\<0hEPjEPe[^_ÐULWVSuE~ujU B 0VU BdRhẺUЋU BlRpEĉUȍ}1EEE];]w }䐃WjjSV u:C;]vMU BTE܍UBjEPRjEPV#: t Ev]+]]ԉ^LFPEPAEe[^_ÉUtJC4Ev4vEPHE4F4 uEG>u}t EP e[^_ÍvUSM4t"A4S4RjQǃ41]ÐUS]M {ujA 0S{GvCLEUCPBjRAdP1A|tAQPjSO,uECLECP1v]ÐUVSuE @|%؃SV蠾uSVKztt1e[^ÐUWVSu} FEGxt trEovGt@E;!uFCMEdt\@V8<u/v\t#j G E v裧v~u,jV蓣jjPV}}WxUjEPSWV hU;Wxuj G pJGxHE{ts GtU0$Cujj}t' t_GtU0hVXAv tGtU0hV&hV~Vut-jVUЃtjG KjGtU0EPjGdPWV @UVLtFPFPPRV^X1vF @EEPSWVGx~ tvkvOtQEF @%f=u[rA0VXÃtF p3F XF `?F H VjF pVЃ0URV'jGt0VwhEPsÃtEPCP2thURjV뱍vE%f=t&f=t S/hjVw|jCPjjVػ uEPh jVCjEPGdPSURV4tGdFL}tFL EGdFLЍh[^_ÉU,WVS]ESUUEEB0MAQ9uYCTjjjSu CTup}u$uPWSUh1uEp,VjSm UUFEEPEPSsDUB @Ruw}tUE}u_EPE PSǃUREPWh`jS0}t*1tCt;xtu UvWW1%hU RjSEP }ujjSUhЉe[^_UukÐUVS]E Vxxt @t1PEPSˤtt EC1e[^ÉUMU B|% t t t%1 j B pQt PrXQ[ÐUWVSuFEX9uhjVvEEErC xHMUF8H9ErUEh}tEhVC pVwEE9t3FTu`jjjVտbFTRFTu-jjjV袿u FTuhV1e[^_ÐUS]E uh`jS(xxtPSduSu1]ÉUVSujj4V@Uh\ÃujjVb-C CCCC\Pj萢uhvc`cdCTPhht@j /u hSvCTPC\PCPCPCP` u h"#t tLKvhjV{tsP{;s8+vjhh0jhh0 jhh0+jhat s. s̤js- js,js, s蔤pth@V8hj/SO2u@jhPShSjV j)V'uFT 1e[^UWVShS.pDžxxFUlB VjjSlA@P+ t.u)hjEPhjURp)¸)ЃPpQlp:tu&hjURmvhWvp;p;wMAS-vEP:RwPURv1t uFtPMQI+)PWtjEP {C;p]9vp)SWV8%މp9pDžxx@PjjPlB@P) t.t%WhjMQQp)ÉptPEP=u#SpRtjMQ tEP SPURX[^_ÐU l{C9s9)dtPRWMQt tDžllFh]SS%hB VjjShA@Pa"0u-dPW\RB\d>dQWEPt vdRW||jMQ uD|UBLdtdIJP E@PjURU`1}tMAt\;Ptu U\Q9`H[^_U WVS}u{ ts FPC ujjW{ tVu s sC 1We[^_ÉUWVSE} uX9rPH tMtA9u)t;vAKt49tt+t'GNt :utGA8uNKt ut1}tE0[^_ÍvUVSutpVk{tsϗ{ts軗jjh"3V( s 袍S虍dž1e[^ÉUUJQA9tt T 9u怡TÐUWVSh/Et@EE3=33U8%8=85%p9%jjh0%ƃu85%tEP Ph0%*!hh0%,! h0%jjh0%à tYU2E }th0%UR輎}tEPjS輒}tURhgtS116VG?EE8*e[^_ÐUMU zxtB prtQ4tjQ1ÐUVSujj4V1t pth@V8 vhPhhSFjjVЃ 􋆬4PjSu V/à VjF pVЀ؍[^UVSuEXjj4Pbt UtXjRЃt#jE @ 0MQ`vjjEP\ЋU}thMQ t!VEPhUR MQe't t(vhjEPvj/Upth@ыQ8 UhPE!u.Mpth@Q8Uh@jMQhPEpth@MQ8 UhP  hMpth@Q8 UhPjMQjjjURPMQe[^UWVSu ]v8jEPVtЋE}t C; t; tEPSEPƉЍX}}PEP`PvPV؃vPhjUR } 1}tUBt;ptuUV[EE}C; t; tEPSEP(ƉЍXEPvPV؃vPhjUR0}tA1}tUBt;ptu U!V蓆hjEP1e[^_ÉUM1Ҹ<9u@#vBvQh2j(h``ÐUju uUju uULWVS}ujU B 0W[t@W8<u" uhjWTjE lPE dPjW%w uM AtEE/t@W8U ]EE8>t̀8 E  O$ȉ,,DB$LH8u@B$B;8r 8HB,B;8r 8IJ,FL0FPjV7 jjh(VPV&jjEPVf  Er EPV菙vj$P,PE PVg d$P,PVYBhjt<~tvvPtH@V8<iHZPtH@V8<u HutlPtH@V8<u MHtD7PtH@V8<u Hu AGMuErvU1ۅt^t Ut-EE;MvTQEPjVt E;;Kxv"QCxPstVu CtCtECxEUU :EE]<[z<*p<.hv<\t<~|v}MG<t6<~t8,v     BfCBCPtH@V8<uHtx~vPtH@V8<H\PtH@V8<u ,Ht#S>e=v~4vPtH@V8<u Hu\CCGM@EU )ËU1e[^_ÍvUWVSUEM91ۅtZt Ut0EE?;EvXPEPjR5t#E??;Cxv#PCxPstRu CtCtECxEUU ut&|;/t|;?uOt|;$u OE Et ;/t;?uCO;^u^CFOt?;\u{/t{?uCOvPh Ht\FCFOuÃ}t$FEM )ƋU21e[^_UWVSM1ҋE E]]tE8 uBEMuE]E +B@ҍ\Z]1ۅtYt Ut2EEU;UvZREPjQt%EAvE;Cxv#PCxPstQzu CtStUCxEUM M]^G 󥤋]EEtPU: u߾ 󥤃*vUPh- Ft\CMCEMu߾ 󥤃$CUE )ӋM1e[^_ÐU WVS}jh< WE P7&ƃV|\à ujjEP*VSWE P&Sh= jEP_ S7]e[^_ÍvU,WVSEEUUM ME]ЉE싃HEvF&t \tBUPtH@ӋS8<uyEHb}MAڃO$L FUPtH@ӋS8<iEHU1F]<u |1]|u | M|)U UgEvUB:RwPR+{}}t$w}t#v}tj}tkvEӁvR-K l4%ӁvRv?fl4VEӁvRJ l4%t6ӁvR覱l4 v]vE@;Evc=sE}uMQYEPUR [EujjMQz}FEEEUEEE]FEvFEvFEvFEvFErvFˀwӋMAS"UB:RwPR!y1t M;uuPaXvUPYMujjQ@EuǀMM E}}t$w}t#v}tj}tkvEӁvR]H l4%ӁvR<fl4VEӁvRH l4%t6ӁvR֮l4 vZvE@;Evc=sE}uURVMQEPPXEujjUR誢}vMMMEEEmMU E]MU 1e[^_ÐUWVSudPjjjjj:lS]* } HPE PEPS*SV?u1H[^_UE PuÉU,WVSuU Bx{tsjVU Bt0<CujjVZt@V8 vtJCEǰH9v/E&{uh jVXvt@V8<u 4t+U %PsVlEu (sVE EE9uxj jEǃxEx j,jlEUBUzE9x uP vUBUPUEPP~ FLEVPUEt}E uEU B|%%t'PEpVvPUrVh9u%EX9[uC vUPEUUZ9[uS vUPEpUBp$Bp V }t)EPF BEPFLB EPFPB!vUBxBUP UBUP1>}tEPnS}tURYSEPV e[^_U WVS}9ujjW yC0C9uh jWVE @|%%PVWt +sCtVSWLwsv$v W 1e[^_ÍvU WVS}9ujjWo xCpC9uh@ jWcUE @|%%PVWDt +sCtVSWvsv$v W 1e[^_ÍvUVS]u ~uvSPFtNF;C u1GjuSiu+j jvSQu1e[^UVS]u ~uvS0PFtwEPSs"u`juS]RtjEpuZ+F;C t4ujPu2QtJjuUu+jUCBE@UFB EP C @fBFpjSC‹EP$P(EEEC1e[^ÍvUWVSE96ujjP%MvU Bxt t 6u U BtEj EPEP襤‹E8uD9t J9u URh jEP谚]}Ѝx9tQ;t>C@@Ej/u'uEv@WPURt ]9u9uh EPjURY4;u 1*QvU B|%%PEPURVe[^_ÉUM9t%E @|%%PBpQjjQU WVSuU XC;F uC FLCFPTjuVfu-SC BSCBF Hj jsV]Nt 5vSVHu;] u98u PV,1e[^_ÉUWVSEE9ujjURMy8"wh jQ苘EE0<v^!;^uURh MQ h EP迥{u SU C@E}ҍJvMDPjjh# EPURjjh0 MQW 9^uh9 EP>;^uY~tSMQ8BvE~ЍHB9vvQ@ 9^u; PhF UR hM MQ̤F9E6UBTu+jjjRnuMATu ;u1e[^_ÍvUWVSEEE U29EPVE P$^mvEPSU R9^u UEBEUUE@ BUB9BuEB EP EEUP F9uE8UGB9?u E WEEG6;u7EXt?EPSU RouTEUG BW EEG u‹Ext-p0GujjU R脕1e[^_ÉU WVSjAIÃt,ߋu E pM0CtE1jjue[^_U WVS} tw!VHÃujjuΔ1vVWSMCCC CtCCE1e[^_ÉU WVSu ,~t~-~ tF$|8W=HÃujjuA0WVSUM~tC(C~ t FC@C E1e[^_ÉUSE] ;t CBCB SsHSH1]U WVSE] KC9t?ƍv91uAC AB9quCQQDHK9uƃ;t(9;u CG CB9{uSSH1e[^_ÉUUE Mtr t!/vh` h jRܒh QjRJvÉUWVSEESUREXuu u>t1vR7 l4%+}jFÃujjURvGPECujjEP{uSFKWURsJCCUB CB Z FE>tF1e[^_ÉUVSuPV9uvPVFCu{t sF1e[^ÉUWVSu} U=wu`%1t.W聚EuV u EPjfE]ChjRWSSV tHj(WIt)hjRWSSV tEPjV<1u džUVLFPFPPRV1e[^_U WVS} u];vvR4vl4%@uC;ù;wC;jvRD4vl4%@tC;ù;+; vR3vl4%@uC;ù;C;vR3vl4%@tC;ù;E;vRd3vl4%@uC;ù;tO?t;t*E8tS~ 1e[^_ÉUWVS} Ӎ{C PjBƃ FFF FF~SU RPFE P }t Ph hS#0h SbYװЀ| uװDRI u鍅PPPPҋЍD,PjÃC(CPDHCC@C PCVF C 9Vu^F ^ RhPPcF9Fu,h U RjuMV@H뺋FF1[^_ÍvU WVSEE} ӍsC PjǃGGG GGwSU RPD1EXt/U RWSEPtKvcuҍG9Gujh U RjEPZtCUZt9Ct,Cu&3‹C hsjEPKuȃW? GG1e[^_ÉUWVSjjE p誯E}U B EPMQu'jjEPjjujvVSEPuމ)89sC< u9ue[^_ÍvU WVS}] u9s5VSW5utv9s C< u9r1e[^_ÍvUSEU ]: t: }B;@B8t9s : t: uӀ8u19s: t: tv[UlWVS}EE 9t*9u{ wU RJ1 C@vj jjEP0ÃU S9RuZU XE UBL@CRUTt*dSCXnXnt%@SjjEpLP蚔 kWURSEPlEjjEPUR#[4EH w$EEPEPD`C@;C vPC PsUR:CEe$ER t{tSC|\3tSSB9SuJC|.u@E 9u CU CBE 9CuU SS/+vj jjEP.ƃSBVt^}u3VučEPjEP u+7 VsSjURݒ EWEPVURE U BC9u U BE XC;CEC;CE1;ss9CvR&vl4%tF;sr;su;CCUC@ `nhXnj 48{.}t}tpvC@9CEECvPEPjUR'Essu9CEEEC@9CEjEPU|CC1C;CdSEP_ 7vjURU|WEPSUR} @t>UvRo$ l4%t} t }KSE CEve[^_ÍvU WVS]} u@tuht?t@S8<uvtwhtwwh }hXn-e[^_ÐU WVSEt@MQ8 EUt@ыQ8< E11ɋU ;rs)BEU< u1)FAE ;HrN1)119w1)G1)9v)ˍD;U ;B v%PЃ PrMQuMU B;M AAtM QA AOutE P@ U BKu1e[^_UVSuFLEUFPBjRj'V{uQ^{X| KXC4C4t$rFuIEPV(kuC4/vEPVgt"C4 v4vEFLEFP1e[^ÐUS]hS蔊hS膊 h Suh`Sg hSV1]ÍvU,WVSU BxdBtEvR  l4%tBEUvRƒvl4M E=tAE0=Ht;t"U2;Ju;t }t\C uV}t4MvR ƒ l4ME0phUR覈IsshMQ茈tu sshEPKukC tbE[vR<vl4EEE]PUpMt vFAuu3sVj hUR觇 ;tDMATu5jjjQqQ>UBT+ 1v1e[^_ÉUVSuU Bx3Btxtj B pVBBt~a[t]uBt@9uH~u3 t@V8<uvtpA xuFTu2jjjVrO{FTk /v1e[^ÐUWVSuU] 1!E <@<~ V`MNdEFlFpFh}tN}Fx^tt[^_ÐUWVSUM u}ZxBt 1yBxJxBt[^_ÍvU WVSu EJE{,U;S0r)@;C0vPC0Ps,EPt^C,}{,NyVaQu)F uݳ8u&ӳf 돍vt u}u vEU1 GEYe[^_UM} uMA0@9A,tDy(t>Q(zt5A,A0Bzt 8u+A(HPhgjQu1UVS]sjSЃt sjjS\ t@S8 vC4`tX@S8XC81e[^UUE M $xPhjhPjRRyrPhRPh Ju h`uI{>uCM;t7vvRvl4%tC;űU zxt;uEPj߰HPSU RVU Bx~ tv3&vE HtQ:F @%f=u[rA0VNÃtF p"F XF `?F H VjF pVЃ$WV<jSV|URWE lPE dPV|.e[^_UWVS}EMURU0 M}tE UEEE+};uvMAQ9upUBTjjjRfDuUBT}$u1}uPEPURUhEEPEPjVEPK Wuju;EE OxوvWj   uEFE;uW uQEPGP\u"E%f=uGPuW~Hu13vUB@Xuh:u jRoWHH}$ujjEPUhЃ}tUE UE؍h[^_ÐUMU yujB 0Q"vjBlPBdP1B|tBQPQÐUWVS}u ujF 0W'F|t^X(ltd@W8 vdKEEFdEF|%%@t~t' tRM==B1E9Ev U)‰@FdFdFd!v9]v E)@FdFdEEK9]v E)؉Fd Fd]^lGLEUGPBjRj'WgEK9]v U)ډVd FdEHFlVWqhWOwUUVdVlVWp chW wE@FdEHFl%vtEEEFdEHFl}t&EPWMFl;EvEFlVWHp}tUWL1e[^_ÐUh@juhÐUhjuphÐUVSu] EPC PCP3VF t }th#jV&h@v{ ts sltCCCCSC1e[^US] Ct$vC PEPj3uF t CwvEC{ ts PtCCHCCCC0C H9Cu CCCSC vv1]ÐUVSu] {ujSvLR IISVu{u/SvRH vl4%u1e[^ÐUVSu] SV~t@{t{t܃{u,SvR  l4%u1e[^ÐUS] {C$4;t~C PCPj 3uD tv{ ts stCCXCC HCSC?v{u;u C(CvKCSC vv1]ÐUVSu] SV t@{t{t܃{u,SvR  l4%u1e[^ÐU,WVSE@E @1tPU}@t}*u(Mf|jjQEEUUvR l4%t.UvRE l4vUMA@vt 8SuuIj}wE@MQBXEPEP5PURRMEs C9tNCu9>tjjhjUR7 ujvvjMQ7 uv9uE @1t-phj]SijPSjUR7\1e[^_UUM AwN$R8QR,QR* QR&QRGvÉUVS]U BwZ$vSVRS:RS*RS6RS vЍe[^ÍvUVSu] SVDt1K@{,t C,@ u C t}u|}uVWdEHC8EC1tSM9Mv E9u9MtJuE)HC@CuGEtEPV4u!U RV0u }u1v Ve[^_ÍvUVS]u jEPjsLS4tCLCPCP;Er}tEH1CPCLFDCPFHf0N0 1e[^ÍvUVSu^{uVu5EPVSu juV1 tu?oUC@BE@UC@ B EP F @fBELPua9ExLu@LvEEF1e[^ÉUS]EPEPjsLST3 t{LujjS@}t*jjuujSHu!CC1h"2jSS]ÉU WVS]} CxuSguSCPC;Bu1FsC@@CEPSL8uwwujS4sse[^_U WVSu^jVǃtDCPVSu/jjWsSuC@`X1sIe[^_UWVSE x#u@+U z+t&z-t jB(pMQlE @1t#x}jURՐM IMEEPEPEPE p4UR0 t }h됋M I8|;MQvE|vR l4%@t||;Er|;UM ;Q8tEPPjP9u+|E|<0|Xt |xDžx|E=wu`%1u EPh2E||Xut2pNx2p;vE|<0u]vXDžxG=wu`%1E<8t}<9tw|2pvt`E|<+t<-uKDžx |G p2pE=wu`%1tLiDžx |l2pE=wu`%1"h2jUROx xtvxE=wu`%1tE<8t <9E<Džx l2psvE=wu`%B1>E=wu`%1u&EPh2]u vG;}+|1ۃ}tEXt Ut?DžtEE2;EvcPEPjUR;t@E2;CxvPCxPstMQ uCtCttCxEU;}u/V|EPtRtt |Ex j jPEP蔹UE x-uڃ}~~+E9}}}+E9Uup;p2u l2pupPjdEPSƃxRjPEP艸M y+uE;Es EEU9Us M)MxuuVpPjdEPSƃ |RutQ菎VEPt|Su +|lE)PEPSM|E+|+l‰UutRM q4EPt/à PURNtt51}tMAtt;Ptu UtQ؍X[^_UUE tr9tt-Svh2jRlKh3jRXKÐU WVS}hjyƃtRE džudžHt^HDujjWJvHDD趌HH|t:|HP|E P芵|u'1e[^_ÉUVSu0t0DtD|t|tS|dž1e[^ÐUSME ]2t? &t zItcqXtP@Q8PPS-St@Q8 vPQE0Q1]ÐUVS]u EPjjv4S' u}t EHv1CPSt+@u S/VSe[^UWVSu} jWVadžW4VLEPEPEPRV&0t}uMEv}tFP@9EtFPFPSG1tGPjjuujWVP9e[^_UVS]u CPCPPv4StASt+@u S.VSe[^ÐUWVS}u jVW9LJV4WLEPEPEPRWy%0t}u7E}uSF1tFPjjuujVW>8e[^_ÉUju uUju uUWVS]u j VSqǃ{Lu4EPS*}uEE1E3CPSt+@u S -}u:jusLS(u_EPEPjsLS$ uBSLBJjusLjS& u EPEPjCLsLS]$ t ,vSLJWF1tFPRjuujVS6e[^_ÍvU,WVS}u f0N0 V4;VKss4V‰S@{,tMC,@ tD;S8u?Vjt{,t"C,@ t{8uVkOvC@C8;C@s{,t)C,@ t K@C4S8v{,t C,@ tK8C)t? (t(‰ E< M A4EUEPEPpE9uG E;EuOtHEPURփ}tʃ}t}uօth4jMQk7EU BF,@ t5~8u,uF4PEPbN4N0vN8~4sEPEPjWUR QF1t^ۃ}tuuat EKE~8tGEPEPjOWEPh }t}}tuuatKEE8 u K뎉E8.u}zU|:bMv:Auz u}tB:AuKtO:u1}&uu` KtECv~M9t6U:Bu"y u}t UA:Bu Ku~<5v9ũEPEPjOWUR uF<F@~8uf0N0@N4N0N8FEPEP6uK G4;EdG8;EX}ujtKEPEPruÃ}UvRػvl4%o}u.KEPEPw\K[vETwL$8Bt<5u 1u1)u KuEPEPtVEPEP苮}G4;EuG8;EujEPpDvEGvE PURWMQ跹Ãs9vu^XC8}GLCGPC}tNE* tUJ)@C(E+BHC }+{{ E) tEpSUR*&E(t1} t+SjjM Q}W CC!vE(tC$CC vCC$E*@tKSE CCC$E(t$SC CC jsEPDžDžE+@Ut@ыQ8v}tEP8+FMt|@Q8 }| vDžDžHDžDž(0TtE*%(DžE+tDž(e*Dž Dž$E+t ƅ;ƅ;DžDž DžLE*t Dž@ Dž@CUBLCBPjRtM A1 }䉽4@j4PUR'LMu~DžLE,\;A4s Q4)‰EԋMA4E܋,LJ\LJXLJTEPQJjEP蜄 4BH wR$H;vMEP}WjjEP|9D 4RMQi) u?E+u94 u-,DDž(e*M+7v 711E)ttUTtL@׋W8<uOELtCUTtL@׋W8 UL4G 9uE*tvEt@}W8<uPEtCUt@׋W8 U4G 9uutC;C$u C8uLPSEP4BtL~DjMQdth:j}WDžDžE*B),;Hv/PHPDMQGqL,D+Nj,D4E+t*+,D4tDž4x 44B  t up@E*t@ u&4AwDž KC(2 uDž 4 Dž ~J4B =wv`$%1u"Dž SMQ%4GH $t;E)tbE*t jsEP%Utjjh;jR C;C$C8(u{E+uu0TtfHPDPE(%P4 PS}W( Dt$E*aD)Jv(t Dž(@tE*t@PSURE(t { tKK CC4CC0CjsMQəVC,{({ E+CsvRԨvl4%t FC,uƃvR脨vl4%FC,OCsE t@MQ8<uBEt6t2vRvl4%tFOuDž9B PRVEPƃUxMA|F9QxuqxUB|0Mq|~ ~(C@FE($uTVuEPjQM 1҃}tMQtE;Btu U1vuEVsSj}W .Dž$FFtuxu ptFxp ;F vPF PvEPk FxtpPXFFPCxtpFtFxF(pF Dž~(uB~ u u}tEE1)EEEFs}}u 9]11;]w 1)G1);EvU)ʉUM +A9tO)ӃQ)‰PV)P1M )Y)Yqr  Fsmr  FmsEe[^_ÐU WVS}U Euu;uFvEPEPjRW tv@E]}t5vR茓vl4%tCMu+]tRF;F vPF PvW{XtF~tvFPP0^Suvp0^1e[^_ÍvU WVS} uM^9uAuh;jEP"xS4S{(u{ uC C C !9>u FG FB9~uVV輚jC@PEP u1e[^_ÉUWVSEt@MQ8< EUt@ыQ8 EE11U ;ZseM A< u 1)BU B<w@MQ]BvU BPMQѾCE ;Xru}t1uE)EME1u)UE}tU B$B9BuEM A;A$v*QE H@(U B;B$vR| t| t11M ;YshvU B< u 1)BM A<w@MQ]BvU BPMQݽCE ;Xr;urE16vE1)E1);EvU)ډӃ}t E؋M AE }tuvjVU RMQ MuE tujVE PUR Ku1e[^_U WVSDž EU zuDžJuvDž] sN{vRf l4%uU ;rt;r$tN벉M Q)֋A@;A v"Pȃ PR]S.T3} GE p21*jjjjjjS-r S]S@PWPEPt9]E tt) }GWd]װH9[֋@ NEP0R.uE%f=@u  UBRdMPS}WhE@E9Xs @1;s?:u$]F;s:t{EtKt*Ct!u؃tU )BB(M y(t.CE H(@x(uԃM Q)֋A;A v"Pȃ PR}WPU BM qyyy tq PP(rCs惽EPE0+E%f=@M y(ulQ)֋A@;A v&Pȃ PR]SOu_} GE px tp R@P'M A v] K(} G/Dž 1[^_ÍvUv?w@MQ]BvPEPȶG?u;uvuKEE%<@EEUtEEEM;A8EPUMPEP=Nj] vK~!Wh <URMTtڃ}t,1}tUBt;xtu U WǘMTlYvEP8J1uE9E vE 1uEtE EE]1;uEPMUPMQRǃWh<EPE }t.1}tUBt;xtu UWMT];] s3h<E+EPh<EPZUTugF;uIh<MQETu=E܋U9U h<MQiETuUR MT}t E1e[^_U WVS} UB5WE< uEPEPwRMQq GWE<w@MQ]BvGUPEP蹳E9]EG;G v&PG PwURrKu GM)ى˃ t w GUBREDP_#__(Ewƀ> u؉Erbv FsTWE<w@MQBXGUPEP ]r BFsWE$jwURve[^_ÉUVSuE XvKSVuu^LuFLFP@e[^ÍvU WVS] SC MSJC1v;StC;S$t>HJG8upt/FjjV,8uvSCM `SCM S)S){CL{(ts(CCRP!{ ts CCC(RP!1e[^_UWVS}u Et~(EN(~(2FEE8 u4VE EPEPvvWnVE 8U:w@W]Bv]PWİEEbN(VE< uEPEPvRWm AvVE<w@W]BFUPWLEE;Es E)EEF;F vPF PvWG"FE])ÃF F(PVE@PUDP^^(VE< uTre BsXVE<w@WBXFUPW蠯MEVBr ABsE}t ~(}t0F+EFt%F F(EPVEEPUR}tdF@;F v"PF PvWFu RvFF~ t0~ uNVD vF F(PFFP@PNV] F1e[^_ÐUWVS]} u{4u E #~wG4W8GDWH VF|\u|\FVDP|tt@S8 vtPyt~t VF|\t G4W8GDWHVN:D u$t| \tG4W8GDWHM!WFE􋃜SMtG4W8EU@vGDWHEUHV:/uPjFHPBPGDPEPSF"PjFHPF@PGDPEPSR% u7GDCLGHCPE CujSJUt xM Su㋃FM;t(jjS1uCjS1e[^_U WVS}E EtEPSWEsssW^uz}tjsW3ou_sdvEtEPSW vEssVjWӺ u}tjsWnt FGx9u1e[^_ÐU}t}uրw EGSW蒪Ph <jWa1E9uF뙐E;EuNuE;EruE;Er͋EGLEGPjWRu j@\tT@W8TPjW@e[^_U WVS] sN{EvRL|vl4%u";st;s$uENOE뱐OUJEB$EK )J C(B(E)CUtEC(S D)CC vEC(C )CC C(vR{vl4%tKK;st ;s$tON뾉M1e[^_ÐU WVS]}{(E 1Mx9us vB,BƋ9u9sU);{(v{(jEPjU pEP4 u(CCUWRP7C())CC({ e[^_ÐUh@<juÐUWVSE X4p8@1trxm}uOM AHV7;ErEP))NjE PHT71BM AHRVuuSMQ t WtC1tBEPEPjSEP6 oujjMQ vKE XD1e[^_ÍvUWVS}u ^4EPEPjSWг u<}t?F0u ;^t'EDU;Sxv'RCxPstEP=u eCtStUCxEUEPuURE1uuEUDE9ӁvR6x l4%t&ӁvR bl4RӁvRwvl4%t.ӁvR.ll4F;uFt"EPURu EP.tE1}tUBtU;Ptu U EPlEe[^_ÐUUE @HBHXB@4RϾÐUSM] A,AxX|HX@4C1 ux4uP4@4tu"CDPQivCDPQ 蟉v]ÐUVS]u tEPSau&;ErjjSFh =jSte[^ÐUVSu] t#EPjj3VO u(EH9CujjVh`=jVe[^ÐUh=juÉUUE t8uh=jRh=jRÉUh >juÉUVSu] Kt:vR(uvl4%u1 FsƸe[^ÉUUM Ewr$?h@>Fhs>j:h>j.h>j"Qh>uQ h>jRQh ?jRUju uUju uU,WVSu F1t~F4EF8EEPEPfP}t7}UvRs l4%t[~,t9F,@ t0}t*u%==~,9~,!,EPEPKhO}tOt]vSEPf}L}u.UvR s l4%tu*~,t$F,@ t=t =!SxSEPg}OO1ۃ}u4UvRsr l4%u}_tvEPEPe}M}UvRrvl4%uzu>UvRq l4%n}_u@cvUvRq l4%u }_(u<~,t6F,@ t-=t=!uyEPEPetbv}u,UvRq l4%tEPEPeu@}t OJ~,t F,@ u'E;F4uE;F8uF4PEP7JEFjuVXjjCDPVsjsD~jvDuF1tMFf1E܃8uPVW E܃~u3 t@W8<uvtEpAU܉V(:.tD} uPwÍ@WBXPW?P$} <;G,uF( N1 M A1 uhA F1tE H1FU BF1t FM Au 몋E܋@EF1t }u]Uu F1Mt=jEPjW s} 0Et EEFN1>[t>]t >ZjEPjW #} Et U]8tb}uM܋AGE8~u0 t@W8<u txAUjP|>zjEPjW ~} ;Et MEFF=wu`%1tZFPFPWN1jEPjW } Et EEF}tFU8t?M@u4wÍ@WBXPW菄PhBEةt1jEPjWuu} t6Et UEFMA*Wu>}t1r}t'h+BjWGWd1e[^_ÍvUlWVS]C0% u2}uEPSEPjEP tz}u M eEtEEEC1tCEMc1K1:Eu~K0 UBLC4C8UMQLJS+ȍЉЉUC8+dMH U BB BBTLt:t DžP~<DžP$PwP@MQ]BPSEP1wPPwP@MQBXvPSEPwPURlXЃ]SllЃ|xSl Tu'Dž\] C Dž`CHtsE @ \M Q`p]t @S8<u! E ud9T,MI8d]U ;M yA;A:AtY\A`RB\Dž`\U J `ZpEt @MQ8<u#v] ud9TTUR8dCDžXDž\Dž`Mt @Q8<u|] l\;tpPp u~@uuMt@Q8 ]Et'4@Uz8X14Ӊ)ZX]1)APwP@MQ]4BvPSEPsXT9Xs\\;t][8dT9X\U J X+T)Ɖ``Zp\;t#pPp @uyEt@MQ8 ]Et'4@UZ84X14X]1)APwP@MQ]4BvPSEPqrXd9Xr)XMI8dOt\\;tXt.\E P X)Ή``Xpv\\E P @}t#M ];CLu\9CPr d;CPsDžhHUJP+\hh}]8DžDDžX\;tspPp @Mt@Q8 ]Et'4@UZ84X14X]1)+`XNPwP@MQ]4BvPSEPep+`X1ɋd9XrouX))ƉE XXX5] SX+d)ƉCd9Xv DžD\] Ct\hh]u DU] +؍ЉЉU]tX)EXH]Ut@ӋS8<u*vEtUuTu]H-HtK]v;8r#)PSEPlXЉ߃ Gsv>;8r&])PSMQlXЉ߃Pw"P@MQBX`"vPSEPAn`r BGs\Dž`\;td9XPw$P@MQ]B] CvPPURmM A] CCtHC<t_XUB5>;8r#])PSRlXЉ߃]S0r BGsd9XsURllЃU9v!)PR]SlXЃ|xMQl1[^_ÐU,WVSuFE?@PV~EEPEPVU苂pЋ ;}t @V8<u  t{ v{;t}u3V~tzj+ЍЉЉPVU苂3hgCj W PWVU苂XЃ;'uuVU苂1e[^_UWVSuE{~ w tOW?`\*`ǃdjtP5pPlPVpЃ EPu VPEjF@;F4rF4HPVЃ uEPVXЃhPEPVpЃ VlЃhF@;F4rF4HPVЃ Tv`D`\u3`u*jF@;F4rF4HPVЃVlЃ pl\`jEPtM))ʉ)ЍxM)щЃ=GEUtxdu ǃdhF@;F4rF4HPVЃjdCPdVXЃ hF@;F4rF4HPVЃjVЍe[^_ÐUS]SjC@;C4rC4HPSЃCjSЋ]ÉUWVSuFEt1EuCPE uCPhCV舣Vs EPEPVUpЃjF@;F4rF4HPVU􋂐Ѓ VUlЃ} t@} ЍXًF89vÉكQU RVUXЃv1ۃ}t?}ЍH~8G9vC)QURVUXЃuuVU􋂐ЃjVU􋂘Ѝe[^_ÍvU,WVS]}E@EUUEu UTt2EtUTPdЃ ETUu3tBjR EPH9} ujjURU\ЃSWhC} ujjEPU\ЃhXn83EUBjREuWSU RP vEPEPEPUpЃ} uWSjEP`$|; uOUz4uEPjR\ vEEEP8JUE샸Xt]UXE;EvjhCPEP/jhCUPEPjhCjUR U E쉐PޅhvR(7vl4%tFOu΅.E싐X:;EE)Ѝ09v4vR6vl4%uK9w9uEU+X<]SvR6 l4%tKύv7EËE))u)~|.uK)PVU REPtjhCjURrUBTu,jjjRhuUBTu uuuEPUЃjEPUЍe[^_UWVSE@xUtMh}EPj URh+Mpu EpvtXpЋM;A8v A8)ЉptXNMy4\uljA@;A4sH UB4PMQxЃMQxlЃ MQt\Tt\M;A@ut\Tt\tjjURyjMA@;A4rUB4HPMQxЋt\TUBTjjjRfuLMAT7tXUB@;B4rMA4HPEPxЃ} ujjMQx\Ѓ}M`EdpJl\d u wÍ@MQ]4BSEP'`ƍ>;`r1+\P\RMQxXЋ\wÍ@MQBXSEP_ƒr BGsdl2U9v!)PRURxXЃ} ujjEPx\ЃMQxlЋtǁXpE)EhSEMHhu(tXP|PURxpЍH[^_U,WVS]} CEXt*jhCPSdžXdžPt$CjSЃt,ju\wHugCTu[jjjShcu CTu<%t PWS PWS?tC9t@t jjSU\Ё\vWE\;C4s S4)‰EC4Edž\džXdžTEPSdž\džXdžT1e[^_US> _luE؀U؋\t(u)}tjjV E؀1EjjVEU؋\;F4s V4)‰EF4EUǂ\ǂXǂTtEPV?uu܋E P1e[^_ÐU WVS]s{4ttj\;C4sS@;S4r@S4)‰v1PSЃStЋC 9t*jC@;C4rC4HPSЃSЃ }u T;C@rEPu Se[^_U,WVS]sjC@;C4rC4HPSЃ{4u EPj1}tr }u.EPjvEPj EPjS?vuPSX\LJTSlЃ jSЃ} tE vSdЃjjEPS^uI}t}uEqT}tr*}u$}quT}:u} t E e[^_ÍvU WVS}w8v_jjW\ЃVhCWXЃ jjW\Ѝe[^_ÍvU WVS}ujjÃttVG:C tQVWPZsE CE@PluXllC@v:utXS"t S:WVhChne[^_ÐUVSu] C ;Cw?RЍBBjjPVt C S ;Sv1e[^UWVSu~@t _G9t9t @9uEt@V8<u tM _a9tYuP`#uEt1 %PSG9u} ut FuPVpt YE_G9t)EtEjVS`;]uڃ}tjVЀ1e[^_ÐU\WVSuFE̋UEE tQǂt jvL} jvLjjV@FD;F@VL;v@RV8Ã~@tF@9v,#F<;F@vV2*Ft! @V8<v E UVLM;sFP;EEPEPEPRVZ[ t}=vFPU;E؋+~PG;E91ۃrGEMM؃ wEč@V]BEPV/NÃsK}wEč@V]uDjVWjS=1s8tAuuȍe[^_UEPE PjuSO }t} u}t E1v8t0@S8E 0Ut @S8E v Mu uE1t@S8<u tE}M}UEE uo}uit@S8E Mt"@Es8u܉M14 1E)/v}wE؍@S]BEPSOAUUEǃ}u;{8r} u1E1s8)U+{8M}vM MMUEE up}ujt@S8E Mt"@Es8u܉M14 1E)/v}wE؍@S]BEPSO@UUEǃ}u;{8r} u1E1s8)U+{8}}t}u C5E}t u+uM1Ee[^_ÉUUM }t"EPjjQRLu$}tEHzTtrTQR v1UMY;s8<}F}t } u1+s8mu؃mMUE us}umt@S8E }t&@EC8E܋E؋M}14 E1E).}wE@S]BEPS=;ur%U+UU;uuEH9vOKvEBvE؃}u)M;K8r!} uE1s8) v{8)}؃mEHe[^_UWVS} ]Eut u$ujURNu uGM;8U;8tr t?n!vMQt]ujjSZV}uECt @S8<uQ v uCxt1S7PCvjSMQ_+wFvjSEPEƃC;]s;uve[^_ÐUWVS]u CE{4wjhEjSIYjjS軾{4}t vj@P蚒‹ujjS8Iu CL@@CD;C@ЉUC8F8E}uVEPSju7U)‰ЍЉЉ@9s uE}toC4)F4CHFH{4F4CHCFE9Cu UrC0sV4C@)Ѝ@PRR5~4C4)C4CHFH^E9u Ep p3{4tC4HC@~4tF4HF@}tj}tF4)C84  G 49 <84v 49=<u  <84]STSc @uS$P=}EPj8$EP1vW l4%u_uEPW8G~WvEPbEP`=0u!HPv,0, 0^uB=0u!HPPv,0, 0E vE[(ET%=T%]4X%= t t uP 1uvWӃt VWG~݋EԋT%װ,H,װH0)‰У0u!H*P]u,U, 0EԸT%Uԃ<\u?t6=0u!HPt,0, 0=0u!HRt,U, 0-=0u!HOPt,8, 0]u ,0\u?t6=0u!HR't,8, 0=0u!HPs,U, 0E܋EܴfE܉EEڴfE1]EE޴fEރEPEPEPEPSV}= vVvl4%t&SvVA]l4NvV l4%t0SvVy8 l4PFuԃ]5}]SS$P8= vVvl4%]SSV vVvl4%t*EPvV:l4*EPvV@7vl4PEP24%C4e[^_ÐUS]P;P|6|ȋP҉PP;P}PRp ¡P HP @w$I L@LL;B~B]ÉU=Hv`=HT=HtH=Ht<=Ht0=Ht$=Ht=Ht =Hu5HA=Hu@;Hj`=Hth8JoHhÐUVSu@ D=|= ~== }4FP@#FPÃC)ƉPDe[^ÍvU WVS}u 19}!v;@ 4C9|e[^_ÉU WVSZ=H pơx)=D}h k=@uhR;@}UVW2h ) C;@|.vVW h h C;D|TH5H9HHe[^_ÉUvh ~=Ht=H t =H}US]=H u=Ht h vh =H tċ]ÍvUSEU ],(048<=uhEJl HCLj'=HthYJlC PUh H { t h2C ]ÉUWVSu} 1;^}T؉ىTC;^|FG[^_ÐUWVSUM 1E;x}.;sGE;x};r];{};u L1Ӊ΋E@;x}!ULtGӉ΋E;x|[^_ÍvUWVSuEEFEU;BM ;A];E Mϋ];v]ߋT~TEgUM ]؋};s^TىT6v^U}TىTEN] }D DEFEU;B}HM] ;KI}E;x}.^U}TىTEFEU;B|ԋM] ;K}-^} }TىTEFEU ;B|[^_ÍvUVSUM u1;^}:;tC;^}-;u;^}!N;^}DT ىTC;^|[^ÐU,WVSE}ЉU}ȉME}] ;{}Kv]D1EE9M|EE};G(_$UM; uf} G;DuZD 9EuPD 9EuF1U<FM ;q} UB$T8D;Du;tًM ;q1EE};G(sUB(‹M;A,|1|A,9}]C,}G,Pw$`G$UB$M}<U BP‹MA$TA$P} WUB$ML B$UT MA$DA$DA$D1;wP]]}<}EEvU ]C <T}t @u vt}t ux}t @u t}t uYuP}t | v t}t u1u(}t | )v t!}t u t }G$MT}_$M| uDU G D 0vM ]C <uC$UDC$DF} ;wE@(Ee[^_ÐUWVSU BP%E1M ;y}EGU ;z|1 EEM A <<<UTEUuMQUTRPEM<tOU}M A w6$hJ&EU} G0};|}/אUЃMQVSMEE H0U;T|ԿGM;y}We[^_ÉU\WVSE UB4BPE؉EMAPEԉE uFPdE̋FẺEFPFEЉǃ FP/EȋFEȉEFPEE E;F}UċMEċuċE;p|UBPEjMquF0E E;FUB Mċ$JvuEEE1UBEMMu1;_EEURMA0PEPEPJU މMME;|^|&vUM܋UBH މMU;}݃ދM܋PދMA04EދMA0M ЃUB0PMQC;_AuF Uā< 8MA)uFEEEGu1;_UUMQUB0PEPMAHEމUUM;|^|&vEU܋ ɉ UBH މMU;}݃ދM܋PދMA04EދMA0M ЃUB0PMQC;_Au~t UBB MAEEu~t GG:vGuƋ_KxvMًTމTKyGEGG1u~t;~%-MAAEGG1u~u~tUBEyMA UEuā<%EEEEU2M1BAEj1‹MA0EċuċE;pqEUċM;Q]uF }ā<~<t <~nSUB0MčPuVSqN0U }ċD;B}BP4‹F0UB0MčPSEċuċ};w\EEEċU;B}-]S}ċu<7WVwEċ}ċE;x|փUREP1E;u}3M]v}ċD%T09tEċE;C|֋UB,B(jMA$jVEPQ uV}W EPUR MQuV ue[^_ÐU(WVSDž=DžddvdPl4d%u d_uhdQdd~h$PPGDžd] S$ӋEEd;t\vU Dd ؋\u F <w\W4Z8M A <\SPhu V$}| t|# u\P$P] S$u| t@u:u2Dž(( ! ((v勍] S$u| tu<u4Dž((!((v㋍E P$]| t u<vu2Dž((C~EUz8u R11] EH@UE4CtPe[^_ÐUujQÍvU WVSu Ѝx];tWVS/u C;u1e[^_UEt PUVSut%1ۃ>t4ݶC<ue[^ÐU WVS]E P$E uSEU 1;t vE P4uvG<u1v<t,4U RuF4O9uPS謶Åt"E DU R1e[^_ÉU WVS]t} tj谴ƃu1~;tq1PE 5{tC:AuB<t: t9v׃PAPutWSVoƃtC;ue[^_ÉU WVS]t} u1:1FE <t(װHPRS ÃuΉ؍e[^_U WVS}t} tj蝳ƃu1VEE8tpv1U :tTE 4UE4uÃtSVƃS' StGU <uEEU<ue[^_ÐUSUZJB 2]ÐUU؋B 8t"Mqr]؉CUԋB 8u M؋A]sEpU؉BB 8tC 8tPr M؉A m]؋C f|utq~VzFVkN VFN VF@BAjv 6d tEEU;B}tMj ËU}PͬC URP>MATCYTuE]E;XY]44` tQtE t 6EUM;Q~V4e[^_UUM :t9u B:u1ÉU,WVS\E`U=%}99E+EU+U9~@U19}.E+EU)‰UM}UF;u|U)U6}+}}19} MEU<<F;u|EEU9U~ }9h%+`\`[^_ÐUS]%`\PhJ购X;-uTC7;+uTC$=XtT vT؋]ÍvUt>=u]E"}u]EE vEE;tJP)PR3 u؉+P;H9u]UUE}tR}uL=%t%M 41hJhn/=PװЍDPBv}UU%>Myt F5l$=%tT%U Dx-uM12h Khn<*E0%U DP2h`Khnw<P߰ҍTPUB #MyE9%}%U l%l=%t%M t1hKhn;P߰ҍTPUB %?M9:9:/PװЍDP}tMU Ex,UB v}t1%M x-t PPEP=%tU%U x-u5P2hKhn;+5P%M P1hLhn:P L%%?.vPPPEPK¡P8u%t:uY=%t<=XtPU 2h!LhnG:PM 1h;Lhn,:ã%?:Wz;EEEEP8uVE9%u@=%tPU 2h`Lhn9ã%?M9::%U l%5l5PF>t>=u]E"}u]M؉M vEE؃;tJP)PR3du؉+P;H9u]U؉UE}tZ}uT=%t%M 41hLhn8PװЍDP%?}RU܉U؀>tcMytF5l=%tE0U 2hLhn:8PװЍDP?UzM9 %}%U l%`=%t%M t1hKhn7PװЍDP?U:: :PװЍDP}tM؋U ExtP@ 1vUB PWz:z:uP8ueldP8uMM9 %u7=%tPE 0h`Lhn6ã%?U::u:%M l%PÍe[^_ÐUjjjuu uÐUjuuuu uÍvUjuuuu umÐUS]E t'P胆PS5hNhn5S5hNhn5]ÍvUu uj袪US]SetujhNv]ÍvUSE] tSP͠ vStujhNe]ÍvUU:t< vB:u5l|‹E 1ÐUVSE] HJ9wA;tR31 vR{t15Hօt H)É1e[^ÍvUWVS]u=Ht88%O15HUt H)lj=4菷Hu١HE= sE UU15Hхt H)EEE4 8U9r6%O;4u!A9rh,P0ujhN=dt+hNSi`ujhN0D<FPSo.tD&0hN= uF %f=@u1=duF %f=} tLPu]EP)PS(Љƒt9u;}vE8Gt;Uu=pt9sEPWSue[^_ÉUWVSu] xEURSV+ctl= ucMA %f=@uQ=dt5`. Vtp0SEPS111ۃURju18u =05nvE=hu =lt =hu:@ D)P1}uP5@rTtE}t=hu 1ElT@)D9vM8KtK9vE8Cu5D)9s>SRQǃ=t SVt=t =pX1ɉ; }C;@v;;tEA@EvJ;UvE8Bu; };@v;u;t )ӡ@ D))=xt REPSu18u =05{v@=t@D)‰9}tHDMD5D@)Pǃ=t5DE))llЅEtt5h#O]e[^_ÐU WVS}u1;OvjWƃ8tޅuN= uEE PW!t0W^XE PWSF=uك= u7 t u-ĉE PW!uU B %f=@tSW덍v=E PWV0Ã} v=t9=tt:P5h ON\ShLO=\؍)9u P5h O\=dt5`.t*V t_8tR0W؍e[^_UWVS] EtJB;CutqӃUDPEPlEURP UE/ VEEPރEPUR!E >ut=uHt}tEP:UR+Eh[^_ÐUS]t25hOhn#5hOhn"}5h PY5h`PzY hQjYhQ]Y h`SMYhT@Y h Y0Yh[#Y S{vUS]=pt%S5ptjh \p]ÐU WVS}1(=(tKv4W袭u($((Fv(<u1e[^_ÍvU WVS]u 1vvR@|vl4%@tCύv;ugv}tE4G/vR{vl4%@uCF<\u ;t FC;uF_ve[^_U WVS}}P3EjREPU: ËU PƋE U2VEPUR4ue[^_ÉU,WVSE t+j/P"tj/5"@8zudEEEx EEh?\j9E PEPh@\5P $^MTBЉUUv=lh5lijh`\Z=lKh5l-jh`\=lt/EP5ljh`\vEh\?h\3h\'E5l|qlWv5l\u .5l\u 5l\u jh\=lӃU\sVMQE5lEP訊E u zlƿ\thNP*Zvnu#05l*}t E@9vSUR]E}EC9EuSMQ:EF u!VE@)‰PjEEPsnt V;}ME|  E{viYl5lxlvp|tdx5lMu he5lMu hA5l\u hjh\ j~jh%h Mu u>ƒ =}E=}E=pu p=t^h\5ph\Ph\P h]Ph`]P h\Pj=t j}t}u 5pGvM?v%;U}%E U%װHE jJ5pJuh]6u&URMQ$С%U)‰Ѓ~ =t}t t%;E}WE%U h޿\1t 1҅tR!E%%;E|hjEhXn6u 0hO^=uEPaU WVShHÃhh@ jjS"C, ߉ދC S)‰Ѓ }j S.F y9y uI(AA Q!ЉA Q)ЉEq)Љ9U~q A A{0tgC0@C0@C0@ C0@C0@C0@C4C8ǃ<ED S1e[^_ÐUWVSEEP0UMM Mm]]}Љ}EDtMMDE M]]ExEEEtSU:W tCMЍUE<]:_ sE?EEt]:_ uą!uC S)‰Ѓ}jQj{ q9q uI(AA Q!ЉA Q)ЋY)׉9~Y A AtyGuC S)‰Ѓ }j Q C q9q uI(AA Q!ЉA Q)ЉEY)Љ9U~Y A Awu `GG@GUPG@ G@GJAHG@]_ G MEU<u M8]Ux}E‹Mx u:u]ЉЃ<0uH M@ MsUMЋ x t̃}WE]<u UH u"EM<*]@ UM@ tCV)‰9C~C[uv \G0p t(VF;B~BFF;F~FFv u1ɍA~PG0p'Dt)1ɍ<vA~)v1ɍ<2A~ꋗDt$1ɍw<1A~v1ɍ_<A~1[^_UWVSEx4u E ;}u"UR<PM Q8vp<<UJM@EM 9EE EEG)E;MvA0A0хt`A0A0A0хt>A0A0A0хtA0A0;MvIA;Eu79ȃUC9)؋U)ڊ:t9tM4U UUA0E)9fEEA0uEA;Eu99(ȃU:uC9)؋U)ڊ:t9~)UE)9~1e[^_ÉU,WVSUEE;P4>M<ME;uw9t>vMƊU<t;urFNU<ue^M>v}tK E܊ K B:H sv@t:H utP:t]Uz;] w}uE)971UUE+EM;A8~ EA8EEE)FU<uu^Mtc;}tK E܊ K B:H sv@t$:H utP:t ;]w]Uz;] w}KuE)9m}tU U EBUBMAE[^_UVSuU E]~,u2Du)PRV…ttSF4C SPRVSe[^US]1PRSs]ÐUVSuM U]uu^EF JVf(F(t Qv$ 6FЃFÅu (ЍCFF FCf(f(e[^ÉU WVSuM U}]uu~EF JV^$N(F(t QS 6FЃFÅu (ЍCFF FCf(f(e[^_ÐUWVSuFEFV )‰U] \d;}F(t Sv$SFЃDžu (Љ~EG;FF@~1MIx FDIyE$URv$F Gv1;M}WFA;M|E9FuF(uUBGF(uRF ЍGFEF f(e[^_UEU v@t9s9r%ÐU WVS]} S&rC(t Rs$RC ЃK(t9s9:r΅t{ {CSt tve[^_U WVS]} S&rC(t Rs$RC ЃK(t9s9:r΅t{ {CStsve[^_UE1ɋPt)RuÍvUhnh`Ahnj %B 5(lzUWVS] uuVE( uSoEuEPՈUUEx.ux ‹B%=.ttU+U})19 u89v49v9tSURpƒt[+EEUEPEPk @EURENEURuEEPURn1e[^_ÐUju=UVS=te1۾vS{^ l4%t&vSRl4؈3C~1=tP `ujhC`e[^ÐUWS=424tK;t?d{HPs5`tjP#v[u4tFv;u7{HPs5`kt jP[u5`ct jPe[_ÐU WVSh xP5h { h@E PURit jPE=|u =tE 2PkET`M=ttU`=|t}Y`f}ЍXE؃U RMQPp] =|t}߸p`f=tt `U}߰Ѝ\jhSURjhM QuVe[^_U WVS5p,`u(hOxP5h&vh'xP5hy h@E PURgt jP=|u =tE 2P jET`M=tt`f`A=|t}`f}ЍXE؃U RMQPn] =|t}߸`f=tt`Uf`D}߰Ѝ\jhSURjhM QuVLe[^_U,WVSxEUU Uu9v=`EPE)PV5`Yƃ|E)PEPV)EuEE;uvU8VtvN;uvE8FuUE;d*EPjjRVh[ u EUsEEPjjURVh!ƋE E)PEPV/)EuUU;uvE8FtN;uvU8Vu}|%\hE)PjPVh@Fà 8Ȯ8)߃=tu=|-vE)9=|t5TvRW l4%uQ|_tJE)90vRW l4%u <0_~- \@hSD;PVh@EHǃ FU)9t7C%\h)PSRVh@EáȮ8)߃ uFE9ET1EUU9s E@Ue[^_ÉU WVS}'E 48v9s: tM 9vC9s; u)PR5`t jP9sC9r5`t jPe[^_UWVSxEuU 29*ЉEvEPE)PV5`ƃ}=tt-;uv U8V7;EU8=|;]v3SvRU l4%uh{_tb;EshvRLUvl4%u<_u4EPOWV5`Ë}tfF;u1:]] 7)PEPRX%BuڋEN;uv~ ue[^_ÐUMU vABuAÐUWVSu} >u uEEUvRRT l4%t.UvRHÃl4]UvRS l4%t.UvR=H l49t E9u}tFEG&>uE)?t +E1e[^_ÉU WVS}u1<811] ;t$3Wt|ԅuԉ];uމe[^_U}%UVSu]u 1ɋU AJ9r9tȃ[^ÉUWVSEEEuaUPU@E }}t@CE9s2E8uEPSVTu)]1u}}tQ t EH<0 uE}t8}t,EH0E8uEPSVuM}u}u[EE@PURbÃuEPa1av]EuVPfUUEUt*1}tEEPURg=ƃE}}EPURJ]ހ>E8tCF;t~U8u;tr{tl1ҊE8CuUE8CuEŠE8CuEŠE8CtE8CtE8CtUtCCFCF;o}HE} tUE Ee[^_ÐU WVS=\(\(hhju_j.hHƃtGVװPRh%'QD7 RD1PVH=uE D0E|:u{Xhja3P@~`=)E)9wJӀ<3W<3.u8Chja3P~؀<0u )ʋE)9%FE)Pj.VKƃt15hFPuǡ|0e[^_ÐUWVShutSCƅsjSމH j TS;DžXDžTPPSjV車 u PxuuaVj"jjtװHPRPppEK tPhahnuajj haǃtPWukju]SBju EPB jVEP~BEPA j,SWGg,tEURPW辂Wg8[^_Ð$FreeBSD: src/lib/msun/i387/s_ilogb.S,v 1.7.2.1 2000/07/10 09:16:28 obrien Exp $v u `(%`(UE]EÐUEU щA uNu~AvH҅5v ~&HɅv~ U=(u?EEUB jjEPh(jR u ((ÐUU:t2v:%uB tpuJ:$uz%1Fr<$aN.a"a Q)Ѝ(a Mb)‰)Ѝ) F;u=(t EMEMEuUEEUfEE\F9~FIu`u`> gfff)Љ)‰})t<3WEPe}=ЋUTUE)~ ]EvMEF>tFEE;#P5!^}t65(EPa[=(ЋUTU𡤰Me[^_ÉU WVS]} uStVWS WVSe[^_ÐU WVSEPju }#/Hy8t0Pq8tcB%u/PB84/@t //@xLt@L(/@4t 4(/BxtAxt;j*Bp5@t@P,1҅t /@ fPD/BtFt=j*B?t@Pӫ1҅t /@ fPF/@(t (u4 /Qt"t(Aǀ/@,t ,uh/@tWtNt ut@PFv1҅t /@ fPH/BtFt=j*B=t@P1҅t /@ fPJ}t=thhEP:Ee[^_ÉU WVS}=/t\5/1F9}J+~F")‰Љ)‹F vxcjPWu F CV9|1e[^_ÐU WVS}=/tl/1C9}Z&~C$)‰Љ)C"‹CdjPWmuC f1Efx~+HE]0҉Ƌ]09tEE9M|E}1h@ut/@xu jDuVEP1xtV1Utxj /@xt1@%ƒ R1@HPjMQ]SuV305 v1@9EL M]u;u$RvE9U( M]u;t 1A9E /B4TEEËBxu?lt6Eu+10t14u 8t1% 11fx~!]U9u@vA9} Uu9t11fx~&Eu9u1@vC9} uU94t19tB9;h@ut/@xu jBjEP1xtxT1UtǀxU09ht R;B/@ps1h@ut/@xu jAVMQ1xtS1UtxU09ht RA/@4K9]}vEMuE9]|졜1@9E1BMDE/@xu@lt7Eu+10t14u 8t1E% 1pN;u~#]U;uN;u~M];t;u1h@ut/@xu j}@EPUR1xthR1Mt]xVSQEPUR3)؍u u PRQN*A1xO;}~UE9uO;}~ ]M9t1pN;u~UE9uN;u~ ]M9t;u1+E9{h@ut/@xu jb?uVEP1xtMQ1MtxE]9 BH9tuBH9uQvˡ/@xt ~u0ۃ`109ht R>ɡ1tQ.1PJy B;B| t RQV#1x/@DtD1B9x|jUR9\M];u1Gt 31h@ut/@xu j=EPUR1xtO1Mt]x);VSQEPURV tf^1h@ut/@xu j=SMQ1xtO1utxjEP_9}SURMQ]SuVvu}UM;ut tNO9~;]|1h@ut/@xu jM<EPUR1xt8N1MtUxSRQMQEP 9\UUM9}MCEܡ1h@ut/@xu j;URMQ1xtM1EtM܉xM)١/@t9~/@x|t6t-1 Uȉ)U97Y/@t1)9 /v?B$MQCP]SuVEP )PUDP9KMء1h@ut/@xu j\:EPUR1xtGL1MtE؉xMC)/@t 9=/@xTt1)9v?BMQCP]SuVEP tg]C1h@ut/@xu jg9SUR1xtUK1Mtxj]S-1U09ht R9)P1@;E~ +EuU ]PRQ#e[^_UWVS/@xu xuxt1lt40u+h@ jjhPZ/@xu/@xtQ1U09ht R"8/@p~1ǀxǀt/Bx1ǀxǀth@u tBxu j7jj1xtI1ǀtǀxU09ht RM7/@p}/@x1ǀxǀtU09ht R611fxUh@ut/@xu j6jW1xtH1tǀx/@p$}G1B9z1U09ht R1611fxh@ut/@xu j5jW1xtG1tǀx1fx1BH9tu!BH9xuEPv]/@xt }~u0ۃ`109ht RB5ɡ1tQ01PJy B;B| t RQ1x/@DtD}{1P9x|pF1@9G1B9k1h@ut/@xu jU4jj1xtDF1ǀtǀx11fx~O1]EvЉE1fx~&MA(]F]C9|GUB9|e[^_U WVS}u /Bh@ VVBXPGz/@xt ~u0ۃ`109ht R03ɡ1tQ.1PJy B;B| t RQ1x/@DtDmyN@Av/@x|&p|.yv/@xt ~u0ۃ`109ht R02ɡ1tQ.1PJy B;B| t RQ1x/@DtDmx/@tKxN/@(x v/@x/@xt ~u0ۃ`109ht R1ɡ1tQ1v1PJy B;B| t RQ1x/@DtDIw/@t'wNe[^_ÉUVSu/Bt'h@ VVBTPv$19}/@pTvC9|e[^ÉUuvuU WVS] uM}x/B99M1h@u tBxu j`/jEP1xtMA1UtǀxU09ht R/h@ j/@>}/BxX9M1h@u tBxu j.jS1xt@1tǀxU09ht RW.h@ j/@pX/B99M1h@u tBxu j-jEP1xt?1UtǀxU09ht R-h@ EPjP/@/B9M1h@u tBxu j(-jS1xt?1tǀxU09ht R,h@ URjR/@RQPs/B99M1h@u tBxu jT,jEP1xtA>1UtǀxU09ht R,1;}h@ j/@rG;}|/BxX9M1h@u tBxu j+jS1xts=1tǀxU09ht R9+1;}}7vh@ j/@pXqG;}|v1l0/@x1;}])1h@ut/@xu j*jS1xty<1tǀx1fx1BH9tu!BH9xuEPv]/@xt ~u0ۃ`109ht R)ɡ1tQ1v1PJy B;B| t RQv1x/@DtDp1P9x| F1@9G;}l1e[^_ÉU WVS]uM}/B9u 91h@u tBxu j(jE P1xt:1U tǀxU09ht R`(h@ j/@O}/B91h@u tBxu j'jE P1xt91U tǀxU09ht R'h@ j/@v/B9u 91h@u tBxu j,'jE P1xt91U tǀxU09ht R&h@ EPjP/@/B91h@u tBxu jm&jU R1xtZ81U tǀxU09ht R&h@ EPjP/@JPl/B9u 91h@u tBxu j%jU R1xt71U tǀxU09ht RD%1;}h@ j/@kG;}|/B91h@u tBxu j$jE P1xt61U tǀxU09ht Rq$1;}}7vh@ j/@kG;}| 1l0/@x1;}] 1h@ut/@xu j#jS1xt51tǀx1fx1BH9tu!BH9xuEPv]/@xt ~u0ۃ`109ht R#ɡ1tQ1v1PJy B;B| t RQ1x/@DtDQi1P9x|DF1@9G;}l1e[^_ÉU WVSu] }/@uxXt/@uu *v1h@ut/@xu j!jS1xt31tǀxU09ht R!u$/BxXth@ jBpX6v/Bt.h@ VjVBEPh-v19}$h@ j/@pXgC9|ޡ1h@ut/@xu j jW1xt21tǀxU09ht R~ u./Bth@ jB$gk/Bt*h@ VjVBDPf/19}'h@ j/@fC9|1e[^_ÐU WVSu 1 /@xt ȋ@% ‰U}RVjEPU RMQǃ /@x I}u u/@tR1E9tt H9tu8/Bt&th@ jBeh@ jURM Q/@p aCPet%h@ j/@pev1ǀxǀtEPURM QRQEPǃ h@ jVj/@p BPe1ǀxǀtu51FtURE+E@PM QEPǃ/@xux 9uy9u/Bxtx]+]1h@u tBxu jqjS1xta/1tǀxj v1;]u)ޡ1h@ut/@xu jjV1xt.1tǀxjj 1C;]|\vURVjMQE PEP_ǃ /@x 2} tT1M 9tt H9tu8/Bt&th@ jBbh@ jEPU R/@p x@Pbt$h@ j/@b1ǀxǀtMQEPU RPREPWǃ h@ jVj/@p ?Pb1ǀxǀtu91Ft"MQE PUMDPPǃ/@xux } 1yE 41h@ut/@xu jjV1xt,1tǀxjj CE9{t>UREPE PMQ512d EPU RMQ31ve[^_ÍvU1ǀh1@1lu"/@t]`/@t `/@t`/@t_/@t_/@t_/P\t3`t*@xt \/@`Pp_ÉUÍvU1ht j1ltt0ukƀ0h@ jjj:1ƀ0j1BHPxt2*1PJtǀx jj ÐU\WVS=1t+1duj?9uUuV jV  jV ]SVjC jS ǃu'Vc jV jVj ]S4 jS ujSjEPjČE]ȍEPE uVSjmj;P1 jVjMe/TjEPjVe[^_ÉU VSu=F]EPSEEjSVы 1ty=1t=1xt2@@P,t1ƀ1ǀ@ S =1t1ǀd|ujU塘1tƀx|uÐU$S]EPjSu(}t u}uju Sي1]ÐUSE=uhȰh=tjhȰjzh Sj+   Sj Sj  Sju ]ÐU WVSE11pi1B 1B$1B(1$+,+)D؍e[^_ÐUS]t!3s S]US]1=1t=91u|1(v||t9|u狃||s Js$J s(Js,H s0: t (t(ttsg{t0{t*stր8 usrSf;1u<111++1]ÐU1ÐU1ÐUÉUÍvUÍvUS]EjEPSLƒ}u]v|/@ HЙE E8t8;tEE8t8;uE8;uEE]ÐU WVSu]E fEhj請111|1jVP1/PfXfXUfPǀtǀxǀ|ǀǀǀfǀ\ǀdpǀphqb1 %Ƃ01ƀ11ǀ4ǀ8h(qt?h(qƒ14PR*ƒ 18PR1ǀHǀLp ǀPx ǀT ǀX ǀ\ ǀ`ǀhǀlǀp/@ fx~B¡1o@с</B f@BǀH=1D)󥡜1ƀG1ƀF1ǀtǀǀjjEPPuG1jjEPPSG1_1 1J$1B ǂd A1@1(=(x}ۡ(8};j1@)PuVSF(HVQ@=jjEPSF(JEPQBС1fX1f)X(( G(8t 6(jjEP1@/P F‰1t1P(JK1e[^_ÍvUUu13=(<s (U P@( 1ÐUUu1vu }PU=1u ,1ǀdP\JU WVS*+*+*+*+*+*+*+*+*-*|*+*~*_*+*:*'*#*o)<)>)v)^*#*#)#*-*-*<*>***!*f/@ltlQ/@Htw1ۋHЍx9sZ /)vAH}u8+9uE+t t vtE PEPWR)}c+@t3/Bt!E PjBM%+=+/BtE PjB=1t1Et:t2/Bt E PjB0M=1t1Dt4t,/BtE PjBL+}u }+9*}tE+/@ uU RjEPEPEPEPEPEPEPEPEP/@ )0PK+}u }+9u*}tt E+t t~tE PEPWR '_v@t2/Bt E PjB;K=1t1Et:t2/Bt E PjBJ=1t1Dt:t2/Bt E PjBJt:/Bt(E PjBcJE0 +}tKu}tA+9u#}ttE+tttE PEPWR%@t&/BxdtE PjBpdIt&/BxhtE PjBphI t&/BxltE PjBplzIt&/BxxtE PjBpxLIt,/BtE PjBIt,/BtE PjBHt,/BtE PjBHt,/BtE PjB|Ht,/BtE PjBHHt,/BtE PjBHt,/B tE PjB Gt,/BtE PjBGt,/BtE PjBxG t,/BtE PjBDG@t)/BtE PjBG}tM =1t1Uh E+1e[^_ÉUh@ uNU1ҡ/@xdt@/@xht/@xlt /@xxt/@t/@t/@t/@t/@t1ltÐU VSEu u @BZEÀ;);${<j>Sr;>8qE@qˉ=wu`%1tЉEE\;*u uEI;.uCC;>t==wu`%1tЉEE]EC;>`]1u 8q 1ۀE]C;E}fUf fUm]Eme[^ÍvUSu uk@Bt1Ișȋ]ÉU/Bx t$1@HPjBp !PCÐU/@xptppC1ǂxǂtptpǂpP=ÍvUS 1/~_Й 1 ǀj/@p4¡1j/@p0¡1 j/@pH¡1j/@p8¡1 j/@pD¡1j/@p,¡1 j/@pL_¡1j/@p|=¡1  j/@¡1ǀ/Bt#jB¡1 1/PB(uB<jjj14P¡1jj/@PP¡1 jj/@P¡1jj/@P¡1 jj/@bP¡1jj/@p 2P¡1 jj/@PK¡1j/@p¡1 j/@p¡1j/@4_¡1 j/@pT:¡1j/@¡1 jj/@P¡1jj/@P¡1 jj/@Pv¡1jjj /@rPA¡1 jjjBP¡1jj/@p P¡1 jj/@Pá1;~ڡ19~Љ/Bt@xpt:BppRt/Pǂ@ǀ]ÉUj1@HPjj1pt j7/@t=j Z<U\WVS] EDžDžUREP9]Dž@B/Bt:MQBXP}W t19]ME)؉/Bt`19}MSBPEP}WP0 t1/@x,1;EPMQ1/@1@,ǰHË;BkKdQW[u7+]/BtZ19}GSBPEP]SP t1/@xL1;EPEPq1/@1@LǰHË;Bs*K~(QWu־@B@BUEBEBEM9MDž@B/Bx tG]SBp APEP}WxP t1E9EU)‰/Bt`19}MSBPEP}WP t1/@xD1hPPcc~g;}YuPuG1@$P(MI]%=wu`%1tƅ1;}c 1A$P(][U0;hvF;}.1C$H(URU0;htƅtp1;};MI41@$@(Uڋ0C;|Ӌ)11/@@DǰH;s+N~(RQ۽uֻ@B;PEP]S聽P蘽mb}+}/BtZ19}GWBPEP]S P$ t1/@x8hPS胼1/@1X8ډװH;s0v~"SPluӾ@B;}-PEPURP-t@Bu@B [^_ÐU,WVS}u;}u 9u u11P9|әM֋ 1A9E ] CؙA9C)‰)/Bth@ jB4+ `nxXnXnhXnj K} ~l/Bxth@ jBp3< `ny `n;pn|XnXnvhXnj E +1@H9~ǡ1@H9E~EDžDž@BV]S1PhPEPٹP脺 tP1} ~'@9})yډ+E yЃ~} tNjV]SE PWhEPnPaƒ @Bt;}Džtg/@xtYjVURjWhEPPƒ @Bt%1;}Dž/@x0tZjV]SjjhEP觸Pƒ @Bt%1;}Dž/@xHtcjVEPj1@HPhEP6P)ƒ @Bt%1;}Dž} ~ 11ۋ/B8tzxut~pBx8tgjVUR1@HPGPhEP蛷Pƒ @Bt'1;}DžthPEPH $HqvjV]SE PWEP /@p]SyjVURjWv/@p0]SMjVEPjj/@pH]S!jVURj1@HP} ~/@pEP蓶/@p8]SyjVEP1@HPGPS0@Bth@ jP /1[^_U=1t14vÐU=1t18v1UEqUS]M /Bt%QjSB) P\.4QjSP/@ P&.]ÐUS]M /Bt%QjSB P-4QjSP/@w P-]ÐU/@t +/@u1v/@6-ÍvUWVS<t)h@ 5Ph@ FPt /@ fx1 /A @,+jA @PN`¡1(t|ơ1( f/@ fx|F1/@ @$+ǂl@Ps¡1 u /@E\qxtEq1;+=1/E+Uv# [uTfT [ ؅}C$)‰Ѝ@UUDfDuFxt [fDBdN [f<tf [f|tfD [f|tfDC;]*1e[^_U%tukF D]]EEE|DžxDžt1E%A>vXwD$tAuGA}tE Ex1TGEK}u:@=wu`%1tTPЁ'~EGA?ta}t%1DžtDžx|%AA}ttxt;x}xU]l $\v% @;v P  , 1҃=~ dt`=DӋU D;v PmSW +=~& du`t`װЍX ;v PShrv +=~& du`t` Dpl]װЍP9~ڡ D;v PplRpQ P =װЍD FσtE܃<t$=TƀdzESF<w;1҃=~ dt`<1҃=~ dt``F<wܰ<ܯF=ƀd`FF1 \BF< v= ƀd`1҃=~ dt`1Ƀ=~ dt`1҃=~ dt`1Ƀ=~ dt`)щmv1҃=~ dt`1Ƀ=~ dt`1҃=~ dt`1Ƀ=~ dt`ȅtә11҃=~ dt`1Ƀ=~ dt`ȅt љF1?11҃=~ dt`ta.11҃=~ dt`u,1҃=~ dt`t=ƀd`d1҃=~ dt`1Ƀ=~ dt`!+1҃=~ dt`1Ƀ=~ dt` 1҃=~ dt`1Ƀ=~ dt`1{1҃=~ dt`1Ƀ=~ dt`9v1҃=~ dt`1Ƀ=~ dt`9v1҃=~ dt`1Ƀ=~ dt`9`1҃=~ dt`,1҃=~ dt`҃=ƀd`}uE}E1҃=~ dt`ulF1 v>tnF>th>%uF>?u@v>;u~?H؀>euӅu1F1 v>t2F>t,>%uF>?u@v>;u߅~H؀>t F> =ujjpGu1v H[^_ÐUS]{t SK{t S=]UWVS} ]}E@8Et{U9Z0u 9z4|f|b}tMATS}tMA@980}t UBT8W}tMA@9 ~kEPUZ0z41]/MI(Mv]E@(EUMً]GF}tMA@9||1e[^_ÐUUE uB1ÐUWVSEx8ǃ8G8EEGuoW(UMI4\2|FG4@MQ( ET0G0fytA9~fYfytA9}fQEG9E~88q[^_UWVS}Ex8P8URE]CEUB4]{(@ f||[E@]C(4DS0)L)х}1ۋUB9~f~tF9~f^f~tF9}fNE]C9Eqe[^_ÐUS] CC0PC4Ps8[8t{8u֋]ÐU WVS}t'UB PBPB@PB@Pƃu 1 vMAfFfAfFAfFAfFA fF AHfFHA $fF AFAFAFAFAFA F A$F$AFAFF0F4F8A,fF,A.fF.Q M1FuPV(MA(MQ44ӲV(MA(DfDV(A(DfDGF9~e[^_ÐUVSu1t1҅9qu1tvQF u01Fu(V([<t4ҭCF9~ڃv(軭V貭;51u 1;51u 1;51u1ʋ @e[^ÐU WVSu]|w|s}|m} |g}u1@E)u} u1@E )] U ڋ 1A9*UA9jSVE PEPƃ u1Vw1;]}hjE PAF([ F(<tĉ[ E 9s   F(9rC;]|e[^_ÍvUWVSM]}}} |{|wUU }G@9eG@9Y} uE@E EH)E u UJC)}G tVUB PBEPQM Qƅu1Wv}~4^0UBFBF1;} }-]v ][(URU^(EG;} |܋MN8e[^_UUB M)PBM)Puu RÉUE19uȉÐUWVS}uEeWt\M QtIjj>Et3jLj>Ãtj W>C(uSd1gfCfHfCM IfKEfCMfK 1BfCHfs CC }uB9u B9E KCCCCCC C$CCC0C4C8fC,HfC.fCfC@fCDfCBfCF19}"u NC(IfDC(ftA9|}uGUU 1A9u3K }uA9u }uK E1R9uK 1tMYt؍e[^_ÐU=/tu/@(PHt1U=/tuj/@(P.t v1U/,P}t "/@0t@ǀ1ÉU/XP5u /`\1ÐU=/t]/XP0=1t9=1t1x t jZ1x u jp1vÐU=/tI=1t-ja1x tjpN/,PÐUh 5ÍvUh QÐUVSu] hw赨uqV]1ӉP tV// ~ 1xu-S蕥ƒt1PS%PRVe[^ÐU WVS}E t551tu/@x t_F1v[^_ÉUVSuU t1t FG[^ÍvUS]C=w# 1C1v[UUE t<u B$ B$1ÐUUE uB1ÐUUtE B$ÉUUE uB PÍvUSM ˋ1Ét%/@t#u/@tu1]ÉUVS]1pw_9u t' t9evu]/@xPt/pP?/@x@tp@(/@x4u 5v/@p41pte[^ÍvUU1P1ÉU WVSu] u1<C 9u,13VusVte[^_ÐU1p,uÐUSEÄt /@dt du+/@`t`t1x4u1@41]ÐU1҃=/tE/@uux|t%t/@xTu tÐU1҃=/t6/@u t/@xXu tUVS1۸+=+tK+v<2w'P/2@41,PC+<ue[^ÐU WVS]EfEu >=/f;tj;[{t8Cu ;빐j j5CtÉ`j j|5É߃uG/_j jX5Ãu%/t9;S٠u#CFuEfC e[^_ÐUS]/@xtwS c/Pغh )/~v/P/ЃK=/@ u 1]ÉU=1t 1@XnPiÍvUM=1tV1t4MjEP=1t 1@Xn@P虩Ev=1t 1@XnJy B;B| t  vRQ61ÉUh@ juÉU WVS]}tu =/uEwE/@;Xt;uEE/BxuJB fx t@=1t1u)/P¡/@ @ 9|E1=wu`%1=wu`%1ttPCѐ4;.uOC=wu`%1t t0C=wu`%1uۀ;*uu C=/;;$tP]C;Suj$׃j<׃ g1ɉ=wu`%1tLPCѐ ;.uOC=wu`%1t LC=wu`%1u۰;*uM C;*t;/t~1}u }ut!gfff)P;t Cyv~*}u}tgfff)P^/@ 1e[^_ÐU,WVSu} EfEUfUNEE)9|9E)EvF([URMQ4U4輟K;]}])9}9)E1Fu$[EvF(MM BF9~C;]|΅]E)99E)EvF([URMQ4U4(C;]~])9~6)E1Fu![ F(}HfCEP1e[^_ÐU塜1f^u 1f\uefǀ\f^u fǀ^1f^1^f;\u fǂ^1^f`Jv1f\u fǀ\1f\1\f;^u fǂ^1\8U1UMU t A9}A(Rf|%ÉUSEt*1@u"X(HRf|t  B9~1[ÉU WVSuM ]}t| |F9~kʍ9}`F9XىMN(Ru fD fD^(R t FfD fD B;U}F9~1[^_US];1uCy^+vS'u{t 1@P^C]ÍvU,WVS}t E@ t UR fUMY1QPQPQ$E` PfUfEfXHf]Mf;H1f;XEE@R(<E@MQ(Efxty@EE9E~EURfUu‰;ELUދ;t,fu fwfwf;w}fw f;w~fwfEFM;M~MfAfAfEfEUEf;PUMf;J,Ext @1@Uzu"1RMffQHfQ fQfP1MAB1e[^_ÐUMMb)‰U)Ѝ))ȉ)эEPjP5v1ÐUSE//t6f//@t /؋]ÉUS]t*SQS蠐;/u /1]ÐUS];Lu P>|.19wu wAw9wu닂wP[ÐUSE|/19wu wAw9wu닚w[U/XP=f/P=ƒ=/t /ÐU WVS]3{C @tf;s}c C @u f;sf;{~ bvS_Eƍ@S(fztf9z~fzCfBNj C9w U9vS1e[^_ÐUE@ÐUEM P u@t0 %v@0t0 Љt0  ЉÉUWVSuE @u#ۃSuEx^M V uFt0 "F0t0 Љt0  Љ@V(fzu fZfZB9}fZB9~fZ CF9~BN @ff;F.~$F.fFfF~jVfFDvf^8vFEE t*  E=//)E~u F.9Et F9EE 0EM F;E}ӉV uFt0 #F0t0 Љt0  Љ@V(fzu fZfZvB9}fZB9~fZr/@(PptYEPhht@/@(P}} 8u 8tʃ;E>E;~>(/@ fx~f8~@/@ ;~> P /Q fBQ f/@ fx| @/ /e[^ÍvUEPEPn=1t1dtuudÐUVSu] j/Vgt1tSPV$tSV3uE1f{tvC<}BC9|1f{ tC]vRBc l4%uhz^t Sփu Sz1PEPSr=1t,11t‹ƒu1p1[^_ÉU\WVSEDž1111t|9vj31tQFu'02Ph{hnFG ~ 31Ph){hn! u~. nxnnhnj p,~1Džx1 1Dž;B(01 1‹IL,D4ƅRz[1 tPR4;t-hzQ30tƅu}1 EPPPUudh`oÃuhz[ߍu C(Rƅu>t1Rh-{ZI;H(StQ 1v1Rz(Dž;J(}00Ix(;A(|ӃPRqfy(t3˃0B(H@4QeTH(uӃRQATxtp[nz tr Anytq'n  11ҋfxt#A<uBA9|1ҋfxt(vA f }t}tN}txvEF"EVUN"M^$F$ȉEFEV"UF$E^&]N"MEF&EF Eq^"F$F&19sCF4U R&yu#F"V$9wF"9ȉMG9rEv1}E9sfE PF4xuE|?}+UU}t}t )}t!E,E'EvG9r}4}t_ }t}fF"fFFPvl\F^K;]VDK;]w~fF$fFFPv *\F ^K;]vRV DZfZK;]wƃuMA(01ƿtƿu=5817]C(@ڃ, S(Rك4t1C(?=1tP501"Ã=1l=l50178uuIshw"Ã}ww7h@> ?uv=tb5017tuAhw"Ãt.}u ww7hj> ?u501Ãuq=1tAEP501UR6Ãt&=l1v501h=u#}501h=}M9Ku==01u&=1%P!PjhA}uF=01u/=1%Ph!Pjh!à t}u{u E_v}Ct"t "t  (/7501Ph@<h} }t~}}Ct, t*t3S]C SMA fPvS]CSMAK]S 41fJ581=1u!CEPV5019%ƃV3S]C \w7h;Fw7h;2}uhgm;,=1u:PEt AEP=U29P:0} =1umEj+M18tE71ۋE;X(},j+[E,48uECU;Z(|փEPMQ}v]SH EP21e[^_ÍvUMU u tu 9$uGyuAǍv:$uGzuBǍv9u :u1:u ABKv)‰UUtE EUEEPu6ÐUWUt#װuPu u}ÉU<WVSE UBu((t(0‹MA]Cu%,t,0‹CUBxu[B fxD~6@DPhhSYSb0‹MAP hC0‹]CPUBx8B fxH~7@HPhhS YS/‹MAP8 Lv]Cx%uh/‹CP8#EP4t4t 4B8MQz,0t0t 0B,i]Cx)t[C fxF~6@FPhhS[XS2/‹MAP, h/‹]CP,EP@x&0t0t 0B,nUBx)tbB fxF~:@FPhhSWS.‹MA !vhk.‹]CUBxBx)uVB fxF~<@FPhhS9WS.‹MA +hvUBx xt~tutlh VS2MApS2 UBS2V_-‹MA}]Cxtyxtsx,tmx,tgh VS1UBpSE2 t3MAp,S,2tV,‹]CUBx+tx'u MA@]CubC fxJ~:@JPhhSUSf,‹MA !vhC,‹]CEP fzu@x*ufBUBxuhË+‹MAP]Cx*C fxt!fxt@Ph3UBtPht'MA2Ph ]3 9]CuhH+‹MA]C f@UB8_8Rji80ƅt ymMA8v)Dž|8t)װH9u׃SVRuŋzuVSh`V2Ay3h1Ãhpƃ tuh2vSMA<u3hˌ1FMQ<tP4C4gV]C41P0phx1 fvS]C:t':$uzuvAB:uP+)V]C Fj,V.*t4EP4u% t 4UBǀ MAxAuh(‹]CUB<uhc(‹MA<]Cuh6(‹CUB@t @ MADt D]CHt HUBLt LMAPt P]CTt TUBXt XuhMA\t \uP]C`t `u8UBdt du MAhhthVS+UBHS , MALjjSZUBHjkSC MA@jlS)UBDjmS MAhjnSUB`jqS MAPjtSUBTjuS MAXjvSUB\jwS MAdjxSetbV%‹]CHh@-tŐEP4)au"j8 9zuB9u C<u냍ve[^_UVS]1Ɋ`t$<|t `Awt<|u`[^ÉUWVSMtnv9tf] AC;t:t19t0vU:t:tB:t :uu1A9uӅt ;u Au1[^_ÐUWS&=1uzh@Ãtd߰Ѓ =wJ߰Ѓ P=1uhu*Sh51J11e[_ÐUW}tw>?t 7>twk> tw W>twC>tw/>t w>1 }UE11ÐUlWVSE=t+h<(O t  ǐc ƃ t t t\uG t t tƃ=:u :u ƃ.u)=<1u Evƃ.t t tvV,vl4%ub.u =<1uTPh u%u:VF$Ph h@Z' P{v𢀵=i=$1 1(1t1,11<,u1,\u t t tƉCƃ t5uhu'v:u:,t1:=1uH1:UhhPh 7&v=1uvK; t; t;,tCj|h#ÃuЍ3h%j|hƃ t>uh%uЍ9s]vRp*vl4%@;/Ph #C9r01/vV* l4%u=1u _u;uCƃuC:t='#,t=3@t2y9t h`4%011nvO9tV Phh$ 01&v1ƉvV( l4%t D/GNv]jEPS贍ǃ9]uhhƏ#E8u 9thޏ]#01=41rvhSz9thޏ#0181) VPh" }uÉ؍e[^_ÉUWVSuEEE_^}%É߃uhJ#w)vWb' l4%uWPh" ?u'F=l1h.!}s\[É߃u!h"P GЃEEÉ߃uhU"CЃv3wu`%1tSh`8!U\Љ]E}~}uEECjwh$  ~ yvqv iv av Yv\Qv^Iv,Av:9vWlPh F v u =1tFu}E}X~}uh= EIÉ9t#tE H9t=1t ke[^_ÍvUEhÍvUS]9tu[ÍvUUE  1t t1x1ÉUWS=ЍXtEvR2$ l4%@u vs1e[_ÉUWS=u38 8 t1x1=t85" 15hhy tt1x1tw=#ttj8te v8 t8 t߰эQv| u| uQD t | t$;x1e[_ÉUU;uh- ÐU=t5=t)‰1U=t@ f1=t8%ÐUSM1ۀ9tAA9u캧|A)Ѝ)))É[ÐU WVS}u Wt0f{ }1%C @W3ERu҉؍e[^_U WVS} ]ލL9s.9{u3EPRu L9r1e[^_ÐU}tLÍvU}tÐU=<u@h/<=<u hD<<ÐU WVS]<)֋} );@v5@PR0<uhv<E PS2߰ЍDe[^_ÍvU= ~h $ U= u%=$uh_&$  $4ÍvUVSM<\t <^tiwvA<3Q<0}<%I<$}EuA\[v=wu`%1t5ЍAF̊vY vӁvR l4%tZ,tU'tP\tK:tFh588hP8'vh58 8cv8fÍf0hQm8 vyfӍЍffэЍf(80 hP8f˺ ȉf1fЋ80hR8}hP8e[^UVSu] =0tu u95$ubhh58-8 h58 8sv=$tv5$rDvh5880hP8s=,t h58v8=(th 58M8e[^ÐU WVS}]  $(,048Eu}Y=wu`%12]v=wu`%1u;*t ;.C͐;%C}8%hPCNO$8%hP0=0WhHv(=(aWh*$v,=,=Wh>vhRvj54hU58q8 j54hdj54hnfj54hw58 8 S Ãhz588 SÃh588 <;=t;+t;-t;*t ;/+{pt {c{;=tj54{pu6jC4P4;$t 4FCP<ƃ$$h"hh h588Ev=0t/=4u$$=4u$ v4$vj54Swà hEj54SKà hFj54|hvSÃj54Q h588=j54h^;3t#;2j54h4j54hj54h5818 v4 4h588ov8%hP8KWPP Ph%8ChR8;}h58R8]v=wu`%1u ;*t;.u(8hR8C뮉h5888hP<e[^_ÉUS1ۍEPEPh@1u"uTE=wu`%1t1E=wu`%1t E:Eu؋]ÉU`VSu] wavSlvl4%t6:t\u\hVƈhB؃9uS PEP& ShtEP/EPVrƉe[^ÍvUVS] uhzuFSP VPe[^UK;/K=wu`%v1uڀ;.tՀ;*tЀ;\u#~^t~,uFh>$uO~.t>*t >/t>>uFǍvN>%u"~%uh}EPl>%u}hIEPEPhVu!j;V ƃuuEPEPEPhVtTEPEPhVuj;V7 ƃuuEP7EPEPhV]u-j;V ƃuu}W>E؃ vVtƃhEPQEPhVtEPhVuPj+Vy t>ph}WE؃}tEEuEPvjhnVИuh jhV記u!E}hEPljh VpuE}wh4FN7$$%hEP%h}WE؃=wu`%1tFhEP뻃Ph>d1hvhEPjhZF>1u E>2u/}us}umhEPJEEMv>2~E1bvhR}WE؃%vhEPE؃E>tF>t ;u1}u<e[^_ÐUS]fC,fC'fC fC"fC$fC&{uj,C{ ujNC {uhxC1f{tvCBC9|1f{tvC fPBC9|1f{ tCBC 9|`]ÉU WVShjıÃtߋuEPS؍e[^_ÍvUWSU`װ׍;=wR`P=``e[_ÉU WVSu-`|1f~ tF~N <u #F 1Q(1IA~vI14[^_ÉU,WVS]} 1DU)؅}H)R 1RP蓊u)91E1U)؉EEP(v1UJA~IU􋂀N2~SccE>FS(EC(C(C,S:E4vE>e[^_UUB(;B$u1)J(A;B$ry tvH;B$r8 uR()‰HÍvUS]S<C,]ÐU WVS]} t C<C,;C0r ${<un{4t80$C( $0$jSjSC(C(C8SkD v{4tJ1;s<}$v0$C( $F;s<|ߋ0$s]ÉUÉUuU1ÐUS]Eǃ C,u/hs$C$S,)‰C<Sd<uESPS`2}u1]ÉUUǂ B,B<)ȉ|R%ǂÍvU WVSuEdž@dž F,}džSvu/hv$F$V,)‰ jjЃtX1ۅV>;cjjЃtX1G;~-vGjjЃtX1ۅt>V$F,)PRSRuF$V,)‰Ѐ<tSV=tE}tVG%e[^_ÍvU WVSuEdž@dž F,jjЃtX1ۅVM=nvV$F,)PRSQuF$V,)‰Ѐ<tSV<t}jjЃtXv1G;}u}uV<u EV %e[^_ÐUS]S=S(: uJ;S$r%: u K<{<~'vJ;S$r: uK<{<{<~ )vJ;S$r: uBI~ ;S,s: uS(]ÐUS]SS(;S,s#: u K<{<~%B;S,s: uK<{<{<~ vBI~ ;S,s: uS(]ÐUVS]C$C$C,C(jSC( C(C(:C(C( C(S- VS 0C$C$C,C(VS$t[^ÐUWShSÃ1E @C ECuOCnSMJ ShS SSk Sg9S: S&SECǃ1e[_ÍvUS]t|SySlJ SgS SS S9S S-&SE 3S]ÐUS]SmS]ÍvU\WVSu} M E$01V%11VT!1VE9tNf1AEt]vB AuG$0Ej0EPRVEo0EPRV\Ev0EPRV]jE|0EPRVS_RE0EPRV?m:vQA1PRVR A1PVZ e[^_ÍvUE$ÐU WVS}E uCYduQh0ƒt;h0Rh0hS%؃ h0PAƃuEbV퐋| uRW9 ÃtÃPV{ƒuVU1[^_U0VSu]SijS EPSj cEPEPVT tuuVUjEPjbe[^ÍvUUE ÍvUEu1US]C(;C,u2;C$ujh0SqMu hGvuE8uhGs]1uPWEPVqe[^_ÐUVS]M u< u5;\u X<u;Xu\<t VS e[^ÉUEU :uhHp[\tRP1UVS]u u>t1"jVS(Vh,Hs[e[^U WVS] }u:u@{ t&WEPt 15[ эvC{tC{t[믐e[^_ÐU WVSu} :t<~tF[{tC:u{uPCsG?~ tv lF Ftt,"t#u~tvvEF}t  }t *t!UFGE0蛫F3Ov~ uPNF UREPWv 1e[^_ÐU WVS}M 1:t,ڃ{tCRztoB:uzt`֋^A9u t*/v{ tFQC Pu1{ u+uCCFCSv1e[^_ÉUS]tk{ ts C sCtt+!t#u{tsvS]ÉUS]j@@@ @]ÐU WVS}u ]U>uRSW1xv:uZPRƒ{ tF[ B붐~u>D"DsCPW1{t [se[^_ÍvU WVSu} ]~>C"Dh`HvWhHvW~uuPSƒ u.D"DwGPV5vBPw V@t SwV*1e[^_UVSu] MEtmt t.XuSHuHRP1Pvt :t8;Bu2S57vVvhHS57vV[^ÉU WVS}] uu;^C;@vvV l4%t";^Cu ;?v$ @^u;\C;^\u;\C;\ tQvV覰 l4%t.vV}vl4%@u%;\C0;C$0;C$0;؍e[^_U WVSU}] ?t] C:u^C@Cvր>vRܯvl4%t^C>u ?$ @>^t>\u\Cv> tYvRs l4%t2vRF l4%@u$\C$0C$0C$0CF> ?t tGCE e[^_ÉU WVS]hXhܽ\ǃd7ǃh9ǃl8 hD訽Ɖthl肽Ɖx [ǃ|[S1e[^_ÐUS]X0ǃX\ǃ\ǃdǃhǃl t߽ǃtxǽǃx]UVSE\vS_ l4%t3C~ɍe[^ÉU WVS}\X1ۀ>/tC<3/u~01ۀ8/tC</u~puƈ]E3t8 t1"t($Ej3PW PEPWvC~E0e[^_ÉUWVS]\XElMhǃp`S1҃M 2:M B~SjSN SBe[^_ÐUWVSu\XEddžp`VJ1҃:E"B~VEVEEE jj(VPEPV:jVM V_Ae[^_ÍvUWVUE ƿHu R"%ƿHt Ro1e^_ÉUVSu];t{uXhHPSct9t?E v9At 9u#1PhHvO SVV[^U WVS}u M]Ȉf؈f<1"u;9hHPPPhHwOt:ti19BuW9tc2hHPPKPhHPP,PhHwN? :u[v2hHPPPhHwRN[^_ÍvUVSuhHv)N11ۃ\:tCPQRVكC~؍CPQ\VchIvM11ۃ X:tCPQRV2كC~؍CPQXVh,IvM hHV>hFIvfM hHV=e[^ÉU,WVS}Dž}u v\DžDžDžMQv:-B$JvXvDžDžzDžnWWKt;s3hZIw>L ;uBPU2hbIwLFM#E<uW|u3U4FPyÃuM1hIEFtXtSW;v{u<uSW"E<u3tSW;vSRWt$wvgM4PvuE0hIvt'RQWPSW]:%vPRWPSWE4WMuU42hIwJt'QPW8PSW9kv{t2RQWPSW`1SQW vKv1[^_ÍvU WVSu}|} t }tu Pxsx[Ptst|xt:tu߀>t F>uN9us~ tu;t C;uK9s{ t]E8u ?;uv 9vNK:tFuC]u]܉u]؋U:tjE;}s^vU:uNu;MsE9sFA;Ms ;us:tE+E܉)9}҉)9~]܉M؋UUuC;]r?tiEuU9sZE:uL;Ms;}s:uvAC;Ms ;]s:tE+E)9}҉+E9~ }܉]؉uMF;urE+E UUEEU)UԋE+E)EԋE+E؉EЋE+E)EЋUBPuE}~EEEUU܉U؃}~ EEUUU+UE)9} EEUUE@PuE}}UUUEE܉E؃}} UUEEU+UE)9~ UUEEE+EUUUEE܉E؋U)UԋE+E)EԋE+E؉EЋE+E)EЃuURME9Et9}}+E EԋU;BH+EPRE9EteURWEPURWEpHE+E PU REP0])+]SUԍ4:VEPwSVEEP])SWURQSWEP_}u+u VURCE9EtP]SURBSEpHVU RP0])SWEPSWUR ;E)PWEPE+E U+U)PURN E}E+E EPEPU9Ut2EPEPE+EPUREP26E+EPUREPE+E U+U)PUR 9}u+u])9}+EPEPU9Uth)]ԅ~3SWEPURWEpHE+E PU REP0])+]SUԍ4:VEP\SVEEv])SWUR9SWEPG }|qE+EPUR3E9Et<}~UREPUR"E+E+EPEEPEPE+EPUREPe[^_ÐUVSMU u1 BAC9s:u9s  AC9r[^UWVSEPHU@$EvEF u1 ut}vFuovS l4%tF;u~>6vSߏ l4%u ;u~+uG;u|1GEEU;B(HWURVEP :'e[^_ÉUVSu] S&VFFFF;FH|$FF j &j &e[^ÐUVSuF(X t;F,tV+vS׎ l4%t&t @?j^V/vvS臎 l4%tSVMvj\V0PV 0PV؃0PV %e[^ÉUMAA1;QL}AB;QL|ǁ ÐUVSuFPtKjV1ۃ; %vSVvHV. C; ~ރjV_' VMj $ j $e[^ÍvUS]hYǃǃƃǃ1]ÍvUS] ǃ]ÐUWVS}] SWtAjSuVfu&jjjWVd ؃VJ@1ۉ؍e[^_UEu vUWS]CD<1pu`;X%C(+C$=~ ǃ|+s$ He[_ÉU,WVS]C(E:UEEU} C,D;C0 u3::.*EEC, C,:u: S,FC,>uS,:C,p9sS,FC,9rC,SEPS tjS>%XE`'wr$KvE S,EC, EdvETv41E<t= <t<vEvSOvF9C(DC(hd js,Pƃ,C( S,C(C(C,9s(s C(8 t~SEC(C,S4TvPhKÁ$9vE:h:SEE C,K,C,;C$v8 uC,}HE]N;v>[t>]uE}[}tg;} ub=:?uIt ǃ ǃS%<u SuC,C$vC(uH@C(.*C(;C$r!;C,wW@PSE<uVSDu jS螻 jS9E}t(uC,vC$C(W@PS0}uASE9tS<US(:?::WSE<u=:?u }:uE}t }uZ}uTE:U쉓E9t Sm<u /vUS(}u Sc}u }Ee[^_U WVS}ƅ.ƅ*G$G$G,G(E jWܦG( G(G(G(} u/v?WPWp uG$G$G,G(8.8*hPSsz.@*hSPHz.* 2.F*FhPyE GDG$G,G(} ujW裸<t&jW5<uWq8t&WOG, G,G,W[^_ÍvU WVSu} }u/^(;^$rKvWSu K;^$s/v^(1*^(vWSuC;t;^0re[^_ÍvUMU QDA$A,t t+vjQ1%jQu%ÐUVS]u S(MIt9uJ;S$v9us;S$r u9t:9u}tBS(@uS)1C(S8e[^UVS]u S(MIt9uB;S,s9us;S,r ;9u}tJS(@uS1C(S货e[^U0VSu]S!VS藝 EPSj!t tDR5:%j5:Ҵ <u5:I$v5:&5:(1Ƀ=:t#;5:t:vA<t;4u:4VښjEPj  Vj$e[^ÐU0VSu]SjS膜 jSxjSm jS_jST jSFjS; jS-EPSj^  j$蕏1҃:=:tBjS3 jS%EPSjV1ۃ :=:t5vhPN 4ƒPN t C:MAX@AXDž󍃘9sf;tH;t<€:t1B:u鋅9rMyT󥋅UBX=~hOr0MQUBXBTPJUBX@BX[^_ÍvUVS]sHSC`@HCH>@FS e[^ÍvU WVSuHF@PI1ۃ;^}@P0C;^|FExF@P1ۃ;^}@PC;^|FEx e[^_U WVS}wGt+>tv3蚈;uV膈w G t'>t3b;uVNe[^_ÉU WVS}E ;G;GL+w~R~%W\z|tB|8thg VVVr|r19}j NC9|GW\tP8tE؃zhtBh8u.hg PPPG\.PI@vG\xht4@h8t,1ۉ9}"ލvhg jG\phC9|E Ge[^_ÐU WVS}E ;GGH@9E } uj [Gvu +wFv*W\zt!B8thg E PPPr~3W\t'8thg VVVvGPtEG%U 9t09}u j 9|E %GWE )POGRWڃ~;O\t/8t$hg RRR-PbGPt؋U M 9 &;E ~j G^1ۉ9}ރj C9|E Ge[^_U WVS}u ]~ GH@9PF GKue[^_ÉUVSu] FP;^HV\zxtBBx8t:ztB8u'hg SSSF\px+PmvV\z tB 8thg jr EF\xt*@8t"rhg jF\psV\z$tB$8thg jr$e[^ÐU WVS}u ]\GPR;_HIW\tS8tHz4tB48u5hg SSSG\*PhSVWAW\z8tB88twz(tqB(8tihg jr8'_PF KuW\z<tB<8thg jr<hg jG\p(bW\z4tB48thg jr4PF5 GW\z<tB<8thg jruOUzd1Vrd7(ǃuhOEpuVhPUrth@PMq^UB`@PB`@@ MQ`BB;=;jSEPU;uhO*‹MA`hfO*‹MA`P hvO*‹MA`P hMO*‹MA`P hO+‹MA`PhO*‹MA`P; =;t*V3N+PSEP ;u܋UB`x@PMA`x@EP`BMALBAHQPPEPV URjPj@ MQy1[^_ÍvUWVS]} uC`@C`@EPhht@s RtEfxt@f}tEEPhht@s tEfxt@f}tE1ɋS`B;uB;tȍe[^_ÐUS]M UC`~P v@PC`H@SS*]ÐUE@h_P@@@ @DM@@@@ dP@$@(@,@0iP@4@8 @<@@oP@D$@H @L@PtP@T%@X @\UWVSu^hsCEPh<V\s CEPh<VG st<>u%EUt DPS]SŰ>Ov<>"uISWEP$EU| u D>EUt DPS]SpE} e[^_U5<uIJÍvU5<bÉU WVS}hxPwU hPwE  G`pphPw, PGP@tPPhPw PGPtPPhQw ;_\=;tR;t$8thHP33QP6vhQw  >uwj )I1[^_U WVSExxp@E;;t18&USQu/PUBPt/QP5<Mq uXQuUB`Px t/QR봋u]Qu EhbQp_ uMпgQtlQuUB`p5<r 'MrQuUB`plj;;t4M13uu-;uV\;uPE0t :uPM1hQ31;tLv;%u>CMw$RvG$tPhQEpC;utn t vEU:t(8t!PhRMqhg jVJEE8t8u!Rh@RUr:1ۃM1ƒEu>t(8t! PhREphg jRSR1PvtWhRMqEu>t8uh@REpuU2#ÃEM9t8uuLh@R7E0ƒEM9t.8t'uPhRuv(vhg RRSP2P1[^_U WVS]EPs wl 󥍃l lPp4t%=%}RPPERE 0:t9:t} E}~ERE 0:t :t} E}~ҋ! ! ! ! 9PP1e[^_ÉUWVEǀƀxl<-󥍸 =fPe^_ÉUÍvUS]Suu Su]UEU H HJHJHJHJHJHJHJ HJ HJ HJ HJHJHJHJH"JH J@!BÉUUE JHJHJHJHJHJHJH JH JH JH JHJHJHJHJHJ"HJ @B!ÉU,WVS]9EUEfEEfE\M䋻XpulE싓hUvdMEE===EEUMEBUEE:Eu } MQEPSUM M EPQSѤUup0M }t=EPWS衤UM :EPWS膤Up@0: E E86e[^_ÉUWVS]Hw1Ps br%=%P􍳘V ;t!VsVr !;tt(;t ! ;xt(;t ! ;lt(;t ! ;pt(;t ! ptǃCPRPP1ɃR: uR A1:t1ɾRE U9#u}9}:9t#t A~ȃjS99PP1Ƀ RE Uv#u }9:t#t UA~ƒul Pjs otǃ1e[^_ÍvUS]u1.lPjs Totǃ1]ÉU WVS]u1 󥋃! ! ! !  Pjs ntǃ1e[^_ÍvUS]t1.Pjs 8ntǃ1]ÉU= >dEEU)UUM)M9stjSRE+EEtlHtUPh0Ur?svUM|lHEEvUUDp#CEtE+vU+UMDt#CtE-}u}t};׀}tGEU;BH|!hHMQhUr}}}}t3EPhUEpv3hUUrG ;hUMq%]UHE+EE܋upu؋EtEԋMMЋu)uЍv<+t<-u EBEֻ >v ;tV3Qu;u!VURhUMq}+t }-t0^C@u܍KU C@Sҋu!0eC@MSҋu!0C@[U 6C@M+MSҋu!0C@SҋM!t 1e[^_ÐUVSMu @ǁ@ǁDǁ$ǁ(0Q$;Q,sC(B;Q,rǁ A$,A,A(t \`vA(D@[^U WVS] $tE} u C(;C,sC({(vSsVC(Ѓ;C,wRvWfe[^_ÍvUju}%ÉUjua%ÉUS]C(;C$u Avhd sC $$VC 4C (SCC C c${ wcC $8VK$C K$뼉{ C $LVC$tc$0SwC UCU1C Vvc${ wVC $`VP3F<t*S 5C\CC  C SC SB9CrCC)ƃVPSlj+Kt!1;S} C  B;S|KKs{SB9CB CPs C ve[^_UW=HAu^1@a@z~A@Z~0@9~?HA_ÉUELALAÍvUS]:] u12E hh(1…u E )‰Ћ]ÉUlWVSEEE EԋURUEEEEhPES)E E]MY aaaAAu~u@>tj 6Qvj 6PUM9(]C u6u؉uċE9EI((vEEE}t EUЊEEr%$dXvE@9Et#MuQu]S)%u‹M)@;FӋu~(FF=vFUr2PM'9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]E&u9utEuPVuh($U‹M)@];CӋu~'FF=vFUr2OM&9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT] E%MME#}uu .&u#EEvEEE}t EMЊE}*tf]u}+tX}?tRzv}\mu9uEEE}t EMЊE}+t }?0]]E}+t E€}?t ‹u9uN}$U‹M)ȃ];CvӋu~2%FF=vFUr2NM%9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR}tE@]EP}tuF.9t v.uo}tiE9Esa}tEME}t]C 9t 3v u+u@u E+E؃PEPj $EE+E؃PURj#EM‹])ÉӋu~#FF=vFUr2xLM|#9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]S+EPuV}tPN#EE}Z"U‹M)ȃ];CӋu~"FF=vFUr2pKMt"9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]SjuVjY"Eq!E؉EȋU‹M)@];CvӋu~!FF=vFUr2JM!9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]E Eu9uU‹M)ȃ"];CvӋu~ FF=vFUr2IM 9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ";AR]؉]ȋu‰)@;FӋu~FF=vFUr2HM9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;ATME؋E8^uE8^uE]]܋u‹M)@;FvӋu~FF=vFUr2GM9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT] E؋}1]؀{uutKE9Eu GEEE}t EUЊEEtT}\uNM9MBEEE}t E]ЊEEЊMu2wv}]u E@9EI}t}-uHE8]e}-u6E;Er Ex[t"E;ErEx[ux^tE8]uE8-uAx]t;u9(E萃EPURMQ]SEP Ez}[pE8:du9EEE9EUvM9MEEE}tE]ЊE}:t&}]t u9ut}tEM E뫍vEU}:E8]пXEXE$XE*XE0XE6XEu\9tBE)؋ЉE؃}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)Ѓ;CXuE؊EU؈E؋MEEEE]؉]E@u }u}U‹M)@];CvӋu~RFF=vFUr2 =M$9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]E؃EЋu؍DPEPj }uUMEU] 4Ήuă|t LMMEEU] t Ήuȋ|ELȊU(ʈ‹])É؃u;FvӋExP҉Pv @vMq1;u9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)Ѓ;CNuE؉U؈E؊E(ȋM؈EvE]%u‹M)ȃ;FӋu~FF=vFUr2:M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]S+EăPuVjnEE}tE+EPEPj U؉UM‹])ÉӋu~FF=vFUr2|9M9tBE)؋ЉE؃}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;A\EE]؉]u %= E;Eu E9E ]MIU9Uu]  EEE}tEuЊ0EE=wu`%v1t.}}EEEDPЉEU9Ut대},E9EtnEEE}tEUЊEE=wu`%v1t"}1ۍE\PЋu9ut 뙐} ]}|UM9]Huu7}\E9EYEEE}tEUЊEv}}t] A}u!u  E؉EȅU‹M)ȃ];CӋu~ FF=vFUr26M 9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]S+EPuVj EME ~EU‹M)Eu;F׋Ex P҉Pv @vMq15u 9tLE)ЉE؋E)ЉEă}t E)ЉE}t E)UEȃ}t E)ME̋uE)E;FNEPUR~ +Eȃ v+EȃPMQj E uVEPjURjw E  KSE+E؃PMQj EuVS+EPEPj3 E0vMU9n ȊEE}tEMЊE䐋]u9uEx\cqNAbE؉EȋU‹M)@];CӋu~ FF=vFUr23M 9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]E NAvu؉uȋU‰)@];CvӋu~ FF=vFUr22M 9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]ENAu‹M)@;FvӋu~" FF=vFUr21M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]ENAu‹M)@;FvӋu~>FF=vFUr2 1M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]ENAu‹M)@;FvӋu~ZFF=vFUr2(0M,9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]E:NAu‹M)@;FvӋu~vFF=vFUr2D/MH9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]EVNAu‹M)@;FvӋu~FF=vFUr2`.Md9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT] ErNAu‹M)@;FvӋu~FF=vFUr2|-M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT] Eu@0EЈEE;EPuuuEU؉UȋM‹])ÉӋu~FF=vFUr2h,Ml9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]E؊EU؈EmM}}t E]ЊE}uD0;Eur>tmE8*te8^t`Ut8\ux+tMx?tGvE8+t:8?t5MtE8{tE8\x{]؉]ȋu‰)ȃ;FvӋu~FF=vFUr2*M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]E؋uE؋EHE̋U‹M)@];CӋu~"FF=vFUr2)M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]u؈E؋EU9U}tE+EPMQj n}uUu(]u+3s1@v 6. & e[^_ÍvUMU E BBÍvUS]M EUAAQQ[ÐUS] UJ9t IJ9uuSu]ÉUS] UJ9t IJ9uuuSuw]ÉUS]U ;Uvz\1:(u uu:|uf|t[ÍvUVSuU:\ÍB1;E s1 t :)t-t t9)tf} :|tvtt 9|u[^ÉUS]MIxU9\uIy1[UWVSU;E u vHMMQEP<~1ҋEt 1ۉSUR MQS}tËUuƃ}tËMvE8}t&ËM%)ˆӉ%)C<1e[^_ÉU,WVSE@EUUMQUEEeEE1҉߉@EH`U9Uu:} M9Mu(}GU $gGEMUEUME$[v}OUBM}74E|}FM}F$)ljsENyDU2vMF~}74E}FM}F$)ljrENy1<uUF~1<tMF~1}>F~E@ @u G bUBSM1Aƍ|}8?t ?*EE0@ƋUtu}UE9tMM1AƃEE;EskU;UuCkA9EwKE$)ĉPuS&]t}}UEu4EvEH}tUEEKEMAƒEu/EE8EE%vE}}E9E}UBM $bB1e[^_ÐUEU Mt`H EBEB`BBÉUEPuuuPu jjuU,WVSu] E@EURUMMM39} ;E~])}t8 u~ }t'E@uP]u yr};uUBE];u}3;E| E))M;u| E+EU }t5;]~W} 8BE<uCK;]~= }9BM<t';]~"B}<8uK;]~ BM<tE)A}t;u| +E}8U }t%M%E8tJ|;uu}t }GtGE(PU$RVMQ}WEPU RMQY tt~KFCNe[^_ÍvUEPuuPu jjuÉUWVSU$EEЋMAE̋Y]ȋqFuEEEEEEEEEEEEEeEEy$)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe}}}}}}}~}t}EE9EE}9}sIEM]u}M $$$E]9]r}u } tu u}}E EE EEMMM;UU U]]uuUU܋})}܃}~E9EU UU؋MMv]]]؋u)u؋}܉}ԍvE9E<U9U}}tM9M w E E9v]9]0Ѓ}tt u9uwp}9}dEE؉EEU9UDM]u}UEM9Mr}tX]]؋u܉uԋ} 9r E9wUUEM9Ms)v]u}UME]9]rڃ} uFFuUE@s} PGPGE`H\vUBuHE@M 9s=Pq] CPsC{u >t*F}8VE9Eu M+M E+EEEM Mv]uMUuEMU}EMUuEC;]vċUEM EUE]EUEuu4EUE}؉MUuEMU}EMUuEC;]vċUEM EUE]EUEuu4UEBEEMЉM]9sIȀ8uEu9us6E8t}9}s&U:uBEBE}uJMU+UE+ED@9sjE+Ep]čD[A9EE$)ĉPuSf]}}M+UDv9r]E9w>MUuEMU}EMUuEC;]vċUEM EUE]EUEuu4EUE}؉MUuEMU}EMUuEC;]vċUEM EUE]EUEEUEEU+UE+ED@9ssE+Ep}čDA9Ew9E$)ĉPuS]t EEM+UDv9r]U9w>MUuEMU}EMUuEC;]vċUEM EUE]EUEEUEEUBEBE}~&MEM]Ј ECEv}uFFUBEBEtMMJEB+vEWvu]FEE}}}UEBEEMUEB}t] 9] u9u}}9}EH;Eu U UJEH9u MA v]CЋu9uu}EH9Eu MA]%9O}tu 9u }9}}E9EEH;Eu U UJEH9u MA v]CЋu9uu}EH9Eu MA]%9cu9uu}EH9Eu UBM%}t] 9]C u9u4}*EH;Eu } UJEH9u UB vMAv}t] 9]uu9u}EH;Eu } UJEH9u UB vMAL]9]uuEH9Eu }GUEM9M9]9]uu9u}}؉u9tE9Eu UvEH9Eu MA]EU9vM  @;Evr]9]uu9utt}}؉u9tE9Eu UvEH9Eu MA]t1EU9wvM  @;EvE;v v}MUEtEMEUEMEEMEEM9r=MUE]MUEuMUE}I;Msă}nE9Es^MЊ<w <s < t I<uD]C]M@EE]]tE8 E8u 9u,}9} EE}h[^_ÉU WVS} uEU9E<<EE@E)EE@ÃEE| tE3E| u'VE؃Pu}tl]E8tEX@ÃVEPuIt8]*UE"VWEPt 9}1e[^_UVSE] uE9sBE8tVSEP:u 1&vEE@ƒEU9]re[^ÉU WVS}uEEw<$p\EVu EP>u $$uq1wE@ExMREE@EuăEE@EMEu 뙉E둉Ee[^_ÉUWVSM}u] tCF8::tIu1[^_ÉUE``HP5LAu u9PAUWS]u=u ]1}=uCht#hu%W1 h5LA߰HPS蒰PAe[_UWUװHjPjPRh}ÐUEÐUVSE u]t7Phi]hnSVhn hnj SVhEPee[^ÉU WVSE }]tJPhi]hn诖SWhn蜙 Ή0Phn]hn{JuSWhVK舉0Pht])PVRe[^_ÍvU WVS}u jVNÃu!20PVhy]7W؍e[^_ÉUlWVS]u ǃ ǃǃǃ0ǃǃǃ$t'H=vh]iEth]v}uE]jEPEP1p} EPvEPB} EPE%f= ]uǹ ujPo u] tEPh]3S3nEPh]wo }Jh]vjjVSo}Vh]3SDvSW|)}thCPEP-S1e[^_ÍvU WVS]h4ƃt*1҉ Suu uV$h謆0PS1e[^_ÐU WVS]h4#ƃu*t b0PSh ^hn1&1҉ juu uVe[^_US]| | }|c0t S~t@$t$&S1]ÍvUWVSEu }Vm 1>te8t^EEEE8_uEEPjjrtCCfCECG ;t8u)ЉЉ)e[^_ÍvU WVS}E {jE 1RPE ^Éփu.u)H8tE Ph^jEP!WEPE Ã}h&^jEP9sh/^E0P]h]jEh&^E0PuEPE PEPÃL9vpjE1RPESuuA8hSVEÃXt ] )m+Ee[^_U WVS} ނjE 1RP Éփuu讂8t E Ph^jVEPu ;Ã}h:^jWZ,;]shD^7Wvh`^7We[^_ÐUS]0t&08t 00]ÉU,WVS]jSyǃuh^v0E^EEPS5t h_`jEPE@PSt h_9hShVuS =u71h(_3Se[^_ÍvU WVS]} |h8_v08u E8v}"%?ЋM@) %j1RPmuu hU_FjEPu Et-E%U)%hg_3SWhx_jS{1e[^_ÐUuu uÐUlWVSEEu EE}ttjdHÃu1HC C$C(CDCHC CCC@C8C<jjjCLCPCX}PCT JURsTC\9mt\>ruC\r>wt>auC\w< w ЉE+>fu E>hu E UEFu{\{\wuGj8h_EPjjjURSƃ h@CHC u5{vh@CDj8h_jSƃ uN{DtHC@}}}EPEPEPUR@C@{@uS{\wu2jjjjjjjj5A5Ah_s@-C` SCs@X+CC`؍e[^_Uju uVU VSu|!Vh_]SVu S&1e[^ÍvUS]t{\wtD{u.CHC s@h@jP=@tC8C@uu S]US]{<tT{uCa|s@h@jsDyCuC<C@@ @tC8뵐CDK]U WVSu1ۉVw;At+tFt FFX~%CvV1ÃV&ǃ utF81ۉVCvt4VÃVà rVutVtutvVtut1ېVcCv1~<tF8e[^_ÉUVS]1u {PtsPC{t&{\wu SW{\ruS ƃ{@t!s@tKz8t{8}s8{DtsD{HtsH{TtsTt Se[^ÉUWVSE }Et\rt 8t8u 8u1vG8~EG EGjXtn_;_v_t"S7w A]UW )_)_tw@wjEPV)GW)UEGGuG<EuF<u@xw@h@jwDGuG<G@@ @%GDjWi G8u~G +EPURwLlGLG EW ;GLt G8EWW> 8u?_wW_wjjj GL 8u<u G +EPURwLGLE+Ge[^_ÍvUjEPuuUÍvU WVS] u߅t19vN~jSEPuC< u9u1e[^_ÉU WVS} u]t{\wtrC8Sv;sv{tB{u'CHC s@h@jPF=@uC@jS"C8tVWsLCL+Ce[^_ÍvUWSEPu S裁߰H~PSu1[_UE EjEPuuUÐUWU װHPRu}ÍvU WVS1]t{\wt C8vC?vE PSC8u uC81{u{8u{8w2@+st"s@VjsH貁9uCHC C@t1{8tC8e[^_ÍvUS]u S"us@@1{8tC8]U WVS] Eu~8~8~\wuku+^~DuJh@MFD1)@?؃PvDEPtb)ÅԋFu^|H~Xt*FFDjSv@|$^^u;^sMQk} T+^tI~Hu?h@FH*@?؃PvHEP~)ÅԋFe[^_ÐUS]t{\rt^C8C<CCDjjj@CL{`tSjs`s@˷s@A1]ÉUjju ÐUU1t z\ruB<ÐU WVS}] 1vW%PGF~e[^_ÍvUVSuVÃVà VÃVuF8É؍e[^UVSuu@{\wu1jV3usLs@.ss@ V@e[^ÐU WVSU ]uAC8u __:tst>u+C84A{PtsP:{Tʉ)PCPsTP h_sPVsPCPe[^_ÐU_ÉUWVSM] }u 1у_2Љ3 C2Љ3 C2Љ3 C2Љ3 C2Љ3 C2Љ3 C2Љ3 C2Љ3 Cdt_v2Љ3 COu[^_ÐUEtxu <@@@P1Ƀz t jP@pd1US]t {t{$u 2vCxtSpc,ss(C$C1]UVS]u Et 81u}8t u C{ uC `&C({$uC$x&jjs(C ЉCC@C@ } ދC@ FvSYvCpPC1҃x uDRS‹CPtSN1Se[^ÍvUuu juU WVS]{z;q1} uE EC8 L$,dv{E ECKCPtC CcSB;Bv CcC{iE EKC8sNB))9t CcR uC C{E ESKCBC{E ESKCBC{E ESKCBC{`SKCBSBC0C CdC@uEPSCpEuC C@}uE E}E ESBPSrECx t C{E ESKCBC {tVE ESKCBC {t+E ESKCBC {uE`vE ESKCBSB;Bt CdC@C  e[^_ÍvU WVSu} ]]t~tF8t cEPWj;F0t CF0FHtKE)ǃSWFp.'F1e[^_ÍvU WVS}tu G8 t G@_u vGPt7w2:dduBv9t1 v)ЉAKtvՉ+G_GPu"_wW_wG1e[^_ÍvUUtzt BxuBp>&Uuujjjju uÍvU WVS]}E EtA:u}$8t vtsC{ uC `&C({$uC$x&} uE } EߋEHw(}u"~} |}  }|}~ Xvhjs(C Љƃu 0vsEF~(F$HF,MNHFDHFLU %@eVPjv$s(C ЉF0jv$s(C ЉF8 jvDs(C ЉFu~u{utAF3~3C E{ {*S(UeEeC|Hv E{dtM BEыE))ƒCqRS{dt%F0PSzF0%PSh F0{tV~u~u ;}u{u~tAF$v~u{lu{C|@WSdЉBwCtu ~umdukuS08vjjjS0u$SDChv f<u,h‰I~ 1f<tDI‰ȍe[^ÐU WVSu ~o} f ^VF^VfFߋ)Љf E f  ~k}Of ^VF^VfFߋ)ЉfEHf  ~o}f ^VF^VfFߋ)Љf􉖴!vEf 1;}v E ~o,hUf NV FNVf Fۋ)f󉆴)v,hMf G;}XE HPPVEHP PVe[^_ÉUVS]u ~af KS CKSf C֋)f󉳴f juu S e[^ÐU WVSu ~cf NV FNVf F)f󉖴f =Bl)9~u@lEUf ^VF^VfF])‰fD @lf ωV A)‰Ѓ1 ~]f NV FNVf F)f󉖴f =Bl)9~u @lMʉf ^VF^VfF])‰fD!v@lf ωV1dže[^_ÍvUWVSu]}E~|~e~u VV PV PV VE  9w vSэC9w} tWSE PV ~9 ~kWUf ^VF^VfF])Љf󉖴Gf hlh@hV ~oGEUf ^VF^VfF])Љf󉖴Gf E@P @P @PV PPV Vkt V[e[^_ÍvUWVS]M uf P8ufAI@ofw @m @nf H9%[^_ÍvU,WVSuEU PM ME}E |)9~kU f NV FNVf Fۋ)fDMU f ωM@oU E+E9~lf NV FNVf Fۋ)fMD%U f Mf@p)Eڿ)9~XEf NV FNVf FE)fTEf ʉM}wM@mE@nUDE+E9~hf NV FNVf Fۋ)fMD!Uf M쉎`gp)E)9~^Ef NV FNVf FE)fTEf ˉM;SE )9~vU M苆ʉf ^VF^VfF]苆)‰fD"U f ωM [^_ÉUWVS}111ɍvB~B~B~9G[^_ÍvUS]U 1ɉ؃ J[ÍvUS]u@KS CKSf Cfǃǃ,~!KS Cf[ÍvUS]~(KS CKSfv~KS Cfǃǃ[ÍvU WVSu} ]Vydž}tBVFFNVf FVFш FNVf FrNV GFse[^_UEjjp(@ Љ…tEBE BEBEBU,WVSExU UM IM@ EURUMY4;Y0s q0)N Ep,)ރ? $lq} MUJ EBMU JE+BEUZ4M QRwwGPGPEE EU RUMI ME@EUZ4 ;Z0s r0)N Mq,)ރ}t} -GG GGG E9Es3}jEMUM EEEE9ErϋUM#@SGJm)MuBGtGBG@< t q E @8qMUJ EBMU JE+BEUZ4jvGE9Es2}EMUM EEEE9ErϋEU#@SGm)MGG GGG E9Es2}EMUM EEEE9ErϋUM#@SGJm)MtGBG H@uG B‰W1 E @TqMUJ EBMU JE+BEUZ4jvGE9Es2}EMUM EEEE9ErϋEU#@SG m)M؋U+B(;G sO )ȋJ,)M+G EvU;Z,u B0;B(tZ(9s )؍p Mq,)ޅuhEX4URM QPEEX4;X0sp0)NUr,)ދM;Y,u A0;A(tY(9s )N Ep,)ޅ(EUECNEM;A,uQ(UO3M;Y,u A0;A(tY(9s )N Ep,)ޅUZ4MQE PREUZ4;Z0sr0)NMq,)ދE;X,u$@0U;B(tZ(;Z0s )N Mq,)ޅu@UEP MHUE PEM +AEUZ4MQE P~EGCNv}v EEMUZ4MQE PREUZ4MA0;A4t:EA UQEM AE+AUMY4EPU RQEMA UQEM AE+AUMY4jE PQMUJ EBMU JE+BEUZ4jovUEP MHE @EU +BM EX4URM QP1UEP MHE @EU +BM EX4URM QPUEP MHE @EU +BM EX4URM QPUEP MHE @EU +BM EX4URM QPtvUEP MHUE PEM +AEUZ4MQE P5MUJ EBMU JE+BEUZ4jM QR e[^_ÉUE up(@$ÐUWVSEEEEEEEEEEEEEEEEE,U Uv,,u} 9}uEU 1=M 0Dž}u Ew <t勅490s0Dž}uEt <t싍<90v00U  9s9Ev) x6 ɉ 9r͍E) y&vE <DžDžHEĉ,Lt3, ,u΋U,DžDv,?,t#M,<8E 9rD<E DžDžDM,,Dž80߉$EDž(Dž94E49vЉu 11ɋEЉUЋE;uv1v4E̅u9uw9]r] +}̋M؉ ƋMEЉEMeЋE EЋMeEЋUƉUÉ;Mwu;]vN1ɉu܉MU܋M}t؉EԉڅtJU؋UԋM؉Љ[^_ÐUSM] EU9|9s19w[UWVSE}u u1Z@M v9tAuu 12p@M A9uu1@ u։[^_ÍvUhu ukÐUWVSu} Cv8tAuF)É[^_ÐUE Mʁ`t[! tI tgu@t,jt@ t.Tt4tvc6vb.v-&vlvsvpvwv?@tr-@}wv-@ʁ@@t' t3vt@t-vxvSvs@ tr-@tw-@ʁt' t3vtt-vxvSvs@tr-@tw-@ʁt' t3vtt-vxvTvt@ @ÐU|WVS}u :vE]EPEEЉEPSje }WSjS]S诋 jS!uVSjR Ãt~uWjEPjjWj jVjjEPhSwhVwhYw0jujjVS=Ãu b8tjEPjjEPj} jEPjtEx[^_ÐUlWVS] 1jhaw}awfhuScƃj/S:t7x9ucwH9v8/t@؃Pp߀?EPW`upE%f=u;F ~8>)hSWPE%f=@uWewWPhS1 1;/u {tf߰ҍЍD@=vi?]uhcwSfPS f􋅜P} .􋅜P詆2􋅜Pj􋅜P|1[^_UVSubÃt=j=St"j@PSƃS+|vS|e[^ÐU WVS]} u=u S8u[9S}3SS8-u!Sxt,SS8-uSSw$SS:tPVdu_=-u S8uS=St)>:t$=?t55hwhn&?x:tS8u{sS8uZS;SDSw?>:u:=St55hwhn%vSSwSe[^_ÐU WVS} ut5E8SEPU҃u~E<Nu1e[^_ÐU u )y~(h襄t&A QED A1Ð$FreeBSD: src/lib/libc/i386/string/swab.S,v 1.5 1999/08/27 23:59:35 peter Exp $VWt$ |$L$tfffIutCffffffffffffffffffffffffIu_^Ð$FreeBSD: src/lib/libc/i386/sys/reboot.S,v 1.5 1999/08/27 23:59:43 peter Exp $ԃ7̀rϐ$FreeBSD: src/lib/libc/i386/sys/pipe.S,v 1.8 1999/08/27 23:59:42 peter Exp $v*̀rL$QÐ$FreeBSD: src/lib/libc/i386/sys/fork.S,v 1.8 1999/08/27 23:59:39 peter Exp $̀rtÐUXÐU WVS}u]94U :PWSuxP#‹M 99t )1e[^_ÉULWVSE87 vU:% 11E]z $xvM uV}WE xw$=`tM AD|xP ]SuV} w$=`tM AD`xP B ]SuV}  w@Gt=`t 0=`tvxPQ EPURM y w$=`t] CvxP uV}WhxE HlQ)R_URMQ] ShxCuV}WE Phx+URMQhx] s PvuV}WhxE p vURMQ] S=`tuV}WE P=`tKURMQhx] sp1vuV}WhxE H*)؍@)Ɖ)ڍR9u P}WEPhxU B@PMQ]Shxu vv}WEPhxU J*)؍@)Ɖ)ڍR9u PN}WEPhxU rp1vMQ]Shxu F@PN}WEPhxgURMQ] { ~=`t=`tPuV}WE PhxURMQ] ShxkuV}WhxE 0REԋu P;Phx]S=~ EPURSMQ]Su Vhx}WEPhxOURMQhx] Cދ^)ù$Iэ )PMQ]Shxu FuPsCQ})ω$I)ЍH+vU ZlJMċruu?Qщ)Ѝ9u)Ѝ9u nmEM)$I)))ȍH$I))Љ)‰Љ)lj}9E9MKuCQщ)Ѝ9u)Ѝ9u EnEmu>Vu}WEPhxQ5U:gu @UE;Pu@tf]M;Ys{ u@uMEu;FPvR O l4%rUz_e]M;YVvRN l4%u>_UE;Pu@ti]M;Y; u@uMEu;FvR@Nvl4%U:_]M;YSvRM l4%uKu~_tBPEU@MP%Eu%=uEu$E9EuU9UEiMM@u%=X w+=HDw=8tG&=PI=pw=hv=xyEP|u | EUJT)‰UE)9E MAUy NjMUP @M9tuP @EM9uUUE@AuVEPE@PURMQuV  %UMD]CUuTUE@EMAUu;tCMAUuVMQ%])É@PuVREP UE@M{MA%U\uVSQEPURMQ> <u@%=CKP%Ë%=uK뛍vEHUTEUEu+F UDEPURE@PMQuVEPMQ]ut1}uNE‹DT EUE+F uD1D1 MQuVE@PEPURMQu uVM]L\ 넸ze[^_ÍvUWVSE EEU;BtHMƋMVhVEPQU2>ƉuE }EEM;AtU;uuMME1ۃ u U@uuMAuEUX,} u M@u}u'E@u}uEUX0t(~&VMQVEPURM1mƃ Kہ}tAҁvRHvl4%uI_tD}t;UvRcH l4%u}_uEҁvRH l4%u_uL}t<}t:UvRG l4%u }_tEE{w VEPVURMQE0!ƃ Ur4M9Mt,URMQPEPURM1EUEPMr1vE@e[^_UWVSE@0EU UEM;QtBEƋMVhVEPQU2iE }EEM;AtUE1ۃ u M@uuE@uEUX,} u M@u}u'E@u}uEUX0t'~%VMQVEPURM1ƃ Kہ}tAҁvREvl4%uI_tD}t;UvRE l4%u}_uEҁvRSE l4%u_uL}t<}t:UvRE l4%u }_tEE{w VEPVURMQE0Yƃ UsMM;ut5E9Et-URMQPEPURM1EvEe[^_ÐU WVS]E EƋM}9vUBM%=Pwx=(qw/=== v=8w=0<v=@q=Hfi=xw;=`Hw=Xs>=h)=p!= w=p==t]=tn9EE}t }EE~Ev}Eyv}oEav}ZEL%}O}4E"A"E! Éс‰! ÄM)MƋM! É!с! É!сUBMT%=t'EH%NjE%=u!=v! ÉсUʋ}G%=t!! EE9E[^_U\WVSEȉEċUJ AMr$uBtE}tU EUM HM"vu uЉDEM9Ms vu~<~Dt}~Htwv<}GLT0UOD_H]}\8D;<u;]s2KJ:u9u:t )}9}ËU;]r9tnv]E9sSMQ<:uE);AL|މ׋ILt/C;]s'uV<:uE);FL|މ׋EHLu;]MUĉ urBB} z EBMJuFPN}ĉG$uY }vEp$UrfOMq$XO H]s$>O.uċV$V(F y׉~,F AЉF0F kAЉF4F qjPREx@؋U+B@;EsEEMA]SuV}WEpPƃ tփ}u UzTMăyu#@P@PdM]ĉC}ċ;XPw.UB@@ @C;XPvҋMyTu!]Cu}WEPVsS\UzX~8MăyuBX@PL]ĉC}X~ Eăx7jURMQV]sSUà !j}WEPVUrR*à uwM;qv!}WEPFPqQAƃ uuJUċJAM]SuV}WEPUR ƃ }=MyT0}t#]ċC S)‹}W)ƉGG }vs;]siuċ;XPw.N}TTTTT T -vUDMDD C;]r]ă{ts0Luă~tvL}w$L1e[^_ÉUWVSE E];]]U@%=Xtw =Ht^v=xtRvM@u%E7U‹@MJu%Eu%=uEU@%=PwU=(w==8w=0tlv=@=H=xi=`xw=Xt+j=h=p&MEDEvGMQSPuVEP{ ǃ URMQuVWEP] 9uC]]KSURWMQuV8 tSEPWURV }vEvGMQSPuVEP ǃ URMQuVWEP 9uC]]KuuuƃSURWVMQ t9u݅uuS]SPVuVEvGURSPMQuVW ǃ EPURMQWV< ;EučsuU@%\)CKMuP%Ë%=uKSEPWURMQ 9uS]SWuVEP} \U@%JE]+C D/vU@%JE]+C DD ];]hEe[^_ÐU,WVSU EU1EU9fM@u%=0w2=w =tZ= =(tf=w=`v= =E9EUE8vM9MEu%JE9E|U"AEP^]M;Yu A4Eu;F8x .@MU;Ju Bu];s> @UE;Pu@tf]M;Ys{ u@uMEu;FPvR6 l4%rUz_e]M;YVvR5 l4%u>_UE;Pu@ti]M;Y; u@uMEu;FvRH5vl4%U:_]M;YSvR4 l4%uKu~_tBPEU@MP%Eu%=uEu$E9EuU9UEiMM@u%=X w+=HDw=8tG&=PI=pw=hv=xyEP|u | EUJT)‰UE)9E MAUy NjMUP @M9tuP @EM9uUUE@AuVEPE@PURMQuV  %UMD]CUuTUE@EMAUu;tCMAUuVMQ%])É@PuVREP UE@M{MA%U\uVSQEPURMQ> <u@%=CKP%Ë%=uK뛍vEHUTEUEu+F UDEPURE@PMQuVEPMQ]ut1}uNE‹DT EUE+F uD1D1 MQuVE@PEPURMQu uVM]L\ 넸ze[^_ÍvU,WVSEX(P,U@0EU UEE;PtRUUpjSDEShSURPE0ËU0pSEPDEUUEUE;PtEUދ}HuEE11} u U@u}uE@u Up,} u U@u}u%E@uuNjUp0t'~%vSWSEPURE0à NށtB}UvRh/vl4%uG}_tA}t8UvR*/ l4%u}_u}t{UvR. l4%u}_uIt<}t8UvR. l4%u }_t{wSWSUREPU2à E<ubU9UtZUpSEPBUpEPSB SUREPUREPU2?E UEPE<u1E@e[^_U,WVSEX(P4U@0EU UEE;PtRUUpjS~AEShSURPE0E0}EEU;BtUE1 u U@uuE@uEUp,} u U@u}u'E@u}uEUp0t(~&SEPSUREPU2à Nہ}tAҁvRh,vl4%uI_tD}t;UvR+, l4%u}_uEҁvR+ l4%u_uL}t<}t:UvR+ l4%u }_tEE{w SEPSUREPU2à E<tUUUދ}Ht]U9UtUpSEP?UpEPSp? SUREPUREPU2E zEe[^_ÐU WVS]E EU9uFu%=Pwx=(ew/=== v=8w=08zv=@=HZ\=xw;=`<w=Xk1=hq=pf=w=l==tY=tb9EE}t]}NE~E}~#}nE_}YUT Jv%ƋUr}+E>8"FE vD ׁ)4 M)}MD %vT D %v<uFuT%=tSEp%NjE%=u,vD ׁEUr%=tD EAU9U[^_ÉU WVSE} u]UH 8eu9EuA(t1y w%uRSVWQvRSVWQe[^_ÐUujhWOv;G8^uE;G8]uVP]fF]/;Gss8-u!NH-fF-vVW;WsF:]t;WsB;Gsڀ:-uՀz]uϋ;Gs"8-uVP-fF-;Gs8]tjWOG@XKxivË"FtVvS l4%t-S E9tȉMFfEfFKy~ t VWZ}tjGXKx6ˋ"FtF ff)FËN ffFKyʋG@tF B fF~ t VWVWu%VWPW VWVWPh0W+e[^_ÍvU WVS]u ;Cs1-t[uB;CsBj <:t<= ;CrjSI <-t<]ujS/ VS ;CrjS ;CsB;Cs ::uz]t|j;CrjS <-t<]ujS VS&;CrjS ;CsB;Cs:=uz]u GjS] 7S E;Ss>:-u9B;Cs1z]t+;Csz-u E-SE vEEM:MuEN fEfF=\tCE:Ev j S ]E9ËN ffFC9~qEPEP:~j Sl SEP(EPSËN ffFC~e[^_ÐU WVSu EEU;Bs:vRvl4%t M;ArƋE8+}Tv;t"WUR3ٚu<uڅujMQx v{ C$|vӁvRvl4%tËN ffFC~vӁvRvl4%tËN ffFC~+vӁvRHvl4%tËN ffFC~vӁvRvl4%tËN ffFC~v=wu`%1tËN ffFC~;vӁvRXvl4%tËN ffFC~vӁvRvl4%tËN ffFC~vӁvRvl4%tËN ffFC~?vӁvR\vl4% tËN ffFC~vӁvRvl4%@tËN ffFC~vӁvRvl4%tËN ffFC~Fvv=wv`$%1tËN ffFC~ōe[^_ÐUVS] j=uƉҋK %fCe[^ÍvUS];CrjS(;CsB;Cs:[uz.u Fvj.S=E;SsB;Cs:.uz]u  jSE]U WVSuM E;Fs6s @;FsU;VssB;Fs9uz]u;Fr jF>+}(U=(Ut'WEP3qu<t;uڃtjV 1CUe[^_ÉUS]vS vl4%t*vSvl4YvS+  l4%t*vSsvl4Ë]U WVS]3{E UUSEE]ES3{e[^_ÍvU WVSu] Fx8@tMӁvRm  l4%t"S9tSVY'vPhV<;u FP4;@4e[^_U WVS]3{EECE^E@ @]@S3{e[^_ÍvU WVS]u }CE{~u}~B}u BM$E))CvVC)@PhxS-EPjFPSY C)PhSC)PVS jhSjCHPSo jhVC)@PhxSC)PhSM C)PVS"jhS* jCHPSjhS E@PFPS‹EHPj_vVC)@PhHSC)PhPSJvMQVSN‹EHPEPVS6‹MQGPRS vjS e[^_ÐUUzuE BB1ÐUWVS}GP U@ WJME;GGGMMzuPhPGp‹GPGxuEP2‹GPNURGp‹GP1҃;U})GpЅ}BEAB;U|׋Wzt"ztMQjE)BP}vEj WWEZE}EBE}$M)CfCCC ؍e[^_ÐU WVSu UBP PUx19sˋF ff)FC9rE9u UBH [^_ÉUWVSu FfEUBP HʉU@E9Ef9Cu`9t\1;}sP"CЋ"F%9u0vG;}s'ҋ"Cȋ"F%9t;}t;]r;]sVURދUB+pe[^_UVSEu @H19svŠ"FtB9r1[^ÐUWVSE} @H119s7Š0"GtCB9r[^_U WVS] s}C{ u Plss C { uj ua!vEPC HPSC De[^_ÉUÍvUÍvUVSuV Jȅ}B] 1ҋF9}v<t  vBF9|1[^ÉUWVSEP Z؅}B} u1ɋEP9}v:t1AEP9|[^_ÍvU WVSEU z8xuiv<>uUVE P)tAU R4UE @4>^'<;uSVU R@tE;C~F~e[^_ÍvU WVSu~]+] t;FPVBV EFЋM MQRP^e[^_US]{u5C;C|C@@PSSC M M C]ÉU WVSu}~u^uu VF ]N 9<|FH9<|C ~كF)PN RDPɟF Ue[^_UEM xuP % EÉUVS]u 9s}/Ps uj STC se[^ÍvUVS]u CFCPs Fuj SC Fe[^UWVSEx E1ҋME ;H }"Hv| tEBE ;P |11ҋM A@Y;%=Xwk= )w.=w===0ew=( v=H=xtiw/=hw=`^=pzL=w=t}3v=tn$uCEF=MQRSƒ%;%=`t'=t =L%=`t=uE ;pL~'MMpL~ P@vE P@M ;qL~ EEqL~ Q@vM Q@~v~oBlE ;pL~ MMpL~ P@vE P@~~B1}t0)M ;qL~EEqL~Q@M Q@1%=E xLu @@kvU BL@PM AE H(3vU J<]RL~;%=uAJe[^_U WVSu} u X11%v%=pw@=0w==(=XtY=h=w=xt4=t!==9~1EPRV.ƒ2%4%=`t'=t =%=`t=u}Bv%=`t =9~׋U :e[^_UVSEu xuUh FDtAFDvVDFLA~1;^L}F< VDFL)HC;^L|e[^U WVSEu xFLP ǃuFHvFLPu FH1;^L}VHFL)HC;^L|FLX|? ;NL}3V<:t(VHFL)H;~ ;NL} F<:uIKy19vVHFL);~C9~;NL})VHFL);~A9;NL|;NL|W e[^_UWVSE} 11xt1K_Ht Pt A9~I%=uɅtO([^_ÐUU }uBw   1UVS]s C)C} t1jV跟F؍e[^ÉU WVS}E xu`ÃwY{tSuSЉDCjCDPu CCU v1e[^_ÉUWVS} E xu3Ãw,{w&u)SЉD v1[^_ÐUE xu@ux.w @ÐUM E xu*Bu"z.wB~9| D1UM E xuRBuJz.wDB|99|5ȅ}ATȅ}A$)t 1ÐUjjuuu uޜUjuuuuE PuÉU|WVSu ] }1EuEEShjPZPEPPu64à tPS(4Phhn@ He0Phhn!xt?x=w'hphMh視DžvP訏8#t ~tv蓏8#uh hn@(vi0Ph@hn 2􋵬V趕PjQLXvvP諘 D􋍤Q80u ǎ8=u-(BPR^~膎j"jjj.h vvu h hRhnJjv j"jjj.h vv) h hjhnǚ)0APu6hxhn蜚 1􋅬P<v}u(jhQBDžvPjFjV誖hjPeV PPQЃ9t.ˌ0Phhnx VI9}G~)hŃhn?􋵠V  hS։ 4 jjjSW赕0~uWƋ8t)趋0Phhnc h hnJ􋵠VP`PPƃat t#vbb1ۃuV 􋍠Q }600PhKhn萗Dž cE0=vh`hnX}PMQV }PMQV  }PMQV jPV  t,0QPu6hhn謖 svt?jSP uFjSj]  u+v􋍬Q 3-Pvtu6 􋅤P 􋍬Q轏 ,x[^_UjuÍvUWS] }1҉ ]tt8E]E8E]EBEBEB E藈/TvjjEP;ǃ|7fEPWt%UW h[_U,WVSu}1EEEPEPhu(,tKvu+1>]܅t&VEPM QssA tʋ[uۃuX+e[^_ÍvUjuuu EPÐU|WVSDž}t}tDž DžDž} uhh1ۅtFPEPEPEPEPS uSF&1JvS3&)=(Xu } DžEP;ǃwShS- ƃw茎hS&à Vp1EPP} ]E%f=t ̈́FvEPCP}$}tE;Gt vEt 5S$x[^_ÉU1ɋEPtt HvH@PuuuQUjjuuE PuÍvUWVS}DžtDžp|Pt Dž|xPEPURE P]ÃuVv1Qh3PZƅS j Su0OyW! u; ;#]vR|vl4%t*vRl4C; t; t; t;u; t; uAC; t; tހ> t,> t'> t">tvC; t; t; t ;u<+t <-tUuDžp@u|jPPO~UREPb@u'|jPPOtJkEPURPE Pdt&GUREPPU R@p<+t <-tY~uDžtv~@u&|EPjFP%OtvFPURzvp~~@u#|EPjFPNtTFPUR<u6jvpt>E>tPEPЉtpt tWhPX[^_ÐU WVS} uSWVuuߋMu&\vPhVWaƃu191^;tEP3EPNu߿V[^_U WVS}} u}E`XEU`XPRtE}~؋E 8E4@XÃ}tt;u5@XpÃt;uhUÃt;tj/S$tjS]Ppƃ}EE4@XÃt;ujS]PƃE}~;v}t*jE P]Pƃj/E PNǃu=EjE P]PƃE}~E/u vG/tv+u ~VE P]P+Ƅ3E} ?/u E E 8/tG?t?/uE 8u}+vUPR0E}~؃}tEP&EU`XPREP uA;]}0vPRS C;]|1vE}~ e[^_ÉUShXhcv`XPhXt=hh`XPh C~ vC~]U WVSE`XE=udhÃtD3u;߰Ѓ+=S,uvEPVu E}u.V)1uEP }u&V=1|urEP"q}u&VQ1|uFEP6E}t }t}u:V=1uuEP" VEPsv1e[^_ÉUlWVS}t7utu!u1s=ua5ShS EPS}1PS˂u%f=@t[^_$FreeBSD: src/lib/libc/i386/gen/setjmp.S,v 1.17.2.1 2000/05/16 20:43:21 jasone Exp $vL$APjjs L$T$QYai qyy1ËT$jBPj? T$D$JZbj rzju@L$ÐUjuu u^UjjujHÐU WVS]}u FЃ FFv$tz-tu_tp'tk+tf!ta(t\)tW,tR"tM;tH/tC?t>:t9@t4&t/=t*+t%%CV,(PjSBvV' l4%u<u t/u t"u t t/Fv u"C\E@9\0 $0\Cn\Cr\Cb\Ca\Cv\Ct\Cf\Cs\C0CE<0C0v tt"\C0C$0C$0Z@u\C}MCv V l4%t^Cu?@-CC؍e[^_ÉU WVSM] }CPWPQTu)e[^_ÉU WVSMu ]}MvvFPWRQKwtjWPQ+Ee[^_ÐUVSutPV^|"EPV:~uE%f= t 1jjjjhWà DžllBfDžl EBddBj\PRSC Ѓu*`hEY\ŭSCи@YSCЃEPV H[^ÐUpVSu hĆÃuXqS@Yb;Fu>B@PhEYBP>EPh@Y } u;EuF;EtS2ƒuS<1e[^ÐU WVSh6Džu1`u1ې[#LZЅt;9v,A[HZPZu BA:u[LZ!Cve[^_U WVS} t E }t UUEE8?1vHZPW+ u8PZt}LZU v} tpvLZU _vHZW u4PZt} t/LZE "}tvLZU  FFu "h܇EPEǃ 1e[^_USj ÃuhjOvCCjPLuhj؋]ÐUS]SB9Cu/BCP3éuhjӴvKE C]ÐUVSutA>t3} t 1;^sv4C;^r6Ve[^ÐU WVSu} 1;^s$W4 uC;^r1e[^_U$S]}hB]UBEPRt1;q8t E}t@]ÐUWVSE NjU3u"CVhjCPv1t+10Cj0CPCt{tC1e[^_ÐU0VSj+E P:tEE  vEU :rt:wuE xuEPg}1j *Euu uEE!EEE|ƃt t1uu URrE 8ruhu]{t1jspsi }t_jjpN}tIExt@jp|p.}tjuepu utvC@Pu5EPh$pj:mU :ruRuÃuE PuqÃuxUZr؍e[^ÐUWVSEE]t 9Cuu `vP}jjWs/rƃu Te8t߃}u UStEe[^_ÐUVSjjuLÃ|u SƃSe[^U WVS}u 1CwVW [Ѓte[^_U|WVS]EPSl|}u}v}~[dAvjjSjjujE uҍv` tXtPf=tAf=t2f= t#f=tuЉPn\^~%= t)=t"f= tf=N%= t%=tf= tf=uMV%= t(=tf= t %CV%= t+=tf= t  v %vN%= t%=tf= tf=uJV%= t)=tf= t v%@V%= t'=tf= t D v v 1҉Ӌ~ȉuƉuuE] CCfCCE ;tp8ugvEtUFuO]  ;tA8t:PEEPuڋFCFCFfCFCM} uuЋURYkEx[^_ÍvUU1Ɂ:ELFu B%=ufzu zȉU@WVS11DžhDždDž`DžXjjjEPutGj4̿SUR'4u*SRtlPMQPh} vÉP1RPEPjjPRj u6XTt\hD|Dd6T1ft"vT|tB9|1RPEPjjdRj pXDž`U BBfBB` :t8uօ)j1RPMQ`)h\X\8?tm] \8_u@PWt3Wu.PTR\QS``~ ;t8u\~ `eht;`~2h@v@VP]S9 ]XtdPXRgTtPQTPg]`8[^_ÉUSM] CAC=tt,!=u vC $<uQ@C;E|A/CUƒzu Bt z$AC <wI[ÐU WVS} uMuFuFF EFF]t?9sGAt?\uAu\I@f9sAuf9sAuf|VP?VP [^_ÐU WVSu} f>{u,f~}u%f~u0E4vEPWVS0tj{Sb ÃuكWVe[^_ÍvUWVSM] 9tf9u1qf>tUf>[u.f>]tf>tf>]tf>uf>uvf>{uGvf>}utOf>uuf>uEPPU19[t ,tQ{t;}t:كf;]tf;tvf;]tf;uf;urnvGhtO`tf;,tU9sf9rFfN ffuEPPUK96E1[^_U WVSuf>~E@ EU |B^9s&f~tf~/tA9s f;tf;/uE 8uM0auh,uEm.tQ~u'ePAvU RXu9HU ffA9s9u9sffufE e[^_ÍvUWVSE PhSURƋE ߃?*v[!uf>tj]FPuf[!f[!uf!شff>-u^]tf-شf]uNjU J f]8E H f?)U J 9tf*tf*fffE PPunE 9u,@ u‹B %=uE PUR%8vE @ u*hj‹+PBBPm1[^_UUE 02PÉUEf8tu PPP v1UlWVSu M}Evf9fWEPEPxt 1G tLf~/tEE%f=@t,f=u1WEPEPuE%f=@u f/fFGWEPtf9t+f9/t%f:}Eff:tf:/uۃ}u)މf9/#vff9/t WRQVEPe[^_UWVS}E fdUWURƃuHt:SEP'U0SGЅuG t v1DžDžTG @Wzvz.u Ef8.uh] fBf ffBfuUREPU R\u E f"vWURSEPuV҉ƒpG @tVG vV[^_ÉU WVS} GtPw? PÅu u"~GH|vIy_UEf8t fu+EP ƃtVEP>G4G1ue[^_ÐUWVS}] ;]L=?tX=*t=[tQ ;]tvEPSWt fu1fuvEfUftf;!ЉUtytvf;-u]=\tfM:UwBCf9v05uVPèCPV讨Evf;UuEf]uE9E(f9f?%e[^_U WVS}t;G_7Ntv;t 31swe[^_ÍvUSU] f:u1fPR C @uPPC ЋÐU WVSu }SuG @uVSXvVPG$Ѝ[^_ÐU WVSu }Su\G @uVSXvVPG(Ѝ[^_ÐUUM v9tfu1UMU vBuÐUEEEEjjEPjjEP =([t5([TuF([tVjjEP5([jEPZ |U%4,[5([([1UWV=([uu1_4[;,[s@5([ 4[=tɃ=0[u5([r([e^_U WVSu=([u t{1C;,[sCV[([Pu;,[s[5([ =0[u5([([;,[r1ve[^_ÍvU WVSu=([u tw1;,[sD([9p$tC;,[s/[9t$u;,[s[5([ =0[u5([)([;,[r1ve[^_ÍvUS]=([tu5([([0[4[]U=([t5([([4[ÐUÉUuOT1҃u‰ÐU,WVS}u EEEEjjEPEPjEPS }s1rEE$1;]}Mv]jjEPVjEP }L8-t(vFPW{tC;]|Ke[^_ÐUWVS=u qt^=t E2j]EPhԃ]E@P~ u18+t8-uu=H[uhhWװHPhRV hs8e[^_ÍvU,WVSu=u ZtE1Ѝx~ 1vW]EPVǂ]EGxPtà u3=H[u=H[thVhÃt8+t8-u1ۃ=u91te[^_ÉU0VSu=uu1E3uj]EPEP]܍E@Pà uD=H[u=H[t)Vhj]ShShà t8+t8-u1ۃ=ub1te[^US]t j@!]UjÉU=tP@=@[t"@[P@@[D[H[ÍvUSTtjjjjS t # = uShnjj/1]ÉUVSjURuP@ Ѓu3uE;$v/$P5((u 1v(FCuFCujVh.LjVhL jVhLFCuFCuFCuFCujVhKjhVe[^ÍvU(E4EEMAH[jEPQRB Ѓu{EH[Ru7=uhiDuG5T =@[ujjhXjjp@[ÐUWSUEPEPװHPRhΌ5A u]uuh@y@Eu>] hEPthEPu1e[_ÉU WVSuE ]}8+8-SPh``EhEP!à N(hEPÃF(u9u-hS2t6tF^N(hEPÃZF(uSFN(hEPiÃ#F(uSF N(hEP)ÃF( u^N( hEPÃF(uSRFN(hEPÃF)uSRF$N)hEPÃtNF(@u^N(@hEPiÃt'~(|^N(hEPBÃu1)F)u^ N)j v ZÅte[^_US]EPhSDFu ,t#uEPhΌSFu1]ÐULWVSu ]=uh|@=uShShhPq PPHPVP5= ti=ShhS PPHPVS5=0<=4j:ǡDžƅ5jWPhyCS u9ƅ2jWP&yS M8+t8-f.=7x@5VjPN uSPnÃC 8VC 0tC C 8u=D[ЍE@PV@=D[hЍHB@[jh8[RP@ Ѓ9%8-x@5VjP2 uSPRÃC 8VC 0ztC C 8uD[ЍA@PV(lD[ЍHB@[jh8[RP@Ѓ:17:5uÃŵ؍[^_UWVS=uh<=u=uR=dt5d[EPEPhhhdV5;ǃ uX>dEPEPhhhd5hSV5a=ǃ St1vj:usÃtiE=D[t;EǰЍUHB@[jh8[RP@ Ѓu:!:5uuEPTuuBu-e[^_ULWVSE8+Cǰuh5aEx@=P[P[@ 8t{=D[t@EǰЍUHB@[jh8[RP@ Ѓu P[@ 뜐hP[@ 0háP[@ L[P[1v=L[uEPL[EPEPEPu=,nt5, e[^_ÐUpWS]߰t=\[t5`[SpGPEPh?} 68tE Eu4Ph'h~d[u=PEvEPh)5d[iQ5d[gy }+u4P=Pt%=8t=d[tw5d[ygvSt,߰P`[SP =d[t5d[\[X[e[_ÐU8=X[u1:X[PEX[PE X[P EX[X[ÉUVS5T[t/6sɬs 辬 S責uT[=`[t5`[芬`[5\[tSv6{ts[{tsG{ ts 3S'u\[4e[^ÐU WVS]} ЍpCPZucC;,t;tPZtVE PW#u)9u 'C;,tPrZuEE9r1e[^_ÍvUSM] UE8~1mt)tVt't>JЅu,PSh. Sh4Ѕu,Ph9Q¶h>Q貶]U,WVSu}}8EP8=PDž1h00~PP߰HPSRtBP50N.ǃ u5EPǃu&PEPuE PSDYEP} t"tE PuXttVu5}t"tEPu 0PPPX1[^_ÉUWVSuT[tsVRuuVÃt{t nCC EV8ME8(j&ÃjS<\[\[E hbEPiEE]hdEPCƃtfF> t> thfVt)H~4XS{UMSPV h EUE}f#hiEPƃVx u}t*EE8 t8,t8 t}t E81e[^_ÍvU,WVSv=4=0uh0-PP}HPURhm50* t/U=P4fEPhvhP +u4v;#C; t; tC; t; t ; t;u)C; t; t; ;j}@FPdB VPWeB߰ЍpDž| uN|\u NDž DžDPߣ~/PRPTeR衤 VPS+etN5d[hWwtЍp DžB T[T[URpu C=45d[hP}v5d[n1[^_ÐUS] =@jjj7@|*=D~*S5D5<7@} 1@_=<t5<@@DP<tS5D5<F7@|9Dv<E@]ÐU=Tu#jhH1}1T1=HtHUS]=Tuu S1}1T1;t؋]U= u t= uMjjju1M 8+uv*v@Shd9~jhэrdځ%hUdڃڃWRhjh ? ЋUHE e[^_ÐUEEUBjjEPh jR肷t ÐUWVS] tk j(ƃ1 EF ^$EF$tN$UR8=vMQ"PVjhV=EYf@2EEE8vU:HP2VfC2USK@KF$PSV fC4 fufC4}t EC]C}u]UZ]EEM9`}t}~EPURV EjhV9t?MHf@4 F$ujjhF}N$?EPyUR v V1e[^_ÐU WVSu] C&fC$GP{@Wv j/W+ƒ t09uzt&BװЍxPRC@P f{&FCCC,F e[^_UVSu>t9f{2|$vڋCuCÃR9f{2}߃S&~tvf ~tvvF$uGv't $1ۃv賜tV诒 V藒1e[^ÉU WVS}?G%7V8fF8ujVW fF4UvusF4ffwejVW fF4f"G$jjh-F }>FfF4N6vf~4tG$@tBF,;G t:F6tv 葛tw GfF4vtbG%tg%w Gt=jVW tRFN6wt=F@Fvu*jWQGuG%1wGvP辐f~2u,G$uws%VWf~8tf~8uXjVWfF4fu9G$u3jjh~F }FfF4N6fF8OFP$@|/uT F@$/BF&@PF@PRpPԏf~2u"VvV$Gf~2uG$wQ$hvF6tFG$u0v 5$tv @0vv )+vF6u"G$uh#t O%~tfF47e[^_UUwE fP81vÉU WVS}] tt7G%f~4 u Ff~4twu O%f~2uF8/tG$tSW\GMvjjh'ƃ|.SW0GV" uV踗Gv1e[^_ÉUE$FXh*P P \TCh<St8tDA8#8h<SNt8tH,h<St8tLvh<St8tPX\vh<StV8ttMPXh<SVt8ttP\5PS*1ۃh@P wvH׹0׹-׹h@PtQuźB׹tE׹8Tt jOf[^_ÐU=@u t u1vDÐUVSut-"VD5Du 7u1e[^ÉUS]9t.#vS5H虞u Dvu1]U=@u1hKhMO@u!0P15@H[ÐU=@t5@@ÍvU,WVSujhXjj hMj jh`j5[hb]S賈 ߰HPSj賆VJbƒ װHPRj舆jhgjwe[^_ÐUSU}t vAzu$)ĉE UECtABu5Su]ÍvUSU}t vAzu$)ĉE UECtABu2Sul]ÍvUSU}t vAzu$)ĉE UECtABuSu*]ÐU5u u ÍvU|WVSDžj/EP$tEDžIE8Hhl_|ƒuqװЃ$)ĉu R|8uDžЍp}ЍxD7=vBjhjVPjσ jhj軃 vVSP5:/WDPEP:D7 5E PP3 =wq$1ҋE 8t BE <u$)ĉ$D$PCPE P95Sh #PP; u uGDžhP@t vx[^_ÐUWVSEEE uEPEP3} 1hh` `E܋M`9Es# EA9]sE܈t E܀8|t8:uߋE`Phu>`Phu> EPhu>~uܿ  u !}tuܿ* u j:h4uU2t EPh7u@tU؉EPh:u@1҃tUԉEPh=ur@1҃tUЉEPh@uK@1҃tỦEPhCu=~h[ufd*EPhCu?1҃tUfdEPhFu?uEģEPhIu?uEEPhLu\?tUfEPhOu1?tUfEPhRu?1҃tUfEPhUu>1҃tUfEPhXu>1҃tUEPh[u>1҃tUEPh^uh> tUEPhau>> tUdfEfEgfEiEjfElEmfEoEpfErEE``ÔEaEEEEEEEPEPu=u EEPEPud=ECEPEPuH=1҃tUSt,EPEPu!=uE1sC C EPEPu<tUS u0EPEPu^:~h[uC EEE}hfEfsfEuE`\E0EEEPEPuS<1҃tUE}4~`WEVWEVu1r`h[^_ÐU WVSu] ߃;t3VUt2;u=wu`%1u1) vVke[^_ÐUt vB:uCtBIu[^ÐUWVSE} ÍpvCvA8t uv)[^_ÐUWVSu >=uFHEEPURlƒt5}=װH;EFBu1;t vG;ut;u-PR\jÃt@PhÃtlPS5 *tD}UB:t:=u+EUDP$hU u4EBMEt:=u=BFBu1e[^_US]EBuEPSjuЋ]ÐUj juKÐ$FreeBSD: src/lib/libc/i386/string/strrchr.S,v 1.5 1999/08/27 23:59:35 peter Exp $ST$L$ 18uBu[Ð$FreeBSD: src/lib/libc/i386/string/rindex.S,v 1.5 1999/08/27 23:59:32 peter Exp $ST$L$ 18uBu[ÐUE<\ÍvUWVS]j(kfǃ6hQfƃG (\w$ N PV@FO WGFj8P8EEEE EEE=<\t<\9~؉E]EEjhXP@S9`EPSL u|iD@R@ЉÉ^Sce‰V t/XSPRjFGFGW5hhn.1[^_ÐUWVShPuhvE|sxPj9Ã}hv~19}2:A9|PSxP|PPX[^_ÉUÍvUEU @$JPRA ÐU VSu} ^$juuEPw^{tsdCC PEP=`tC CFCF4vEC PEP `CCFCFVfe[^ÉULWVSEX$@;Cu 1CEEjssuV]UURV*Jǃ tajEPEȉEEEjV@Ѓ EPVIǃtUCBCBREEP]SIEԃxt S@Љe[^_ÉUVSu^$sCc{ts/cv$!c~tv cVce[^ÉU,WVSu]~$jhGPSi\VSS^ tF PS?^uh.CS@ЉCxt S@Ѝe[^_Ð$FreeBSD: src/lib/libc/i386/sys/Ovfork.S,v 1.11 1999/08/27 23:59:37 peter Exp $YB̀r tQCmU|WVS``}uӝ[u՝C xt1QEPPu5|Qv}փ=15Sch۝SGJ MQS7JhݝS)J jS+PP@xt @\uPy_vPQ$ /EPQb4PSP:j ;;􋍜Qi~ VS|9v|:.v=|7v|8v=|+v;|,5|P x`1Yx@\:Dž􋅘P'_􋍜Q i`x[^_ÉUVSEu 19sj PG@C9r؍e[^UWVSU1;] } vװ‰C;] |} 7w 1۾0 2C ~[^_UdSUE Åt C}fEfEUUEEuuEP/…tEЋ]U1ÐUdWEfEfEEEǰHEEĒEEEPu EP+}USu*9u9tT]ÍvU WVS}(u=Hot WVG u!jjjwG(ЉÉփu u=_PwTG tG)փ0t#G<)G t?tG)‰Йփ=Hot W؉e[^_ÐUVSu]=Hot VSu Vx*Ã=Hot V؍e[^USE8eX ;E{ts\{ts[{ts[{<ts<[{DtCDP[{HtsH[S[]ÐU WVS}}Hw}utuul@`1=uqh\ÃtQuH߰Ѓ+=v yS@uXv5S]h SC EPSChSC hS,ǃu WÃuWOvWӁ{suSfsu S6fs$u S Fs(u S/ &s-t S3[^_U|WVS]EPCP}}S {uXEbSY$SjuЋEPbE tUR1MMuЉuT L E5t PUB0B0P P 4 4 < < D D E׃4Ӂ4с4U::  E}~NjML 8 4 ЉL u9v EPML @ < ЉL u9v EPML H D ЉL u9v EPEu8 UDD DAuTL)AL D L E9L )I~0}D; IED EMU;4 IEEu;< }KU@ UDDDDEuM;< |EUE;D }HMH UDDDDEu;D |UP L ;EvMQ vuVU1[EP u ǀL U4 u ǂ8 M< u ǁ@ uD u džH Ex[^_ÐUE@(@,ll1ÐUVSM] uu lP05Av ww lP0I  At[^ÍvUWVS}] E~9ust/'tV~ CJ[^_UUvRC%vl4ÉUUv RC l4%%ÉUUv RC l4%%ÉUE%UUv R>C l4%%ÉUUv RC l4%%ÉUE=wu`%1UUv RB l4%%ÉUUv RrB l4%%ÉUUv R:B l4%%ÉUUv RB l4%%ÉUUv RA l4%%ÉUUv RA l4% %ÉUUv RZA l4%%ÉUUv R"A l4% %ÉUUv R@ l40%ÍvUUv R@ l4%@%ÉUUv Rz@ l4%%ÉUUv RB@ l4%%ÉUE=wv`$%v1UEÐUUv RR4 l4ÐUUv R讦 l4ÐUWVSE@(`@, L u PUL C; t; tj$NEuMQiO *v1jEPS‹E;]t]uEPC; t; tjEPSޣ‹E;]t]u URDvC; t; tFwjEPS蔣‹EP ;]t}uMQNuNOWEP #v L u udNUEL MǁP $ ll1e[^_ÐUWVS]1} tClL }%tu 1ɉ΋ ;M v}tEl@0Pv|$~Iv CI}tElL P ! [^_ÉU WVSM] }lL #r !M;ru`lL p9ur7tJv E CJvlL ;pu 09usZѐlL ;pup9ur"lL ;pPp 9urCJv ECJt[^_ÐUE@(`@,Ȕll1ÐUWVS]}1} t_]w;M vtl@0Ix CIyt[^_ÍvUSUM E]f}v.Qt ttA t 1[ÐUWVSE Džl}tEDžTuvuz"vEH7DžTTPIEUTH=D\1ۃ=D\u9]EPVEEpPSj # ЉH+EPMQWƃu$jpPj }!8Nt 8u D\=D\u D\E8/`ǰЋUDH9sr`H``HHH9`r4``/H)PEPQ @R\IE"HI`H@DžPPRH@PD.@@EPh>YU\MXDždvEP@P]Uh9\u 9X;Dr?PɉPQ@P@rljPD.G.G@Q'\l7EPl0F/GDžLh9Uu+vlQekƃ9uvlP=kƃ~.u~ t؋F%=.tɃF@PWFPEP@R t(Lu fLYvh9Me9]\F`+Udt @9| 9}~TX`+E:t>#t =t|\uv|\u v1CB:t ::t:\utn:CP53ƃu6=t-5`@ @tDpt(|t:tAB:t :|t::ujjPjE PPEPÍC wC[^_U WVSj=u uÃu sjdR7ǃu KEd;?u BC$v;\C;:;<w$1tCIt ;/~;7~ZC2w?$L@v 8v 0v (v vv:vCCBMu()FdPWǃEd>;:t;t;^C;:t ;B)K}t)PWDžE8؍e[^_ÐU WVSj=u uÃu jd5u mvd.vCBOu")΃FdPQ&tǿd;:t;uB)Kt)PQtE؍e[^_ÉUSj#u uY…um:0uB:xt:XuB  1 vB< w  <w<w 9|ƋE1]ÉUVSu >:tF>:u^FPuV^e[^ÐUEt  vnUEÍvUS]EPu V0S:US]uu 70SvUEPuu uUVSu]=u jW5hg5t(uS5~hl5o u Pho5M =tVЃV:>UEPu uUVSu] =u j5hg5tuS5hs5=tVЃV=UE Pu觻0@ÉUu u舻0!ÍvUEPu uÉUS] =u j5hg5t(uS5hl5 u>Pho5]UE PuÐUS]=u j5hg5Gtu S5*hs5]ÐULWVSE DžDžDžDžDž vSX!vl4%@tb@MvR#! l4%@t]KExP.W_롐%u+Dž1x$xMyQV U9 Jv뜍v딍v뉃넍vy\CЉaDžDžDž@DžvDž@`[QvDSP>  1 Dž@DžtEUBftE]C}t EMAXWvEMA=NvS l4%tDžDž ExPT ueUvR+ l4%@t2MIy~븃EP4Te럍vW$\u DžtY1vUZ;s&)RSt؅])K EPRjEMqu DžtM1ۍvU(t,CJtzڃR%StʅR`hEMqE(t3MIFtyӃQRt9)؉Åvu Džte1ۍvUvR l4%@uCMItyQRtnE]sUvR l4%@u-MIFtyQQt)v Dž]CՃM$puDžt?yvE`\?ZU`\~vݐ ~jѐ@t_%vtO9uEDžFMIy~v]SxPu  }'9URFPv^xtXuNMQS|u{SjPщщƒu<tE]Cf1utE]CHvE]C)苕v DžMCՃ:w$?:@tg-vtW%=uAF]K{~vEPNu q}mt39ÍvMQNP9wvNetEtEPSNURSuXjPtEMA8%tE]CEUB)苍(t[^_ÐU WVSE 8E ^uEU :E vEhEPUR +u E H+EEEUE E -t) t]E HvU ]t"=\t9|WS}-E =\tGEU9|81VWb}SVQ EUF~̉:E v!e[^_U WVSE@U9B0uEh%ƅtvEp0@4ƒ@7OyU21KEx4?URp0p&ƃt#7WVS)Ep0UP41ve[^_ÍvUVSu] =u=Hot S腻C u2C tOC t"S7u9c CCK {0tCC;C4|+St=Hot S-o CLvc ߃{t;Cv@9u C)CC<C8C@C0C4SBCBC=Hot S蹺e[^UVS]u 9sHr1"VsD$t CDsH1e[^UWVS}W!Jwj 7?ƃtF)ËU O )_7_ECPPWO+EUWDP7R']WI uVwj 7ƃu_롐F+EÃSWu)EGDUR7Px'E)G7U GD E 1e[^_ÐUE@(@,ll1ÐUSM] Ut\9vvt/ tvtCtAvA%=uhtA$ACA%=u@A%=u0tA$ A$? ŠA$? ‰tA l@0[ÉUSMU E]tKv2t $ $? B$? Bt vtjvt<v#t$ $? Bt t&vtt tB t[ÐUVSu] 9u1'hhu)؍e[^ÐUt)}u#}WEPEPV u>t}t;t+}u%}WEPEPS ];t}t}t-}t'E;EuH}u EU)‰U>t;a>u;t E],>t;uU+Ev>u ;uEEURdEPXEe[^_ÐU,WVSEEUUEUvRvl4%@uƀ}-uEEEvE}+u UUE}t}u'}0u!E8xt8XuURUEE}uE }0uEEEEEURPjjEUEURPjj_EܾEE©v=wu`%1tEnUvR  l4%]ځvS  l4%tCCEE;E}y}|;}wu;uw;uu;}uE;E~ E0vEEӋEËEEΉƃUUEU€}}G"v}tރ߃} tE}tEHU e[^_ÐU,WVSEEUUEUvRT vl4%@uƀ}-uEEEvE}+u UUE}t}u'}0u!E8xt8XuURUEE}uE }0uEEEE5=}t 5=EURPWVE܋EURPWVƉEEEE©&v=wu`%1tEnUvR  l4%]ځvS  l4%tCCEE;E}|9}wu9uw9uu9}uE;E~ E7vEEeӋEEËEEEM]EUUUEU€}}7EU}tEUj"}t ]U]} tE}tEHU EUe[^_ÐUVSu] SVtihCPV$tPCPVtuhE}EUURÃuh£jGqE>t}u؍e[^_ÐU WVSuE UE=tSv߰HPSVxu%߰HU C UC#;uŀUńUe[^_ÉUuuhףjGÉU WVS] ӝ0װHPRjbjhjQ ډװHPSj/jhj VƒӉ߰HPRj jhjEPU WVSuE EVURte>;}vE8uVuubUt tQu VWËE uhhnO1avVjS19s(}t"jSURU҉E]F9suߋE8uU 2E Ee[^_ÉU WVS}] 19s'vjSEPU҃u1]F9rܸe[^_ÐU WVSuu u1=HotEP{Ex}@u}LSE0WeE)ރP#9 t$=Hot EP;E)1u } tUt]E PVS ރ>u}~u~u ~ >ub~u9Ft(>uF~u@~u:~ t49F t# EE U1Iv=`7u1ۿ$]v<8tURURU RV8ЃuC~1e[^_ÉUuÐU,WVSEE}u1E8t8ЍPMYt*;t%8tǰE;u܃UMTEH MeXtvEuEE‹ETREuE 1*uU:t*M12V ƃ vUEEMAUZtKE;t?8t/MAU4E3Vƃ;u‹UBMBtUBMAB A qZtAEtE;t.UBM4EEp 3V u;uҋUBMEe[^_ÍvU(UE MEAQu A  A EAEEEuQUWVS}u E w} u EgE쉅$UuU $EB1Dž(vE (uEXtV Q;tLU v1F9} 43zu9u  G ;u((~EUB U ;B t$@@ !vUB$BUB $B l$P1Dž(vE (uEXE (uE@ $;B u5;lF;u;tz,lT 8ǂ,ǂ0fǂ4jhD9 PF;uv((lu$P*$UR E P$[^_UVS]u tP{uHjZt/@@@ @VSP 1e[^ÐUM쐋U :~*}<}ЋE}EЉ}F9|EE9E|E[^_ÍvUVSu1ۋFJ=Jt:Jt @8t:u#uAt 8tA8uAut;u1v[^ÉUh$hOd…u EÐU|WVSE URu 1vDžM;􍅬Pǃ􍅬PURQuDž9uEPSu E􍅬PZÃutt$t?QWtE!U QWE PDtUM TPW4u E 2vRWjtME U싅EEBE Bu B  B JEDžMQRƒEPRRr QhP>􋅘P%x[^_ÍvUlWVSEPu1C1􍅬P=ƒ}uEPRvEPREP{u}M 􍅬Pƒt{]UEC1 EFWƒuEECE C CEDžEPSÃ&PhP􋅠P#؍[^_ÉUU 1uu juXt uPÐU1}u#ju uXt uPÐU<WVSEUEE } t(}tv}Dž8 DžDUBЉUB%Dž`Dž փ ;1tU'PRVPURà P҃t;vU}t}uHӁ~UE)EDž  UBDžBDžDžw;kvRPVREPjà R҃ލF ;VǃV VÃ3;vUK3t ~v}t }DRhPVREP{à P҃;ӁN);"PRE} hWVPUR}à W;;nbPRh);}7 t"n^RPlRPVREPyà REEERE0PlumU;Z ueu+E)=`7ro r_SPV)ރ;tU#vu~;s t{E8u?};B:URP#UUEU E1[^_ÉULWVSDžDžDžDžE uaDž}?t?.uG?uDž;}v.ЉEP ǃ<hPvjW ~v~uU}uUUR]SvURPP t*URSURPP 6_Dž9hWvjjUR ~p~uU}uUUR]SvURPW t*EPSURPP 6fUu=| }obDžDž=AhWvj0UR ~p~uU}uUUR]SvURPW t*EPSURPP 6`.y8=Ut t2*u#!vu u8t u @hWvjjUR7 ~p~uU}uUUR]SvURPWy t*EPS-URPP 6fu-tU=vtU& Et U1[^_ÐUU t>t Gt>EE@E EE@EE@uPuXÉU,WVS}uUf=u }M}1EEEU U1E|}9}3Z؃A.A%A.AFO;u |ԡkoAcv fÍf0A v]fӍfЍ(ˆfЍЍf0AfӍЍf(€0A.AFO;u /ssBABAB A hPj jPBƃ TEP]Sj PVP` t9UUM MEUDžMQS1[^_ÍvUu |}t ÉU% ÐU WVS}u =]5]5K>>Åt9{utVs uك=uW>]]؍e[^_ÐU WVS} ]ufu u <tSWEPhhPjjjSWEPjÃ0%t h˶uEPSPÃ}'t h艶Fu Ffuwt!F%PFPhҤ=Fw-$" v؍[^_ÍvUWVSEEEEEu6 u v'r1E8t 8.uG@8u1;Ev x.؅u3URt URURURU RPE9r5EPUREPU RjEPY CUEu=|1۾=vEPUREPU R6EP q8=t t%"uEUBuECuC>ty}u/u @u"EPUREPU RjEPL=}tU'v}t}t e[^_ÍvUWVS]u uu t%EPEPuPSh 5 uF߰ЍpTNx <.uVSSYZvR߰҉ЍD=~5VShDPuuEPEPP[^_ÉU WVS]vhJ>phVP虸ǃUjWYE!vRvl4%@uF>ù>SP(\FvR l4%@uҀ>^~t4vR@vl4%@uC;u;hVh7WW 7.vWhP߷W 1[^_ÐUU h%PRuÐUWVSu}}t}w} mv=Hot VzEVo~0tF@9F0tv0SF0FF^ }v(\}taEPEPV$ Ãu E }} uZWE uDE;}t}WE } u f^ FFCFFZˀ;}t}uf^ E F~t tF؉Fv~ vF=Hot VuyEe[^_ÐUlWVS}$u(uOu 8t EPURE PURh`蒮  GG}ffE$gG$gGg_ }Em} }tz}neEPEPVSU Ro D)ƃSEPSEPݷ UfB} }EPEPVSUR ÃSj 脷SEPs SjJSjTUfB E 9|vCSEP SEP SjSEP }tEPURS ]UfB )e[^_UWVSDžDžDžDž=u =u u f=u f5fjhh=% ohƃhVh5Dž=t|=sa= tXv> t> uDž%vt0DžDžF>t%=s > uF>t> t > t> uhh(;#jhRV t  T t  u F> t> t>&> hVh(hhTƃ tDžjhQV+ t   t  u F> t> t>f> ]hVhhj hƃ t5Dž=t[=sE> t> uDžvt0DžF>t=rF>t > t> uDžj hPT t   t  u F> t> t>> >t8vRvl4%@FC;uȍ1DžDžj5hj S+-PPSV zzw"rrP1 󫋕zw#rrP:.DDD jh¥PR; t  % XF> t> t>B> 9>;01vRvl4%@u(F>t"Phu >;t>}PW蚼Ph4F/vR$vl4%@uF>t >;t>}PWt"􋝌Qǂ:PWjJ ǂ    F/vRvl4%@uF>t >;t>}‹&t/u+Wq,ƒ SWjdt|*1vy ٸCGv Ivjh˥ROu) t  uhӥPQhP賩(~ %􋍠Q^=uChS u(j.SƃtFPhu5ft $hإƃthV 1h[^_U WVS}u *VSh{vC; t; tjh"SMuRCP:*$% Ph)Dvjh6SMu5uVWh@͠ ha趠BjhkS‹E8tЋ]ÐU|$WVS}1EDžUU }t }t}MAЉADž U fc􋍠QPRQEP à .􋕨Rs\}t}t }u?Ӂى)UDžDž69$􋕠RQPRMQà  􋅨P脗􋕰Rؘ􋍰Q輘ƃ 􋅰P衘Ã}t}t }hVRQEPHà |:V躖t*;~ PR>؉)q}ut7tIU9u能t QP7uuuuuu*װ‰)}u󥃽u E vEu&RPEPAut%xtRtzu v'vu~9s tIuEPuURyvQuEP^Ev1x[^_ÐU`WS]1󫍽󫍽󫍽C t}nDžDžDžDžDžDžPDžDž"DžDžDžPu } vSP tGt tut)SP@tGu$mu E1[_ÐU< WVSEPh PLƃu1MfŐ>#thpVY3ÃthsV?3ÃtDžCt;kv; t; uCCvރuhsS2ÃtCVU R3t;u}uEPEPjPt0UtQSR[uы[^_U,WVS} E]hFhv(ƃu QCtt[t{uEPWVu҃Ve}tUE1ve[^_ÍvUt8tF8u 1EEF89~ulWƒtZFM4REPCu ELUt6sRBE؃u,[t{uE܋FM܃<uUE1}t ucE؍e[^_UWVSDžDžuju -v] sfC{hPjjjs sEPjƒ0WPRP9ƒ|Fu FfuFF%S^uaw4$v" v[^_ÍvUWVSE @EEEEuu @1E8t 8.uG@8u1;Ev x.؅u'URtU RPSE9r(E PjUR5EEu=|1۾=tzvU R6EP?8=t t%"uEUBuECuC>tt}u#u @uE PjURH9}t E$}t}t e[^_ÍvUWVS]u uu uH߰ЍpwVt!N<.uVSSyZvR߰҉ЍD=v*VShPuP[^_ÐUE EUB EjjEPujRt1ÐU WVS}ƅuKvV;~tWstՃ{uV=1e[^_ÉU WVS}u \ÅtJ؃;t/v98u PvBAuS)8uԃS=1e[^_ÉULWVSEEEEEEEEEEEjjEPjjEP~ }1vu)E؃uẼ]PE{jjEPEPjEP UUUԋM؉M9 vEЉEȀxxEĉB MUʋE܉D]ȃ`U#BtQ߃u5{u/SMM܍CRPQyCE܋M̋EE܃?t H \uEU;]uF]PÃtq]PMQSEP跲] UEЋM9ME<U܍:P胱Ãu":+nv: ^vMQPEPr]1;u}%MMMDЋMDF;u|ދUMD}tEP}tURֱ}t MQEe[^_ÉUu裱ÐU WVS}=]E ]5Wv6W-t&^;t:3Wt ;u} t!E Pv t ƅu=u]]e[^_ÐU WS5]]%PhhPC]] =]uh]6PP߰HPSh5]4 tFu;PP߰HPSh5]U4 t19hȪhuc 躯[_ÍvU WS=]uh]55]5]hΪhS]] PP߰HPSh5]h3 u9hȪhu| Ӯ1[_UVS=]uh]5t1=]uW=]t5]tEPEPh;h]h5]5ƃ uS]Wv]EPEPh;h]5;Sh5]q6ƃ St]10uuhȪhu] u跭e[^ÍvU=]uhԪh֪]5]xE ÍvU=]t5] ]ÐUVS=]th;Rt ;=]uhԪh֪%]t!5]hh;ƃu1e>+u[j=tJ=]th;'=]th; h;P>#nhVQ"ÃS5?hV-"ƃ/F> t> thV"ÃCV%????ƃhS!ÃtBCt<;t7; t/; t*h@svhS~!ÃtCu?e[^ÐUj juÐUWVSuEFӁvRњ l4%@uҀ-u E+uF}t}u0u>xt>Xu ^E}uE 0uEE}tEE1uEU1EÉ©=wu`%1tnӁvRvl4%ۉځvS踙vl4%tCC;E}=}| ;}wu;E~ EE}NJF€&}}}tG1" v}t߃} tE}tFU e[^_ÐUSMlD H }'B+v1;}; | ;J~@;|[ÐU WVS}1=]t4]Wu ]vF<]u1e[^_ÍvUWVS1h2h4zl@p@t@#hCV~Ãtz;ttqvR贗vl4%tSl@tGhCVÃt;tt~PhP@zt $l@P^[^_ÐUS]u`u 1( tjSu jS]ÐU WVS} 11=^uZ.Sl@t$rt t(819WEPWEPsWEPÃFt؍e[^_ÍvU WVS}11=^uf_l@t(rt t0D1EWE PEP&WE PEPGWE PEPwÃFt؍e[^_ÍvUS]SySP]ÍvUdÐUWVS}u11Ɖ@M A9uu1@ u։[^_ÐUWS]}t~-/= ^u'h ^z+t1jEPEP߰HPSu 5 ^ ) t1$uh@u=e@Eu肤] j uÃthJukC@EE`Eu¡@@@ C; t; t@D@ǃhJSÃtACt;;t6; t.; t)HEshJSÃtCu@e[_ÐUu hMu'ÐUEuhZ0΅PÐU=^uhghiWu^5^nnE^U=^t!=^u5^^ÉUVS=^u/hghit^u15^hh`F@uƃu1l>#tǃhtVUÃthwV;ÃtChdJVjʁ~UvhdJVj褁Q t$hdJhdJ趀 vtJdJxJEtJEEvC; t; tEEEƃhwS]ÃtACt;;t6; t.; t)HFshwS"ÃtCuEe[^ÍvU WVS}j#^;tW3t-;uƅtE 9FuW6ue[^_ÉU WVS} ujÅt9suWEPC0u~؍e[^_UStS(u uk>(]ÍvULWVSDžEKUU } t% }t$}Dž8 DžDUBЉUB%DžKDž փ ;VPUR0sà ҃kt;[}t }u?vӁ,K)‰UDž@K@KKDžJJ KDžDž;vVPUR rà 9҃ލF ;6VsǃVs }uuVsvV|sÃ3;3t}t }KhWVREP qà 8W҃!;=Ӂ);P賞Kv} hWVREPpà |BWqt2;N;~vP)v;}tOWPEPPjPURhj%3 0wv t#Sv BPtURVPURnà !ott;uK+KsӁ~gv)Sv5Kt%5Khj% ރ"v;Ktu'Kǰ))Љ=krShKr,ij#hRSV_Y)ރ;t)Wh@zu~;s Pt&~}uPhJ=KuM};iaURGK) tPPhKvK 1[^_ÐUEtuKKvKKPuu u-ÍvUWVS]u u4u #tt(/5KKj.S6uSʯƒt=wu`%v1 ڀ;{.hkSVu2hShK{ODžODžKKKK@K@KJkJ KJ tPPRtK=wu`%1u:.uB:uӀz. =wv`$%v1tj:S}u ;:ڀ;{.hkSVthShKyODžODžKKKK@K@KJkJ KJ=wv`$%1u ::t:.uB:u΀z.,hVWjSԩ |%WSPV*Ph`1[^_ÐU WVS}uײu1}uI} uCj hxW@}tj hW)}uE EE }t }t vW/v;E tB1wv}t }t0vPGPGPGPhP腞 P>%P>$%PhSRÃNy֡C ;vhPj jP荦ƃ } VhvVh1vj PVPÃu1qECE C PhkEPVRJkJ}u) t hkhkvpCC ؍[^_ÐU\WVSEM1E 9E}vЉU1;us:#9t(лvF9s#9uEf4x}u~ Dx9}}G;} |}t\] 9]}TvuNx@Mv6u f; ~& f f< ED]TNyEE 9E|[^_ÉUu 萯t}t ÐU%藱ÐUVSu];s~s~Vu 303)s1e[^ÉUEPu uÉUL WVS]u tSh j#ك(^fu $^BjjhxPjR[ǃ  PsShFW$ PQPhKW# ^ tWKyꋅ+P= ^u ^t5 ^hRW#^t"PhUW#= ^thZWf#h]V@jjhxPjPyZà uMW践<%u(~mu"FSRvsP_vSP_FuSjn_SYƅ uVW%W3+ ^ tT)‰Ћ)‰Dž`DžjPj轚=kuj^ P5 ^ jPW5^`jRW5^`}v^tmjjhbƃ|Sj>W u@))‰SDžoDžjPVۙ V[^_U=^t5^ߕ^kÐUVS=^u/jjj^jjP =^=kEjEjhhru]S}pjjV5^H %kuPjhhSEpjjV5^ %ku5^ߔ^x[^ÍvUEUt ^E ^tu$^^tkÍvU5^h^kÉUU(^t(^ÐU WVS]u EFt7ЍxCu1:EuWVS\uK؍e[^_ÐUWVSE} " Btpv9u Bu@u1[^_ÐU WVS]} vRmƃl44GvRml49u Cu1QvRlmÃl4Wv RBm l4)É؍e[^_ÍvU WVS}]E EvvRlƃl44EEvRl l49tWvRlà l4EPv Rkll4)ÉCtOB1e[^_$FreeBSD: src/lib/libc/i386/string/strncmp.S,v 1.6 1999/08/27 23:59:35 peter Exp $SD$L$ T$@AJt}tm8ui@AJtnt^8uZ@AJt_tO8uK@AJtPt@8u<@AJtAt18u-@AJt2t"8u@AJt#t8u@AJtt8t )[1[$FreeBSD: src/lib/libc/i386/string/index.S,v 1.5 1999/08/27 23:59:30 peter Exp $vSD$L$ 8t@u1[ÐUVSuU ]u CFl vCB3hs] sOSFNpe[^UVSuFltXPjV؃ue[^ÐU WVSEpl1EPjt(E;F|^VWEP3܍vvՐe[^_U WVSu}~pt V~p~=1ɋFltv9P}P@uAVKjFÃu ^ktPE0Cu3-7Cu$j3؄ S̄PjRiCUCS PsEp=E 7sw*EFlC^lFpe[^_ÉU WVS]} uSM[ltOv3Wu;CuPsvn[utC UCBv1e[^_ÉUEtt.tt 1)! PhChl聏lÉUWVSDžDžDžj/u luǃ=4^tB9=4^t:5t&~`t VIVރu=4^} t E }t}u 56tFPusuu4jt薁ƃjtVmF\FhDžPPv\tu f;FdtM~\W}Ã~`tF`PPBЃFhF`WS0Sߋ ~hG~`t F`PPBF`F\juh^hnhS jSÃjS 8#DžDž jPS͎Nj9tSӊVhjFHPFIFHFLfFJfFXS芊,S{Fh@0~`t F`PPBF`F\jS$ƅDžjjPjhS/à u:=`=` =h=hw>)f=vCS@o0^0^DžKRPPh<URhjSЉǃ tECS@Fh uhhntOCS@Fh0^0^BPRcvCS@ЃjFHPjFIfFJFLfFX FhjAuFPc~`50^0^DžF\h hF\PRPjhFHPyF` uhӮN'Fhvjjv\=uh|IDžS^Sv\Tƅ PSv\ufFd/vF`PPBЃt V} $t 5} tU 21h[^_ÉUWVSuE~`tuEPEPv\xt}u Ef;Fdt8^\SǃF`PPBЃ SWWU F`PPBЃF`F\FhVe[^_UjuÍvU WVS}1tHCPW诜u,St S{ ދue[^_UEU@PyMU2Puj;MM1EPEPt v0^UEj ]SRE@`HE؋URPSh$EPhjEp`ЉÃ0t)hEp`v"uC cvu ÃuOEU@PxMU2Pux:MM EPEPuuEPh$|؍e[^_ÉUS]=luhhl1^t l1]ÍvU6.& ÐUS]=luEPutlhl't1hl']ÐUU hBPRuxt 1U,WVSjEPEEUREP\u!URhHqE 1*}u"URhHqqE vUUtvE@PSmǃuWu.E8 E@P+mÃuSu.E EPhHp5uSuWURЉƋUE 0WmSm 8vEPhHpU EPhHkpEU e[^_ÐULWVS} ]$1=muEmj DlEt"DdP!lƃu0hhn` KhD`FXjEPUfzu(jEPU REPzf[UfBE@<^pUFBF BFB FFEUFV F$F(~T^\m3m3E3ẺEEEE E܋UUjWvX^8SeEPS4i Fd~,uaMJ LPRAЃuF,F0PLPR abv~YMP PB ЃtA(Dž(@P(Pb(F,E9t WeF,[^_UEM PB,B0AB4AÐUEM @P8@8uRUÍvUSE]HE Ha$ATAH:A$CA(0"A$Q(S ACA AQ SAA CACAC vAXQXHtsAX@ht^QXBSvtFAX@ ;vt.QXB #vEEPS1}1]ÉUVSu^{t 3lS^u~tuE0jcvFP^LS@ЉFHFPxt S@ЃhhVuuFLPISGT^w G  t V{`t Wk`1e[^_ÐULWVSEXsLS0UE{u E U$CS E}u } u}$tEC$U ẼVsHC0PVB ЃtDFU RV@Ѓt-UP VPBЃtEPVU҃u{$uC$jVVlEPVVuC$Hv}u 18v} u}$uC$vE܋GEGEEEVuUEPV[u{$tvU9UuC$PEP\{$ukEJ EPRAЃuC$C(#vuVU҃u {$uC$}t8EPVY#mrUP PB ЃC$e[^_ÍvUEM PB$B(AB,AÐUEM @PL@LuRUÍvUEMPE H&$ BB BAB BBR QBBABAB A vB0vtvHB0teB@]tRB@Jt>B<6t*B<"EEPQ2>}1ÐUVSu^{t 36fSPztCLPBЃS\V\e[^ÉUWVS}u 1nvEB=~=Z SZƃu 1SjVt_uhVwjxP/MAQ PT`} PTptpPjjV@P?H ]LjhPhx)‰`l|)ȉC}`C@B`}W)‰XXCO )ȉB} XB@BX\PTP| uTu DžHHt-Hu\E9t V$Z}G$_8E9t VYE@$LP(SMQu }7cEtu-G(6G$EUB(B$E([^_ÉU WVS} u~=VWE0]cÃuUB(B$v)߅ċEe[^_ÐU=muhXmmUWVSuEÅu 1vVEPVBЃu.Pu hhS6߰Ѝ\@}E$vu >Ph+U)PS{uƃhɳSd߰Ѝ\ tVhҳvuhvuuhScuuhScEƀ ƀEe[^_ÍvUu uPhҳhnÍvUEv  dÍvUuPhҳhnXÉUVSuÅu 1v` tuM5dx5h<P5`TPVhhS[$5`+PVhŶhS5ƃ ƃ؍e[^ÉUu4PhҳhnxÉUEv1жÐUu uÉUWVSu uMDž|u|PVEP^|jEPYv^u+DžlDžhDžpDž|Et.%Džl)DžhDžpDž|~^|fukDžxxPtPhPlPEPbà jpPhPlPEPà |||VEPÃfu]8t)jtPhPlPEP^ E9t"|PVEP1}8؍H[^_ÐU VSmu$j@jÃu 1m{<ux K PS@C SCC l^ujjC(PVfMSVPO C PV@OFV@ЉC:u~/t>/tj.V:t1u ķ%>:uF>/ЉDžӷװ҉PS-ThS: VS:j.V7: t DžtjVKjVvÃEPSE%f=hPS[ƃSZ RQ Sk} PWG RBGQ0G ?2KA4*r 2 ;GtU ;Jt)É؉)} WG@BG 91E ;p}+Ã􋕄RIFM ;q|1] ;s}0ځM ;A5F;q|1i} L􋅄PC{C;G F] ;s|1} ;w }$LF] ;s |} Ƅ>L1;7}GE L􋕄R+􋍄QC F] ;3|1BM Lt"B z vavB F} ;w|1E ;p}BM LtBzv BF} ;w|1h[^_ÍvUMAtƒЃ v,t -t+u߉ÍvUVS]ut= Ѓ w01҉TP9C Ѓ v;U| E 1[^ÉUS] hjEPut[U)9:uLAj;jEPQ\t(E+E9:u!AjQщU)Ѝ9Eu)Ѝ9Eu`)EE}2;VNE1ۋM ;Y}OPu L*C} ;_}$;8Puߋ8L؉EE1ۋE ;X}SU Pt L+vCM ;Y}$ PtߋL؉E1ۋ} ;_}E PEu UЉUMԉMv}; }9};E \u#1tXu E+EE+EM Lڋ}<8tUvUCE ;X|MًU LǂPǂT}߉`ǂdE@h8EU BBMىLǂPǂTE@} G }t UċMDG }  /] LEPURS")]C}tMQ}WS)E1e[^_US]Sh<tjSh]U=|5hmjthmHÉUWShsEÃu =~Shc߰H=%tShUE;u=mm,u4uhh,E?hmSt,;:tjhmSthm:e[_ÍvU WVSE}Em~t;F}1ҍP<t6B;V|1,;V}E;F|NvB;V};}2LWV3EP6SW CL^G(e[^_UVS]u 5VjS=e[^US]hjS]ÍvUVSu ]=uhJShVut C(^ vC( e[^ÉUhjuÐUS] Sjuh؋]ÐUhu uGU,WVSU1E IuP}썲LL};EuUB};D~E}tW~SA2@93u5u2B93u)E~!I:@9;u 2@93t؋EXIUU E.‰)ЉEU))E )yMQx vEQų )‹uV)))ЉF))EM$I)))ȉF}FEEM)Ћ}Dž}O+]؍؍؍G}GwuQ։U)))4EHyEEHEQmӉU)))))E}}E1ۋMu>QщU)Ѝ9Eu)Ѝ9Eu`M; }ǔu~NF;|MA)EAAu;4}E@}G G U W$[^_ÉUuPU8u EPuaPÉUSEM  9%1[ÐU WVS] M;| 3 Й։)Vue[^_ÉUSUM AZ)É؅u@AZ)É؅u2A Z )É؅u$AZ)É؅uAZ)É؅u)‰[ÐUWVSE}ԋu jMALؙ]u!!jVSqMуu E@UBz0t"Ѓ@9B0tr0/MA0E` ߋ})tPUu(U9zr :)z=HoMQEPPu$URE URPUrMуu"u=Hot EPXSUz0t"Ѓ@9B0tr0.MA0UBBb ߃=Hot R1x[^_ÐU WSE] EǰHEUBUE=Hot SEPSMǃ=Hot Se[_ÐUVSu] =Hot S@KyC;C|< tSV,ƃ=Hot Se[^ÐUVSEPu Tƃt+Åt huu趝} fC 1D7;Es5^SMQW']߃@;}v#}t Eӫ(+E e[^_ÍvUShPuu u=à t$uuPtÍvUShSuCtuuuu SÍvUVSu] 9s!@tсt t@9w1迪([^UEރ:w$v1UE߃]%ÉUUBvB ÍvUWVSEEU9EEU2u%t =thzUE9t.vUPEvǃPFg 9uTKuՋE8u=>uE+E \U:u(2؃? Ћu 藩(*vFXEE9E4ke[^_US] jEPu1C@ ~CCjSEPg]ÉU WVSEu }xu]x uW@@ X;tA)B9} &)63X;ue[^_ÐUEM UttRQ"RQW/ÉUWVS}EEuEeShԹvƒt1ԹB=wW}u/E}FE.u7}t1}t+FEGu}~UE v1e[^_ÉU,WVS]ECCC mEE8:uEU::s}}EE7vV߹W}uVWgt e) E܁}Ey:uGEE}u}]XC;EECU܈CEE-.s;uS}W**E0E+}t C;Ev ovECU܈C}t,+u9M)ى)ڋ}::C9~];]u"EU EBEBEB 1e[^_ÐU WVSD߾fjSEPj؍e[^_ÐUEPuuEÍvUWVS]1WjEPSj;8"tM9]tHE4]tM<.u t0GC6v Rx  l4%@u1v1vtt&tIwʁ}wEpvw}w}wEUCw}y}l}_EU ЋU ƃ} tU e[^_USMl< @ }'B+v1;}; | ;J~@;|[ÐUS]jEP} tEE]ÐUE EUBEjjEPujR=<t1Ð+&v̀rÐUVSuUt$] CAuJtvAJuvJu[^ÐUWVS} u]tVtACtJuutAu)H[^_ÐUxt>Xu ^E}uE 0uE1uEU1EÉ©=wu`%1tnӁvRTvl4%ۉځvS vl4%tCC;E}=}| ;}wu;E~ EE}NJF€&}}*" }t߃} tE}tFU e[^_Ð$FreeBSD: src/lib/libc/i386/string/strchr.S,v 1.5 1999/08/27 23:59:33 peter Exp $SD$L$ 8t@u1[Ð$FreeBSD: src/lib/libc/i386/string/strcat.S,v 1.5 1999/08/27 23:59:33 peter Exp $W|$T$ W1OtLBAtBBAt8BAt.BAt$BAtBAtBAuX_Ð$FreeBSD: src/lib/libc/i386/string/bcmp.S,v 1.5 1999/08/27 23:59:29 peter Exp $WV|$ t$1L$u L$t@^_ÐUu ut1Uu ut1Uj@u u t v1Uj@u u^ t v1Uj@u u6 t v1UE hPPut 1UE hPPut 1UVSu] SVtACPV,t-CPV tC PV,t1e[^ÍvUVSu] SVt-CPVtCPVt1e[^ÍvUVSu] SVTtCPVht1e[^ÍvUVSu] SVtACPVt-CPVtCPVt1e[^ÍvUVSu] SV\tCPV4t1e[^ÍvUVSu] SVt-CPVtC PVt1e[^ÍvUVSu] SVtCPVDt1e[^ÍvUVSu] SV|tCPVt1e[^ÍvUVSu] SVttuCPVu1e[^UVSu] SVPtCPVt1e[^ÍvUVSu] SVthjCPVt1e[^ÍvUVSu] SV`thjCPVt1e[^ÍvUu ut1UVSu] SVXtCPVt1e[^ÍvUu ut1UVSu] jSV~tjCPVht1e[^ÍvUVSu] SV|t.tu"CPVCPVou1ve[^UVSu] SV,t-CPV,tC PV t1e[^ÍvUu ult1Uu uHt1UVSu] SVtJt"wt :t#2CPVCPVCPVu1ve[^UVSu] SVHtJt"wt :t#2CPV'CPV[CPVu1ve[^U WVS}uE uSt uGjV# ËU uhhn1u_SVatNCPVu t:CPV9t&C PV%tCPVv1e[^ÍvUUE w:$Ⱥv8 0 ( @PÉUUE tu@PÉUVSu] Ftt"0~u fSv4Sv FCtwt ( t!FCFFC FCF Ce[^ÐUVSu] CCC t{uSuLC);S|SNu+1KB;St C t uS te[^ÐUSE] MUtt!RQS) vRQS}v蓈/1]ÉUWVSU} ]BPBPBPPhuV 9wVWm31e[^_ÍvUlWVS}1EEEUUME<M)ȹ)ȍ M E}~E]EEU<uu Ӿ Ft}t;u~]uE}~t}t;u~]u}t }E]E}t&M9M|E9E}9E:C}t:C}u\}uV}t}uJ}uAEЉ)¸.)PSE P:߰Ѝ\*EU4hS ÃE}?}tEEu:CCUЉ);EwRM QqE 71e[^_Ð$FreeBSD: src/lib/libc/i386/string/strcpy.S,v 1.5 1999/08/27 23:59:34 peter Exp $L$T$QtLBAtBBAt8BAt.BAt$BAtBAtBAuXU(UEu EPÉUÉUSM] t$r t5;vEQEPQB#AURQЅt E1]ÐUSM] t$r t5;vEQEPQB#AURQЅt E1]ÐUUM trt"(BQR@BQR 1UUM trt"(BQR@BQR 1USM] t$r t5;vEQEPQB#AURQЅt E1]ÐUSM] t$r t5;vEQEPQB#AURQЅt E1]ÐUVS]u tGrvFEUBCRS@Ѓt^CURS@NCURSЃt6CURSЅt#E1҉Ӊ1ɋE1 Ӊ^1e[^ÍvUVS]u tGrvFEUBCRS@Ѓt^CURS@NCURSЃt6CURSЅt#E1҉Ӊ1ɋE1 Ӊ^1e[^ÍvUSM] t$r t6;vEQEPQB"AURQЅt Ef1]ÐUSM] t$r t6;vEQEPQB"AURQЅt Ef1]ÐUSM] t$r t6;vEQEPQB"AURQЅt Ef1]ÐUSM] t$r t6;vEQEPQB"AURQЅt Ef1]ÐUS] EEPut E1]ÐUS] EEPut E1]ÐUSM] t,r tFKv;%EQEPQB*AURQЅt}%1]ÐUu uÉUVSuM UӃt )؉Ã>u.FRQV@ЃtRtUFShXV@F>u/FRQV@ Ѓtt"FSh8`V@ >t1ve[^U WVS}uE VW6;uv?uwt rFtQgvu[u,VËE uhhn)VSWvtSE 1e[^_ÉUE hPPu-ÍvU WVSu} ]WVLt{t9t{u}u1$jEPVCvjURVUҍe[^_ÐU WVSuE t u߰HEEPV;E9Ew|UBt rBtNhtZu,RËE uh hn苉5EuSV\ SOE v1e[^_ÉUju u UhEfEfEEEEEEPu EP‹EUE@(@,ll1ÐUEU} utl@0 tH ÉUM U}ttEtA vtÐUE9vMQSU҃ MQWU҃‹E} v؉E}uMMMEJv}&u]MNvu]MvCAN}}}E HEEEEmueE}uME}&u]vNvu]CANEE};}URWMуs|uqE}uEMMEH}&u]MNvu]MvCANU)UM)M;}EPURMуa;}wl}uMD}&uMvNvuMCANE}E)E}UUUE EE9E EEEЉ}ev}u+U Jv+E}%uvNvuCAN+};}vW+EPMуEEU9UiE EEEU+U+E9~Ѕ~E)ƒ}$]щNvƋ]ѐCANU+UE+E+E9vЅ~CU)ƒ}!ыNvƉщCAN+E;EvMQUR1uPMQE+E;EvU)‰U1uE e[^_UjuÍvUWVSEPEP$| E%f=@tsvjUR[DžEPS{E%f=@tmsjjjP<Ij .et DžU tBPSX{$%1ZDž1Dž1IRPةc)؋NjPSWRsƃ~)눉M ] tV􋅘PjURY u+q􋅌P}􋕜RnC Džv1;sDu:ft3WG)É9׃9t˃t F뵐h@jVRDž1;t_tPCPT t {u E tF<u􋝈SH$vP0P+x x-CPC tBCe BE BR+ B3o􋅜P􋕘Rs o1h[^_U=hu5EUBEjjEPhhjRethÐUVS]sSa 3Cs SSF Ve[^ÐULWVS}wo]} QEEuUЉUE EPbEԃu EEЃUREPU REPURE EEԉEEE E~EЉE؃$EċUԉỦ׋E9CvẼ$E̋U؉U+EEЉE܉EE9Et Ẽ$E̋E+EEЉE؋U9UX9EvEPURU҃EEuU܉UEEEuU؉UE}uC E}t/u;uVEPU҃;E]yvEEE;SURU҃;E]E9EEދU҉UE0;]r]+]9vSURU҃;E~ދU29EvqvE)1uE0SEPU҃;E]ދU29Ew/}U2SEPU҃;E]ދE9EwҋuUUE9EuY}t/vUE9ur퐋UEEuzUEG9urUEGMuV}t.UE9ur퐋UEEu"UEG9urUEGMuE9Es U9UE9Es8}tUEE9ErSUEGE9Er>vU9Us3}tUEE9ErUEGE9ErE؋UĉE؃EĀeU9U}ЋEԉEЉ}ԋE EEȉ$U9rE9Eu!E EPUREP~oUЉUԃEPA1e[^_ÍvUWVSEE}w1URMQEPURE $UUU v]MQEPSU)ډ]S]+EM D$UUʉMuU2PVMу ЉU;u{M<1 v};}s"U:PWMу%;EtӃJUM1+EE E}~E0F BKu+uu9rv}U<2;}seW+]SMу%;Et:U+EE E}~ڐ]F BKu+U9r};}r}~ +U]F BKu+U9r;urV+EPU҃~U+EUEEE Eu;ue[^_ÍvUWVSEEEU JUtG}vuvCANu+};}v+]WSU҃͋EEMue[^_Ð$FreeBSD: src/lib/libc/i386/string/strcmp.S,v 1.5 1999/08/27 23:59:33 peter Exp $D$T$@BtX8 uT@BtL8 uH@Bt@8 u<@Bt48 u0@Bt(8 u$@Bt8 u@Bt8 u @Bt8 t)ÐUVS]u EUM;tuQRPVSnvtf{u5t:wf t4jh@Pbk"t:w~f qu1fSwI$`c ,  fe[^ÐUu uhÐU WVS}jvÅt85sGCGC {e[^_ÍvU WVSuU Ѓvߋt]9SutTC ;FuC;Ft7jCRP6$CFFF;C }VwuSe[^_ÍvU WVS}1t!9zuRWӋ݉F~e[^_ÐUVS]C;C| CuUC{u!CuCPss 3C~'CK ufytASJs)։9~1AC9tyuCuȍe[^ÍvU WVS]c0cSAc8tuc4c0t} Bt U E M1e[^_ÐU WVS}= u EPu &ƃt5jjWh,Ã|ڃtE9tc1?tfp Et uH fx@@$@,@(X@ e[^_ÐUE URPjujhUS]SEt K]ÐUUB f t1 RÐUS]=u<CC C uMC ub vC t&Sc CCK 6{0t.C@9C0ts0WC0Ct36)KC =~OZ_v~tFC4~t F ~tFE~t~t ~uFCMQSu1e[^_ÉUVS]E H{4@}P%)SDAK C$jP @PSO t QVS0S(uC,K@C<Й{@P(;C~CPS e[^ÉU WVS}E4jW-t XEtN04_uу?Wt}u uXE1;}*8<0t40C;|܃tW}u1XUe[^_ÐUSE} tW?tX4t+jjS,uӃSuǃ01]ÉU WVS}4aGj h ЉG@SW0 jjjV)ut6hSVt=t"VOV,Bv1ۍ8<2t"jjXP42WK uC~1[^_ÉUSEX}uuu jS gVǃ,]ÐUSEUXt$t.Vǃ,GvuVǃ,vuu uPSl]ÍvUSEX}vUǃ,/tju jS"Uǃ,]ÐU,WVSEp URUM MjjRQPmPEP&EuUUXMMIEXUE9U.vf{v5)9EuuMy׋MHsEf{uAjEPPUR&EX MEEp f{URMQEPURMQTE EEEPURTfju%PMQl%E~XEEUr E9E} w/} r)URMQEPURHD E`;Ub,v} r,} t} vMavEXUf|SwjMQRPEPCTUDSMAMECDK)‹MQEPURMQh=uEPURMQEP\CtXUbSMQEPUR$=t02vMaE` Ub1e[^_ÍvU WVSEUpt*t%t Rdž,$|udž$dž(dž 1 u^$ Cdž(;^(w#jjSV#ƒt zf?t͉$;^(~dž$A x(f|GuA=C=A>CEA?A@EUBA@BAABABEAC1ҍyD]vECDDCDECDFEDGVfEEQEQB~[^_ÐUWVSu1Lhhxt#x=x~ttth Džt|uDž|Dj}uEj}uNLECDž|DjDžlDžhLUDžtEjDžx}t }h$à 1ǃEǃ|Eǃj$訾Ɖso1 󫋅L9t ^F/F DF d'F 'F>F_F0}tWE  tt uU RMQ*/-vE  jj0oEPNRE EjEPw'}b1u  EddBEBEBEdEE``BEBEBE`EE\\BEBEBE\EEXXBEBEBEXEETTBEBEBETEEPPBEBEBEPE}b1}U=EE_xE EEdxu0Ex=w Džxxv Džxhu  ǃǃ xlt*xI#ltlBl!‰lx9lsllO1Nj1tffw fǃWjI uSh+h(3SJStRM t!@E@t!}}"[vCvCOt7{tstS18[^_ÐU WVS}jj7RJƃt jVB8BEP7uIƃt|EP7^IÃte}u_CCfCfCC jVjV7K jS7K1e[^_ÍvU0VS1Iuh蝻Ã؅uPhĻhVB ]S EPSjHIV à t VhNjEPjI؍[^ÐUtt  1USEX{tjs3JC u v7A]ÐU WVSEX{tjs3\JC}t@}EPu S<ƃu[}uj63J@jPujjVSr?ǃ !@tj63ICe[^_ÐU|WVSEU } uRUӋEUBBCBCECCEUBCBCBCECCEUBCBC BC EC C EUBC BC BCECCfEECECCfEECECCfEC 1f;u.CEUUEEU܉U}֍ EfEEDSEDSU EUBBABAEAEUBBABAEAt?AE܋UBBABAE܈AE؊GGAGAE؈AfFf;uCQC @1f;u4CEUЉUẺEUȉU}ĉ֍ EfE֊E׈DSEֈDSU EЋUBBABAEЈAE̋UBBABAËAAtDEȋE@E@AE@AEȈAEĊGGAGAEĈAtDEUBBABAEAEUBBABAEAfFf;ux[^_ÉU|WVSEU } uRCfEC 1f;u0CEUUMMEE}ƋUB EUBBABAEAEUBBABAEAt?AEUBBABAEAEGGAGAEA֋MQfEEDSEDSfFf;uCQC @1f;u4CEUUMMEE}܉ƋUB EUBBABAEAEUBBABAEAAtDEE@E@AE@AEAE܊GGAGAE܈AtDE؍U؊BBABAE؈AEԍUԊBBABAEԈA֋MQfEҊEӈDSE҈DSfFf;uE̍ŮBBCBCËCCEȍUȊBCBCBCEȈCCEčUĊBCBC BC EĈC C EUBC BC BCECCfEECECCfEECECx[^_U$SMEUBBABAEAYAEUBABCBCECYAEUBABCBCECY A EUBA BCBCECYAEUBABCBCECYAEUBABCBCEC[U WVS}w~tjv60BFjW6B~tv8F Ft%dždžt%dždžV輯W賯 S蛹1҅tЍe[^_ÉUSEX{tjs3AC} t7C t11 tS"t3DAu ]U VSujj6w>ÃtZEb1EEEE %EjEPS;jS6?@1ve[^鷹v\̀rÐUdSMU Ӆt S}EfEfEMMUUPuEP2F…tEЋ]ÐUu jEPutUÐUjjEPuvtUÉUS]jjjSN1҅tډЋ]ÍvUS]jjjS&1҅tډЋ]ÍvUuÐUlWVSu} t}t5;tC;u+]]K9rzA;Xuotfgfff)Ѝ)щʀ0K;Xu>u33ONI)AGAAK;Xtȍ{} u }tMvK9vC;/uEPV</ E%f=@t4} tJhh VWU |AˍvaÍvK48tN}thV<tӍvEPV<t48%X;tK;]tF;Zu aCv=wu`%1^;zM1e[^_ÐUWVS}jEP1}t6  t-EPVE PW ÃujV70UB ËU ZFV)ЍS9s,EPSEPURE PVWD -LFf9Es E)RDFPP+fFMҍVF)fFfJ^U BUBËCU r2S+E XUr2S+G($ <uG;uEf9GrfGuZ~u,UFH9uALJUf"~u"f}uLJfLJjV7/} uUBP0W! 1e[^_U WVS]} j3 -ƃuǃvsfC E@ G$VN)ʃ9u?~u}S AH9unCPWS%ƒ|WtfC C f0Cxu;f{ u4CPWS%ƒfǃЋECǃjV3=.1e[^_ÐUVSEuX{tjs3 .C t$t tu SdsFFt vj63j+EtE@uCPEPSjFPujSƋUBuuRSt2-%Pu3-#u e[^UWVS}jE 07,EPEPWc 0U;EjV7{,EHvj37:*ƃSFH9jV7-,EG,9t1ۅumrYUFP\0f@jV7+jS7)ƃ t2fEmsjV7+jUR7f)ƃ u9v[Cf]UfPBU;FEU;jV7+EPEPW s0AjV7*EGuWEP) jWE0p(vESG9_SG9u0'vCPWE PEPƃtwf{uECfKftSE PEP+tGtLjWE0'}k1HvjWE0'.jWE0'WEP$e[^_ÍvU WVSVj6E0%ÃvfuESB<GtG PUR!ƃDCu];u fCUfCC SEPSURk"v7 C؃)RPP!fsUCuWEPEPEPQ]ScWEPEPEPVEP ƅ)ECFf9Es'%U)PЍDFPЍDFPfFEUԋB tgw t vfMVF)fFfJEB0WMQSVUԋCMVF)fFfJEB0}u M܋vEЉUԋE܊H CEЅuU܋PE܃ PSMA%q ]S f}tEDF0vEPTPEP U؋CMVF)fFfJEB0MQ UԋC vf}tEDF0vEPTPMACMVF)fFfJEB0UBC ov}M 9u9] }uuQS]vuuE PUR t}jMQ]3jEP3 E,U9tv1ۅvjuM1|ju]3j1ejEPU2QjMQ]3> juE0)juU2 MqƲe[^_ÐU WVSEPEPƃu 1qvMfFUfF] CFFC F {u:]] C9u#KfFEfU]3E蛇ǃujVU221v] GCGfGUfGC G {t?js2ÃuW"1pCjSU2u]SVWE PURà EWU R9u] W轇U EE0؍e[^_ÉUWVS}EPW?ƃtEPW)Ãu1jEEFCCFfCfFfCfFU B C F uuSVRW‹E0EЍe[^_ÉU WVS] }UfCfCC4G tGvW{FCfCfCC4E@ tBEP8UFfCc K jSE01e[^_ÍvU WVSu UMfFfFF0CF tuUBNj F)fFfFF0C7G PSGtbw MQ uKiEP‹ F)fFfFF0QRSkUC vfFf N jVM11e[^_UuPAwv36xF3C P66G GC }Ct.EPUREP PEPuM} u E!@tzC@U;Bv>:u PvC@PE0xuPUC@Bs PU2lCUBUUvCUB É1e[^_UVSuEfxuyuA u v1A t@QB@uv@QB@tX P UEt6PPEPSV t vEEPu Ѝe[^ÉUWVSu} W;VvVr:t)‰ACsGv)Ɖ[^_ÉUWVS}E P;WvWE r:tCAFsGU ;Bs@[^_ÐUWVS} ]ujWEPjGPEPE U;Es;>uuWtu65u |vEUEU> ߋFEjuE0ƃt];]v]SFPWjVU2|E)؉E u1e[^_ÍvUWVSE UMEUx MM]EPEPÃu ECCC fCfCu9vVURCP@}tMAjQE0 U)]jSM11e[^_ÍvUVSu] jSEPjSEP ju6ƒu \vB tjR6 Bvju6ƒt)]BERV9]w1e[^$NetBSD: bcopy.S,v 1.6 1996/11/12 00:50:06 jtc Exp $vVW|$ t$L$)9rL$D$ _^ONL$D$ _^ÐUMU BB jR1ÉUVS]u t9j3ƒtB  V3e[^ÐUlWVS} uEPW<uE%f=t1dh(jÃt[1ҐDDD B~E 1RPEЋURP؉e[^_USEU M] $[ÍvUS]uhhnsSgu1YQE AAHTQ9RuJH YCA 9u CHKA]ÍvU WVSU E;r-1v^CUvE PUR8ÃCHUL9 u CA CB9KtSK9IuYvXE9Cu C UB SC B E9C _S CBUSBC 9u UBXEXK URÃE U1jWVz99EsyU;t;OE CCE HULK9IuYvXECUBC 9u UBXEXtss$UЋCe[^_ÍvUE `UP1ÐUS]C9Xu @ C P@ B 9X u @vP @BQm 9uSm1]ÍvUVSu9t"vCtSV(t"[9u1҅tЍe[^ÍvUVSu; 9CCtSVCHL9 u CA CB9Kt;S9su C F vSC B 9s tS CBBvC8Ɖ[9iPkÅtCC1e[^ÍvU WVS} tE pp$ ЃU B1jVSw9u39u/E pv;u U b1e[^_ÍvUM AU‹9t 9Ht9u1Ðvv_̀rÐUVSu uVjÃt VS]؍e[^$FreeBSD: src/lib/libc/i386/string/bzero.S,v 1.5 1999/08/27 23:59:30 peter Exp $vWS|$ L$1~ڃ)Ӊك[_ÐUEPu uÐUS] {tSu&CC C1]ÉUlWVS}G $fEGfEGEċG,EԍEEEEEuu uVDÃ|VTtE@tO @؍[^_ÉUVSMEU] t txv w K0 }K%)щʀ0gfffK)Ѝ)щʀ0u=K$0u}t(<0t$K0Kȃu lv[^ÉU WVS]u MEUυwRURPQS t#vwu wOjj VS'0v(Ojj VS'0jj VS'É֍vOjj VS0jj VSÉ։ uOvO$0 u}t0?0t+O0%O؃ u jve[^_ÉULWVS=HotEPUB tzu5MQNt"=Hot EPvUB f uDfz|==Hot RMQE PURUDžM Dž$DžEuuEEDž  t%%t t%u⋝+ tLS ^]E}~EPMQuDžDžDžDžƅX$uƅ 뵍v1ۋ ƒЃ w\B BЃ v⋅ 8$$u)0$$PQE Pj$t$EUR AAv$t$EMIvƅ+z*1ۋ ƒЃ w!v\B BЃ v⋅ 8$uw$u)0$$PQE P$t$ vEUZ A5$t$EMY[DžL1ۋ&\BЋ ȃЃ vԉDž 1ۉ\BЋ ȃЃ vԃ$uC$0$$PRM QpxV@Jt 4&P $t$EMA>  tw$t*$H!EUBRt $uIf@t2$t$/EMI9$t$EMI} ƅ-  u Džu Džt@$t$(ݝVE Miݝ>$t$ݝEE@ݝt+ܝEuƅ-Dž  tDž   PRPPQP gt Gu=~9~Egue DžgeAQEP>  Vfu;~&u tW|9K@; |Njt%" + Guƅ-i tI$t$vEUBHtE$t$vEMAv@tE$t$vEMAf2$t$EUBv t[$t.$HvEUBRt9$t$EMI@tF$t!$[EEPAv$t$EE@$t$EMIDž߀Džx$t$ EMI u Dž ż|>Pj Rt+ ; Ѝx tZ$t-$HEUBRt9$t$EMI@tF$t!$[EEPAv$t$EE@ Dž̼ Dž t[$t.$HvEUBRt9$t$EMI@tF$t!$[EEPAv$t$EE@t& t t tƅ|M  tK u twQPR PQR =vu t1QPR PR + x1g P Pƅ9}tt9}+~ElFEE}~EPMQul^]E}~EPEPbutFEEtcƅ0ff FEE}~EPMQUu%=+~~~ClFEE}~EPEPpul^]E}~EPUR2u)~ElFEE}~EPMQ_ul^]E}~EPEP!uu ~}fe݅D@; |!uݼFE߼FEE}~EPMQsu K~DlFEE}~EPEP#ul^]E}EPURi߼FEE}~EPMQ'uۅ~FvlFEE}~EPEPSul^]E}~EPURu  F EY;   F EE}~EPMQ!u )Å~FvlFEE}~EPEPGul^]E}~EPUR uFEHv FEE}~EPMQu FEE}~EPURXu  )‰V )E $  @.FEE}~EPEP:u݅E@t?  JVEH EE}EPMQ K~ClFEE}~EPEPul^]E}~IEPUR) FEE}~EPEP/uUNME}~EPEPsu+~u~DlFEE}~EPMQul^]E}~EPEPu]}tEPMQu4Euy}tEPEPuEUB @t Dž=HotMQ`$t09$t$L[^_ÍvU,WVSEEUUEEE@M EE%uE1MEBX$H1ҋu TPFЃ v>$];]|EPEPS:EC;]~]]jEE*1ҋuvTPFЃ v>$u=];]|EPEPSEC;]~]]Fuv;]|EPEPSEC;]]BЃ MEBЃ v1ɉLBЋEEBЃ v$@t og;]|EPEPSEv t%;]|EPEPSE t(;]|EPEPSEv@t(;]|EPEPSZEWv;]|EPEPS2E/vt(;]|EPEPSEv;]|EPEPSE v t(;]|EPEPSE vt(;]|EPEPSzE wv@t(;]|EPEPSJEGv;]|EPEPS"Ev t%;]|EPEPSE t(;]|EPEPSEv@;]|EPEPSEv;]|EPEPSfEcv;]|EPEPS>E;v t%;]|EPEPS E t(;]|EPEPSEv@;]|EPEPSEv t$;]|EPEPSzE zt$;]|EPEPSNEN@t$;]|EPEPS"E";]|EPEPSEC;]&]}~UPEMU;M~Ewj$UE U NvUE U :vUE U &vUE U vUE U A;M~}tE9Et uEe[^_ÍvU WVSu }Eۃ?uSD7PEPI SVV)PjRHIe[^_ÉUWVS]M}u fu vetEuC]EuE]-vEPEPWSRu ugtGuEtK fu90uEE@t@ED@uU E0E9UrE$U)ʉȍe[^_ÉU<WVS}] Ew}G-wv+F ~AIgfff)Ѝ)Ӊڀ0à I09sAF9r 0F0F)[^_UWVS}E xG tuW*U U MrEG tavEEUrEtvPMQwG,ЉÃj])ދU B)؉BuNvG *M MEpEtG %Bf=BuB9ws=W)ӍOOPRGÉ_G t(9s~SEP7F)_xv;Gv-9v)SURPFW - }Dv_9r!SMQwG,ЉÃTSEP7F)_])ދU B)؉BEEuEM MEpEt}u1Vj UR!ƒt EH)‰UNMEU9vG_Ë;Gv'9~#SURPEW, uw>_9|SMQwG,ЉÃ~TӃSEP7E)_)]uW+u"E])ދU B)؉B1 O @e[^_ÐUEPEURPEU RP,EUÐUjEURPEU RPx,ÐUU1Bf%=uBu}tUE1ҋ@%=u }ЉÐUVSuu V@Ãu t V@؍e[^Ð$FreeBSD: src/lib/libc/i386/string/memchr.S,v 1.8 1999/08/27 23:59:31 peter Exp $W|$D$ L$uG_Ð1_Ð$NetBSD: bcopy.S,v 1.6 1996/11/12 00:50:06 jtc Exp $vVWt$ |$L$)9rL$_^ONL$_^ÐUVSu t $vP=‰rZBB Ѝe[^US]tK[ÍvU WVSuFE^1M ME ЉUȉG;}|ɅtRM;N|7F@PËFK V PRQPB VLލFMU UBVe[^_ÐU WVS]} M98)1Ҹ~ B9R‹EBB  ~$ PCj RƒF9|C! vPCj RƒF;u|Ѝe[^_UU1uuuu|@@u ÉUMt+t1htUvF1fuuuuu@u vUS]j(X@]ÐU]Eu` E `]EvE `UUu]؍]C%E=ukE]CuuME]C%=|v)}u }iUBE MAPo}@wL]È@s;E`}fUf fUm]EmEEUu]؃uuME]EX9]uE}fMf fMm]UmUEm]u}u @t*EhE"pEExEEPUR MQW Ep@EUBM PRQu/ EPEPuugEjE }|11ủuMىE1}|}+u؉}ЋE؉UJ} 3 6+EǍ09~;U~UЅ~)))UЅ~7QMQEEPUR@à MQ]~WEPE}~URMQE~VEPaE}~URMQEEEPURsNjw G MQWƒ -u}uE@؃URMQ EPUR W} tEM E}th[^_U,WVSE @EU9B} 1v] ]MEÉ]u<0 A1EEE]E%E] EE%)ЋU E)EUfFf]9]v?u#uvM9v?tEUB] SEP`EEEu] ]]E%] E%)ЋU E)EUfFf]9]vuE}ԋuEE}tl}$}tU3U96+EE,v]K9|) )]]1EĉEȅ} )EUUUjE~}~EE9~}ȋU)U))U}~h}tL~4VEPCEURPkà UR]])t#SuVvEPUREjE}~uVPE}2}u%E@u@tEEEE}t+uVJ4U U)E vuFuȃet +EȉEȃ}~EEEE}EUUU}~uVEPE}~URuVE}tREPURq};Mjj uVE}tjj EPkEUUă}]}~W}|+jjuV:EPEP ؋U҉U؍vu1EEv} ~WEPEUU}tGr@EuFM PRQs jEPnEEgvjj URlEu9uujj VQEE+jj EP4Ejj UR!E EȃuVEP`0ẼURuVà EPURǃ uWVWu}uEu}9tw~E̊E~|uZ}uTEuN~"}uh%ÃO;F> $@o@ov-@oddDoDoll||zntbtVpJp>x2x&5ddh@5dCE}>=t&EEEj EP=xt |=|t ljjjhjhj%H uh`?j @L=@ou @o%@o jM8e[^_ÉU WVSE]1 Pv t29Yruy9tABQMvyA)Y uSǃtV + @H9s5H B9r=|t PhW }t=u E EPPe[^_ÉUWVSEwEHEuHU<jhEGMEU9~-}WÃuEP1]MfCfK MfC fC}{CE1vS E)w;u} {v F;u|;[uD1}~<{ME쐉!fK fKU)UF}ՋE +@HMu1H}K{u9t1u Ft1fK uH}A)K =|tCPhCP1 Ce[^_UVSu=ht/ v9s1$w V VÃ=xtt VjS ؍e[^U WVS}=ht +@ wh v;DvhvH;u[th;t=l9u 9E ;v{@Ht hn%J MƃM#t h2p=lu-9u s(9E wuwh61KvE P4Ãt1} t"t;u sV M QWS W ؍e[^_UWVS},=8uh=hM + @ wh; DvhHEuhNvth6zxEth][H|u H2B2<t =|tVhUR=DotjVMQ}=ujUPx p=Pu@PP}PM9K s;tE9C s;u9{vSPCPjU9S u<S KK;ts;PugE@ C EHKUtOXE9{u sMK4;uXhe#;u{C;@ovpC ;uejs 9uP@oS‰S CRoC s +5@FD9w HB9v}AUR0}K CHEthMSM#th=|tCPhEP DfC S Hf{ u2:t%8tʃ:t 9t @;CrOC f;CuE9t9uC +@Hs9t SVe[^_ÐU VSu=Hoth0o<=<t/h <=Hot 0o1=8u6=tt u1VÃ=tEu]j EP  <=Hot 0o=ptu hX؍e[^ÍvUS]=Hoth0o <=<th <PvS[=t]EEj EP <=Hot 0o]ÉUWVS]} =Hoth0os <=<th <1t=8u h1ۃ=8u=ttuSq1u WO WSƃ=t]}uj EP  <=Hot 0o=ptu he[^_ÐUWVSEE}tu=uj+UX]vC;t;=u+]]=/v]utNt9t CA8tuA<=tu1[^_ÍvU WVS}tw=ul+E X]vC;t;=u+]]=/v]utNt9t CA8tuA<=tu1[^_ÐU$S=tЃ]S jS jSj莌j4P* jj;jSjb jPj$FreeBSD: src/lib/libc/i386/string/memset.S,v 1.5 1999/08/27 23:59:32 peter Exp $WS|$ D$L$W~$ĉ Љڃ)ӉكX[_$NetBSD: bcopy.S,v 1.6 1996/11/12 00:50:06 jtc Exp $vVW|$ t$L$)9rL$D$ _^ONL$D$ _^Ð$FreeBSD: src/lib/libc/i386/sys/brk.S,v 1.7 1999/08/27 23:59:38 peter Exp $D$9Lov LoD$̀rD$Po)UEU RPjuuuu ujh:US]uu CP| șCPSTfc ȋ]ÍvUS]C tjjjCPfc uu CPD]ÍvUS]uE URPCPiuu fc vK CPST]ÐUE@PU WVSEot1v_wNxvf{ tSU EXNy?uҋEe[^_ÐUu ht,@u蓌ÐUPu hu蝄 w]ÉUEoÍvUEoÍvUUt UWVSuuEFt}1ۋE;vS0ҋu09u5A;Fu-yuy u yuytXq}tCC;|;v1C;}+S&0ҋ09u݃ytA;FuEEe[^_ÐUWVS] UBOvhRSEPUR | ÍC;Ev XvS ƃS ;u u&;Eu!EPRcu Ou1[^_UWVS] UB;] wME ;EwBUBuUBUB%9t1vOhRSE PUR |ÍC;E wSƃS URURPVP8 cO[^_ÉU\WVSEUu  } tt u t(h0hXnhXnu u- Džu } ~ DžDžDžDž<1K{}!s0h?hn vDž[ Dž;8 􋕸R8t 3xu Džx%s M =oto11ۍvPURMQE PEPPoЃ w$􋕴RI C)~􋍴QO ttKj"jjhhP uh@Ph`hXn3Dž=o|A=ot*At@9o=o| @ojjP{o}7qq0hhnvqR5o {}7Rq?q0hhnruoPE P袾EEEEE EjEP5o:‹E  9t7pp0hhnvufDžPV5o1Ã~)ffuɅ]@p0p0hhnF 6Dž MQU9~4thhXnu|DžMf ff wAtPhhXn"|Dž(vu vf)ft PV5oÃͅ!nn0h+t^J+Mfft?fwSP5oSÃ~ f)uf;u  hhXnzhXn;E~EPEP =o|=ou@9otv=ot @ojjPwo}6mm0hhno=t=ouXQ5ov},m0hhnPSoju u5o蓸;E l0hhn=otIƅDžfDžjP5ovoclQju u5o ;E t+$l0h#hnWZ~ = DžDž=o}jh*vofDžfDžPjPjPRrà } [k8tNk0h:u0thAhXnwDžvkDžPPjMQEP5oqv (j0hMhn2Dž =thhXn,wDž('f;t$u  _hVu[P|uEu  hfhXnvhXn;E~EPEPmusEEPURE EPuuRu  hzhXn"vhXn;E~EPMQ: sBt tuYt5hhXnuhXn;E~EPMQ =S u>Bt2thhXnSuDžGu%!=!uhhXnuu  t5hhXnthXn;E~EPMQ ttu u=otJ11ۃPEPURu uoЃ $C)t􋅴P;; c􋅴Pu(ug=f<vf[^_ÍvU=o|65oWooooÐU WVS}u hV3su#GtSPhVs uNx   Vj e[^_ÐU, WVS]E#=tEx #=(q ,q1PVE PEP/tpe8te0Ph8+ Kx  Sj u1t(tWE PRPh'Sq } uMPRPPP7tPh9S}q0jhPjjPEP }"d0PhWS0q&SP\Sj ɭ F|[^_ÐUhXnuUu huÐULWVSuu|EPu u,}$c0 PhkVnp@]#(q ,qE#hq lqU}MމMMMMMă=t ut R4 p4ohVo =t t)NyF;F|;Vj;=t IhVoE# q $qthVkoE#0q 4qthVDoE#8q [^_ÉUuhu uSÐU WVS]EPSEPEPu \ƅ|&߰ЍPt|.tB;E|17fEe[^_UVShVhu ujà tuV1[^U WVS]} u{t)sWLu t {uׅte[^_ÍvUSEU ]xt;ut@, xuRhht]USEU ]xt;ut@, xuRhht]Ujuh0ÉU\} ujuPÉUjuhÉUE w(towtXt[t_tb=tuw@t^=t_=tiw =tXn=t]cvqiaYQIA!9(1/)6!@PhJh ) ÉUS]j(h`S/}ShRh``]ÉUVS]fо f1fʃf1f<oQ)QRhUhxe[^UWVSu11ۋ=wu`%1tTPAѐ9.u]A=wu`%1t8A=wu`%1t\A1;oroG;\s14o ~ Љ%[^_UWVS1EEEEv=wu`%1t|PCѐvRvl4%@tCύv=wu`%1=wu`%1tETPЉUCˍvvRdvl4%@tCύv=wu`%1J=wu`%1tETPЉUCˍv;.C=wu`%1t~EC=wu`%1tFUBEC=wu`%1tUTЉUCvR$vl4%@tщvRvl4%@tCύv2wt$`)U4)U4)U4<+u)U)‹E)Ѝ)v12w"$,vU E  U CvR l4%@tӉvRؾvl4%@tCύvEe[^_ÐU,WVSE1EEEEEEEEǰH}ǃEPEPÃEPEPƒ EEu+}u}u ]Uv}u}u]U1E8-u EEE8+uEvE=wu`%1tUtBōvE8.uyEE=wu`%1tOEEEE=wu`%1tEUTЉUEU]؁ÀvEvR l4%@u 9}sEȋEvR豼 l4%@t9}5E9}'EP#EEvRY l4%@u 9}sEȋEvR! l4%@t9}E9}EPEEvRɻ l4%@u 9}sEȋEvR葻 l4%@t 9}sE9}sEP EE UPUPUPEU BEBEBEBEBEB EB EB B B BZe[^_ÍvUP= EH"A$@}$6u4u0u jE4PE0PU,RE PE PUR` vE4PE0PPu ]ƃu E4PE0PjhrGE4PE0PRlE4PE0PE,PE PU REP E4PE0Pjhr{E4PE0PU,RE PE PUR PE4PE0Pjht1DžU )ЃRÃE E4PE0PjhxP Sh~]S{ƃE4PE0PVS E4PE0PPjVJ  E4PE0Pj hm Džu kÃE E4PE0Pjhx0 u4u0Sƃ E4PE0PV*E4PE0PRjV  E4PE0Pj h* Džu 躘ÃE E4PE0Pjhx u4u0S3ƃc E4PE0PVyE4PE0PPjV * E4PE0Pjhy Džu ÃE E4PE0Pjhx< u4u0Sƃ E4PE0PVE4PE0PRjV7 y E4PE0Pj hZ Džu XÃE E4PE0Pjhx u4u0Sƃ E4PE0PVE4PE0Pjh< E4PE0PPjVg  E4PE0Pj h }$b u {E Ph]Sƃ E4PE0PVSK E4PE0PU,RE PE PUR^ }$ u E Ph]Sƃ E4PE0PVSI E4PE0PE,PE PU REP  E4PE0Pjhr E4PE0PU,RE PE PUR d vE4PE0PPu ƃD  u 9U  }4]0vWSPu [ ƃ u 9U  WSjhr<9E r Su U$RE4PE0P߰HPSwv}$N u4u0u j覽E4PE0P}0HPk  Su E4PE0P߰HPSv}$u ÃE u ړE  PShhSpƃE4PE0PVS E4PE0PRu ƃSu E4PE0Pjhr ZE4PE0PPu ƃ6u E4PE0Pjhr| E4PE0PRu F ƃu E4PE0Pjhr0 E4PE0PE,PE PU REP }$ju 胒ƃE u rÃE  u ^E PSVh4Sƃ0E4PE0PVS )E4PE0PU,RE PE PUR< vE4PE0PE,PE PU REP E4PE0Pjhr% E4PE0PU,RE PE PUR }$^u4u0u j趺E4PE0P}0HP{ E  E Ph]SƃE4PE0PVS E DžDž9U E4}0UE E v}|u+PWjh Dž RhP%ƃRWVP Ui9E NE4PE0Pjh}$u E E E E E PRQh]S{ƃ0E4PE0PVS hP+E Pu r ƃ]~,E4PE0PjhbDž Džr19U4E0RPHPR`PR)؃0~0P+P*09|v}$zu 蓎ƃE E E E 8E u 舎E  PSVPh]Sƃ E4PE0PVS/EP9u E P Ph]Sƃ0E4PE0PVS=u ׍E PPh]SPƃ0E4PE0PVSu vE Ph]Sƃ E4PE0PVSFE4PE0PU,RE PE PURY hP+E Pu ƃ~.E4PE0PjhBDž vDžr19E4U0PRHPR|^PR)؃0~0P+P|,09|E4PE0PjhkE4PE0PE,PE PU REP |΋+U 1ۉ9}؅}CE ؅}C$)t9SPhWƃ E4PE0PVWGC9| Ph(]SƃE4PE0PVSa9E DžU4E0U]h2SWË+} ~19}!E Ph5S"ÃF9|PR+PP?YRPjhRPRj0+@P ]h;S{19}[CE u7vR0vl4%t E .F9|PR+PP<} 9U mE0+[^_U WVS]} ހ;tAtWS )u )9v&H#C;t;\u C;t퐀;.uC;u)e[^_ÐUWVS]}]EEUEPWjh;] s\3D3;E wPFPhǚtURWjh||5C}u}u3u/}u)u%EPE PjSEP } tvC~euYÀuOvS_ l4%t%vS譇 l4FuE +Eȍe[^_ÍvUWVSE11EEÀ0vSÒ l4%wu`%1ttCGvS_ l4%t'ځvS3à l4Cws$)ƍv4)4)4u11EUE~ }uuE U1v#*e[^_Uu@@3CPG G1e[^_UWVS}G,EEjUR7A tOE +EfG GVAfEQUAf;ut2E;E w&UƋUBfFf;ut E;E v܋UJfP[]}t!r }t-8DA jDAjjQ7vc0}tp7}uSAP SAPjQ7G,9t1ۅtj37,u01e[^_ÐU WVSuU >B\N)Ãr2PyGfFEf+Xp0PWGfFf>E)fLFf\Fe[^_ÍvUWVSE pUEf|FwU REPv}t UDVUB NjUf+|VEH9trLFˋE XډUUDV)PSEPU5f|VuVfDVfDVVfDVDVfDV;U~DFUfVfDVfDVUfEH8U J1e[^_ÐU}EPPEPURM QEPgUbMaIEH UJ HM؉ˋBEfEEf|svsE؉EUމUs)‰ЉEPuMQ;E u\f+EtHf|sDsU)‰PDsEPEPfsf+DsMfKf|K|sE6DsE؉E sDsU)JREPEPfETsfUރ9Mf) E)fLCf|CE`Ub1e[^_ÍvU\WVSEE܋XURU؉]EMfM;Of;;CfHfw{EPu VEp PURMQuV CEE5URUԋMMuvu؋EE܅kU܋ZMMf|C CEf)Uu)ftSUfTCjuVQEPE܃U܋ZMI fME}tuVEP U܉UЋMI fMοf;;f{uuȍEEĐS؉EMS)uȉNDS؉E SDS)uĉNTSfU΃EpuUR;E u{Mfyv)FuFTQ9wEPVQ6vURMQEuvuԃEPURVHMIuf~v6EEMAUBETF9UwQMQV E@<\tPU\@jؙ]K t1RPEP0ut/URV]Sڍtt;Et Of}u)f9u#fEP fV]C fFExt~}t:X 19}lMvEAADADEDB9|>fEEEA9uQfEFQEDQB9~1e[^_UWVSu }E@ EUuR_G]]Extj}t:X 19}XMvEAADADEDB9|*19MVfEAVEDVB9~}t$UZG~j1h`jjaEx ED  UB H9EuhE}MQj PEPEDC~[GrUz ЃD  12EE}E}$M)M U4ÉyC؅}C$)M UB ƍ\;Z$|KJ$19}E;XD~ DF9};tU+\@ %1e[^_ÉU WVSuU B f ft‰T@JQ;V$}V$NF H!Í8uQVƒ؅}C؅}C$)!U RVNe[^_ÉU0VSu]SAEPSj hr*t"hrjji jEPj 1ue[^ÍvUWVS]fELSfMD{fEM AtS)ft{q1P Ef+pf4{p0Pi Mf EfD{fD{MAM fAM)fLSftCe[^_ÐU WVS]E ;}ms z8M tMjjjU PP847S u78M 4t{1e[^_ÐU,WVSEU z}M@EEEURU"%U9~fUDG)fESMQEEP )]]7FEfwFf7uM)fLWUfTGfwM QEP>E [7}uzf|wtkTwE9~fEDGf+EfEfw]SUREEPx])]fDwMf)LGUfTG vfDwM y}IDGf}ȋU9~fU%;EuUE;PufMDGf+EfE]SMQEEP)]]7FEfwFf7uM)fLWUfTG}t5fwM QEPE u 3U z}fwM IDGf}1e[^_ÍvUWVS}] ]1KEJDAfEKjSEPWÃt VWޅtjK}tfyt'AffwEfyuf|AtELAfMUJ~!EfAfACBviUBEEfUUUW +UfTAW JfTAEHt SW9t VWO81e[^_UWVSE PUMM]]ur}_ )É;Evf|runu}w4}uvE)EjE PUMDQP]S%E tOPUEBu^ );Mfzt;Mu}]{4}t Ee[^_ÐUVS]u jQDPPSt)Afxuۃtfuǃ $jU RDFPS  @f8uL$ǃ :jE PDFPSsƒtUEPEEPRSǃ~:EU 9B u#EPFBPEPqe[^_UVSu]uuju V"Ct1e[^UWVS}E pFW )‰UE @ fE]FffwTtrSqUREPjU RW t:sjE PDFPWtWURURSPWAà ~;EU 9B u$EPFBPEP?e[^_UWVS]jEPEPuEP u`uuUR&;EЉUEPEPU fB ft,juB PEP5U BuE @E }tEHXX|CLC3F֋EfSFfCf3f|CfLCEU E BEXHf;vGsLC|CffLCf|CuUR  ..., where is one of: %sgrepexviewvitelnetftpmount_cd9660mount_msdosumountswaponrrestorerestorerebootmountmknodfdiskdmesgdisklabelclrichgrpchownsyncsleeprmdirrmmvmkdirlslnkillexprechodfddcpchrootchmodcat@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/cat/cat.c,v 1.14.2.1 2000/05/16 08:38:49 asmodai Exp $benstuvusage: cat [-benstuv] [-] [file ...] stdoutdddddddddddddd ,DXstdin-r%s%6d buffer@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/chmod/chmod.c,v 1.16.2.2 2000/08/07 07:33:23 ps Exp $HLPRXfgorstuvwxthe -R and -h options may not be specified together.invalid file mode: %s%s: %s%s%s fts_read(4@dLdXdddddddXXXX,XX,Xusage: chmod [-fv] [-R [-H | -L | -P]] mode file ... @(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/usr.sbin/chroot/chroot.c,v 1.4 1999/08/28 01:15:45 peter Exp $.%sSHELL/bin/sh-iusage: chroot newroot [command] @(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/cp/cp.c,v 1.24 1999/11/28 09:34:21 mharo Exp $HLPRfiprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%shhhАhhhhhhhhhhhhhhhhhhhhhhhhh,hhhhhhDhPhhh\%s: %s%s: directory causes a cycle..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).%s -> %s fts_readlll$FreeBSD: src/bin/cp/utils.c,v 1.27.2.1 2000/10/27 16:24:22 asmodai Exp $%s(y/n [n]) overwrite %s? %snot overwritten readlink: %sunlink: %ssymlink: %smkfifo: %smknod: %sutimes: %schown: %schflags: %s cp [-R [-H | -L | -P]] [-f | -i] [-pv] src1 ... srcN directoryusage: cp [-R [-H | -L | -P]] [-f | -i] [-pv] src target%s %s $FreeBSD: src/bin/dd/args.c,v 1.25.2.1 2000/08/07 08:30:17 ps Exp $-8)$ؤ4@@ܥ tD T@@T@@tskipseekoseekofobsiseekifibsfilescountconvcbsbsunable to allocate space for the argument "%s"unknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsseek offsets cannot be larger than %qdbs must be between 1 and %dcbs must be between 1 and %dcount cannot be negativefiles must be between 1 and %qdibs must be between 1 and %dobs must be between 1 and %dʅ gą g g g g g| wrldunblockucasesyncswabsparseosyncoldibmoldebcdicoldasciinotruncnoerrorlcaseibmebcdicblockascii,unknown conversion %s%s: illegal conversion combination%s%s: illegal numeric value%s: %ş@@@@@@@ܧ@@@@@@@@@@ %s: illegal offset$FreeBSD: src/bin/dd/conv.c,v 1.15 1999/09/13 21:47:10 green Exp $%s: short input record$FreeBSD: src/bin/dd/conv_tab.c,v 1.10 1999/09/12 16:51:53 green Exp $    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/dd/dd.c,v 1.27.2.1 2000/08/07 08:30:17 ps Exp $stdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffertruncating %sư>%s: seek error creating sparse file%s: end of device%s: short write on tape device%s: short write on character device$FreeBSD: src/bin/dd/misc.c,v 1.18 1999/08/27 23:14:04 peter Exp $%qu+%qu records in %qu+%qu records out blockblocks%qu odd length swab %s %qu truncated %s %qu bytes transferred in %.6f secs (%.0f bytes/sec) ư>?@$FreeBSD: src/bin/dd/position.c,v 1.17.2.1 2000/08/07 08:30:17 ps Exp $%sskip reached end of input%s: write failure@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/df/df.c,v 1.23.2.1 2000/06/13 03:19:40 jwd Exp $abgHhikmnPt:BLOCKSIZE=512BLOCKSIZE=1gBLOCKSIZE=1kBLOCKSIZE=1monly one -t option may be specified.%s/tmp/df.XXXXXXstrdup failedmkdtemp("%s") failedufs<$$0Xp|?@ 0BBKMGTPE %5.0f%c %5.1f%c$@ SizeFilesystem%-*.*s %-s Used Avail Capacity%-*.*s %-s Used Avail Capacity iused ifree %%iused Mounted on %-*.*s %*ld %8ld %8ld %5.0f%% %7ld %7ld %5.0f%% %s Y@ df: %qd: %s usage: df [-b | -H | -h | -k | -m | -P] [-ain] [-t type] [file | filesystem ...] $FreeBSD: src/sbin/mount/vfslist.c,v 1.4 1999/08/28 00:13:27 peter Exp $malloc failed@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/echo/echo.c,v 1.8 1999/08/27 23:14:10 peter Exp $-n%s$FreeBSD: src/usr.bin/yacc/skeleton.c,v 1.28 2000/01/17 02:04:06 bde Exp $B[aim3O (                      !"   (:%&)*+%-/*+-/:<=>:%&)*+-)/%&)*+-/<=>%&*)<=>/%&)*+-:/&|)+-<=>&)<=>&)+-|<=>&|)&|)<=>&)&)<=>|<=>|<=><=>|&)%&|*+-/|<=>:<=>||%&|*+|-/:<=>%*+-/||:<=> malloc() failedoverflow%qd|&=<>+-*/%:()%qd %s syntax errornon-numeric argumentdivision by zero%syacc stack overflow(@Xl@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/kill/kill.c,v 1.11 1999/08/27 23:14:26 peter Exp $-lillegal signal number: %s%s -soption requires an argument -- s0illegal process id: %s%ssigunknown signal %s; valid signals: kill -signal_number pid ... kill -signal_name pid ... kill -l [exit_status]usage: kill [-s signal_name] pid ...%s %s %s %s @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/ln/ln.c,v 1.15.2.1 2000/09/18 02:07:11 jkh Exp $linkfisv.%s%s/%sreplace %s? not replaced %s %c> %s link file1 file2 ln [-fisv] file ... directoryusage: ln [-fisv] file1 file2%s %s %s $FreeBSD: src/bin/ls/cmp.c,v 1.9 1999/08/27 23:14:31 peter Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/ls/ls.c,v 1.32.2.4 2000/08/16 19:57:11 jhb Exp $COLUMNS1ABCFGHLPRTWabcdfgiklnoqrstuCLICOLORCLICOLOR_FORCEColor support not compiled in. l|4(8HhtP%s: directory causes a cycle%s: %s %s: %s: fts_readLS_COLWIDTHS0:0 %lu : %lu : %lu : %i : %i : %i : %qu : %lu %u-%lu%qu(29@GU$FreeBSD: src/bin/ls/print.c,v 1.19.2.3 2000/07/12 06:19:14 assar Exp $%stotal %lu %*lu %*qd %s %*u %-*s %-*s %-*s %3d, 0x%08x %3d, %3d %*s%*qd %Ef %T %Y %Ef %R %Ef %Y %s/%s ls: %s: %s -> $FreeBSD: src/bin/ls/util.c,v 1.20.2.3 2000/08/07 08:05:08 ps Exp $4 h (  P                                                                                 usage: ls [-ABCFHLPRTWabcdfgiklnoqrstu1] [file ...] @(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/mkdir/mkdir.c,v 1.19 1999/09/04 03:19:38 mharo Exp $m:pvinvalid file mode: %s%s%s usage: mkdir [-pv] [-m mode] directory ... @(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/mv/mv.c,v 1.24.2.2 2000/07/28 21:40:39 sada Exp $fiv%s: destination pathname too long%s(y/n [n]) overwrite %s? %s override %s%s%s/%s for %s? %snot overwritten %s -> %s cannot resolve %s: %scannot rename a mount pointrename %s to %smalloc failed%s: remove%s: set owner/group (was: %lu/%lu)%s: owner/group changed; clearing suid/sgid (mode was 0%03o)%s: set mode (was: 0%03o)%s: set flags (was: 0%07o)%s: set times-PRpv-PRpmv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rm mv [-f | -i] [-v] source ... directoryusage: mv [-f | -i] [-v] source target%s %s @(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/rm/rm.c,v 1.29.2.2 2000/07/01 03:08:59 ps Exp $unlinkdfiPRrvW %s: %s%s %sfts_readHHtH<PHHl%s: is a directorymallocremove %s? override %s%s%s/%s %s%sfor %s? "." and ".." may not be removed unlink fileusage: rm [-f | -i] [-dPRrvW] file ...%s %s @(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/rmdir/rmdir.c,v 1.9.2.1 2000/07/04 01:13:36 ps Exp $p%susage: rmdir [-p] directory ... @(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/sleep/sleep.c,v 1.9 1999/10/01 07:53:40 ru Exp $usage: sleep seconds @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/sync/sync.c,v 1.9 1999/08/27 23:15:45 peter Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/usr.sbin/chown/chown.c,v 1.15.2.1 2000/08/07 02:03:09 ps Exp $HLPRfhvthe -R and -h options may not be specified together%s: %s%s fts_read@+@+@+@+@+@+@+@+@+*@+@+@+*@+@+@++@++@+@+@+@+@+@+@+@+@+@+@+@+@+@+@+@+@+@+@++@+(+@+@+@+@+@+@+@+@+@+@+@+@+@+4+l,,,,,,,,,,,,,groupuser%s%s: illegal %s nameyou are not a member of group %s chgrp [-R [-H | -L | -P]] [-f] [-h] [-v] group file ... chown [-R [-H | -L | -P]] [-f] [-h] [-v] :group file ...usage: chown [-R [-H | -L | -P]] [-f] [-h] [-v] owner[:group] file ...%s %s %s @(#) Copyright (c) 1990, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/clri/clri.c,v 1.4 1999/08/28 00:12:32 peter Exp $usage: clri filesystem inode ... %s%s: can't read superblock%s: superblock magic number 0x%x, not 0x%x%s is not a valid inode numberclearing %d @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/disklabel/disklabel.c,v 1.28.2.5 2000/10/31 01:32:23 jkh Exp $DOC2KVinumCCDfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownvinumbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunusedBNRWb:ers:w/dev/%s%s%c%s%s%sioctl DIOCWLABELr,4,4,4l3,4,4,4,4,4,4,4,4,4,4,43,4,4,43,4,4,4,43,4,4,4,4,4,4,4,4,4,4x3,4,43,4,4,4,4,4,4,4,4,4,4,4,443,4,4,4485(6h6678@8auto%s: unknown disk type/boot%s/%sioctl DIOCSDINFOwriteioctl DIOCWDINFO%s: no disk label on disk;use "disklabel -r" to install initial label %s: label magic number or checksum is wrong!(disklabel or kernel is out of date?) %s: open partition would move or shrink%s: '%c' partition must start at beginning of diskbad pack magic number (label is damaged, or pack is unlabeled)ioctl DIOCGDINFO%s/boot1%s/boot2%s too largebootstrap doesn't leave room for disk label# %s: type: %s type: %u disk: %.*s label: %.*s flags: removeable ecc badsect bytes/sector: %lu sectors/track: %lu tracks/cylinder: %lu sectors/cylinder: %lu cylinders: %lu sectors/unit: %lu rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %lu # milliseconds track-to-track seek: %ld # milliseconds drivedata: %lu %u partitions: # size offset fstype [fsize bsize bps/cpg] %c: %8lu %8lu %8.8s%8d %5lu %5lu %5.5s %5lu %5lu %5u %5lu %5lu %5d%20.20s # (Cyl. %4lu- %lu) wcan't create %scan't reopen %s for readingre-edit the label? [y]: you have too many processesforkEDITOR/usr/bin/viline %d: syntax error typeWarning, unknown disk typeline %d:%s %d flagsremoveableeccbadsectline %d: %s: bad flag drivedata%d partitionsline %d: bad # of partitions disklabelbytes/sectorline %d: %s: bad sector size sectors/trackline %d: %s: bad %s sectors/cylindertracks/cylindercylinderssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name line %d: too few numeric fields line %d: %s: bad partition size line %d: %s: bad partition offset Warning, unknown filesystem typeline %d: %s %s line %d: %s: Unknown disklabel field sector size 0 sectors/track 0 tracks/cylinder 0 cylinders/unit 0 revolutions/minute 0boot block size 0 boot block size %% sector-size != 0super block size 0 super block size %% sector-size != 0number of partitions (%lu) > MAXPARTITIONS (%d)partition %c: size 0, but offset %lupartition %c: offset past end of unit partition %c: partition extends past end of unit unused partition %c: size %d offset %lu"auto" requires the usage of a canonical disk namecannot open %sboot overlaps used partition %c marked as FS_BOOTboot overlaps partition %c, %scannot install boot programWarning, (to write disable/enable label) disklabel [-NW] disk (to restore label and boot program) disklabel -R -B [ -b boot1 [ -s boot2 ] ] disk protofile [ type ] (to write label and boot program) disklabel -w -B [ -b boot1 [ -s boot2 ] ] disk type [ packid ] (to install boot program with existing label) disklabel -B [ -b boot1 [ -s boot2 ] ] disk [ type ] (to restore label with existing boot program) disklabel -R [-r] disk protofile (to edit label) disklabel -e [-r] disk (to write label with existing boot program) disklabel -w [-r] disk type [ packid ] (to read label)usage: disklabel [-r] disk%s %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s $FreeBSD: src/sbin/disklabel/dkcksum.c,v 1.4 1999/08/28 00:12:35 peter Exp $@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/dmesg/dmesg.c,v 1.11 1999/08/28 00:12:36 peter Exp $_msgbufpM:N:dmesgkvm_nlist: %snamelist%s: msgbufp not foundkvm_read: %skernel message buffer has different magic numbermalloc failed%susage: dmesg [-M core] [-N system] $FreeBSD: src/sbin/i386/fdisk/fdisk.c,v 1.36.2.6 2000/08/24 17:56:21 jhb Exp $/dev/od0/dev/da0/dev/wd0/dev/ad0BBT (Bad Blocks Table)DOS 3.3+ SecondaryConcurrent CPM or C.DOS or CTOSBSDI BSD/386 swapBSDI BSD/386 filesystemNetBSDNEXTSTEPOpenBSDFreeBSD/NetBSD/386BSDSuspend to DiskBSD/OSAmoeba bad block tableAmoeba filesystemLinux filesystemLinux swap or Solaris x86Minix 1.4b ... 1.5.10Minix 1.1 ... 1.4aPCIXNovell Netware 3.xxNovell Netware 2.xxISC UNIX, other System V/386, GNU HURD or MachSpeedGBCP/M or Microport SysV/ATDMQNX 4.2 TertiaryQNX 4.2 SecondaryQNX 4.2 PrimaryVENIX 286plan9OPUSExtended DOS, LBAPrimary 'big' DOS (> 32MB, LBA)DOS or Windows 95 with 32 bit FAT, LBADOS or Windows 95 with 32 bit FATOS/2 Boot Manager or OPUSAIX boot partition or CoherentAIX filesystemOS/2 HPFS, NTFS, QNX-2 (16 bit) or Advanced UNIXPrimary 'big' DOS (> 32MB)Extended DOSPrimary DOS with 16 bit FAT (<= 32MB)XENIX /usr filesystemXENIX / filesystemPrimary DOS with 12 bit FATunusedBIab:f:istuv1234/dev/dev/%scannot open disk %scannot open any diskcannot allocate buffer to determine disk sector sizeread_s0%s: %d cyl %d hd %d sec SizeStartPart %11s %11s Type Flags %4d: %11lu %11lu 0x%02x 0x%02x ******* Working on device %s ******* Media sector size is %d Warning: BIOS sector numbering starts with sector 1 Information from DOS bootblock is: We haven't changed the partition table yet. This is your last chance. Should we write new partition table? -t flag specified -- partition table not written. ^^^^^^^^^^^^^^^^^ ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^$^0^^^^<^^^H^^^^^^^^^^T^`^l^x^ fdisk -f configfile [-itv] [disk] usage: fdisk [-BIaistu] [-b bootcode] [-1234] [disk] %s%s%d: sysid %d,(%s) (active) start %lu, size %lu (%qd Meg), flag %x%s beg: cyl %d/ sector %d/ head %d; end: cyl %d/ sector %d/ head %d /boot/mbr%s%s: length must be a multiple of sector size%s: unable to allocate read buffer%s: short readThe data for partition %d is: Do you want to change it? The static data for the DOS partition 4 has been reinitialized to: sysid (165=FreeBSD)startsizeExplicitly specify beg/end address ?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorAre we happy with this entry?parameters extracted from in-core disklabel are: cylinders=%d heads=%d sectors/track=%d (%d blks/cyl) Figures below won't work with BIOS for partitions not in cyl 1 parameters to be used for BIOS calculations are: Do you want to change the active partition?active partitionActive partition number must be in range 1-4. Try again. Are you happy with this choiceDo you want to change the boot code?Do you want to change our idea of what BIOS thinks ?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorscan't get file status of %sdevice %s is not character specialcan't open device %scan't get disk parameters on %scan't get disk parameters on %s; supplying dummy onesunable to allocate buffer to read fdisk partition tablecan't read fdisk partition tableinvalid fdisk partition table foundcan't write fdisk partition table%s [n] yesYESyYSupply a decimal value for "%s" [%d] %s is an invalid decimal number. Try again. unknownERROR line %d: the geometry specification line must occur before all partition specificationsERROR line %d: incorrect number of geometry argsERROR line %d: unknown geometry arg type: '%c' (0x%02x)ERROR line %d: number of cylinders not specifiedWARNING line %d: number of cylinders (%d) may be out-of-range (must be within 1-1024 for normal BIOS operation, unless the entire disk is dedicated to FreeBSD)ERROR line %d: number of heads not specifiedERROR line %d: number of heads must be within (1-256)ERROR line %d: number of sectors not specifiedERROR line %d: number of sectors must be within (1-63)ERROR line %d: incorrect number of partition argsERROR line %d: invalid partition number %dERROR line %d: unable to adjust start of partition %d to fall on a head boundaryWARNING: adjusting start offset of partition %d from %u to %u, to fall on a head boundaryERROR: could not adjust partition to start on a head boundary and end on a cylinder boundary.WARNING: adjusting size of partition %d from %u to %u to end on a cylinder boundaryERROR line %d: size for partition %d is zeroERROR line %d: incorrect number of active args-rERROR: unable to adjust start of partition to fall on a head boundaryWARNING: adjusting start offset of partition to %u to fall on a head boundaryWARNING: adjusting size of partition to %u to end on a cylinder boundaryERROR: size for partition is zero@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/mknod/mknod.c,v 1.13 2000/01/06 17:51:46 obrien Exp $usage: mknod name [b | c] major minor [owner:group] %s%s: illegal %s namegroup must be specified when the owner isgroupowner must be specified when the group isusernode must be type 'b' or 'c'%s: non-numeric major number%s: non-numeric minor numbermajor or minor number too largesetting ownership on %s@(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/mount/mount.c,v 1.39.2.1 2000/09/05 12:07:56 sheldonh Exp $soft-updatessuiddirnoclusterwnoclusterrunionsynchronousread-onlywith quotasnosymfollownosuidnoexecnodevnoatimelocalNFS exportedasynchronousext2fslfsffsufsadfo:prwt:uvonly one -t option may be specifiedgetmntinfororwrqnoautonot currently mounted %s/%s: unknown special file or file system%s has unknown file system type:@nfsr/var/run/mountd.pid%dsignal mountdd~d~d~d~d~d~d~d~d~d~d~d~d~d~d~d~d~d~d~d~d~d~d~d~d~d~d~d~d~d~d~d~d~d~}d~d~}d~}d~d~d~d~d~d~d~d~}~d~~d~ ~T~ ~\~,/usr/sbin/sbinforceupdateexec: mount_%s %s fork%s/mount_%smalloc failed, exec mount_%s not found in %swaitpid%s: %sstatfs %s%s on %s (%s, %s, mounted by %s, writes: sync %ld async %ld, reads: sync %ld async %ld) %s,%s-ofstabcurrentno mount [-dfpruvw] special | node mount [-adfpruvw] [-t ufs | external_type]usage: mount [-dfpruvw] [-o options] [-t ufs | external_type] special node%s %s %s %s %s %s %s %u %u 1 1 2 2 0 0 syncasync@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/mount/mount_ufs.c,v 1.16 1999/08/28 00:13:27 peter Exp $updatesyncforceasyncclusterwclusterrunionrdonlysymfollowsuidsuiddirexecdevatimeautorwrogroupquotauserquotao:ufsvfsload(ufs)ufs filesystem is not available%s on %s: mount table full%s on %s: specified device does not match mounted device%s on %s: incorrect super blockusage: mount_ufs [-o options] special node $FreeBSD: src/sbin/mount/getmntopts.c,v 1.9 1999/10/09 11:54:06 phk Exp $,-o %s: option not supported%s: not a directory%s: %s$FreeBSD: src/sbin/mount/vfslist.c,v 1.4 1999/08/28 00:13:27 peter Exp $malloc failed@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/reboot/reboot.c,v 1.9 1999/11/21 21:52:40 jdp Exp $haltdlnpqcannot dump (-d) when halting; must reboot instead???halted by %srebootrebooted by %sshutdown~SIGTSTP initSIGTERM processesWARNING: some process(es) wouldn't die (can't restart init): %s%s                                              usage: %s [-dnpq] @(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/restore/main.c,v 1.10 1999/08/28 00:14:07 peter Exp $./restoresymtableTAPE/dev/rsa0b:cdf:himNRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0%c and %c options are mutually exclusiveillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specified.Begin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure xxxxxxxxxxxxxxxxxx txxxxxܙxxxxT`xlZZZZZZZZZZZZZZZZZZZZZZ`ZZZZZZZZZ4ZZZrestore -t [-chkuvy] [-b blocksize] [-f file] [-s fileno] [file ...]restore -x [-chkmuvy] [-b blocksize] [-f file] [-s fileno] [file ...]restore -R [-ckuvy] [-b blocksize] [-f file] [-s fileno]restore -r [-ckuvy] [-b blocksize] [-f file] [-s fileno]restore -i [-chkmuvy] [-b blocksize] [-f file] [-s fileno]usage: %s %s %s %s %s option requires an argument -- %c$FreeBSD: src/sbin/restore/interactive.c,v 1.8 1999/08/28 00:14:05 peter Exp $/addcd%s: not a directory delete%s: not on extraction list extracthelp directory is used If no `arg' is supplied, the current help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%slspwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help yttttttttttttttttttttttttttttttttHtġXttHtttttt4ttt̤restore > %s/%s%s: out of memory command lines cannot be continued missing %c ../canonname: not enough buffer space ..ls: out of memory directory reopen failed %s: %s%s: name exceeds %d char Warning: undefined file type %d ̯̯į%*d %srestore interrupted, continue$FreeBSD: src/sbin/restore/restore.c,v 1.7 1999/08/28 00:14:08 peter Exp $leafdir %s%10d %s %s: not on the tape ./%uMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %d) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state 4hX llDDD|NIL|ONTAPE|INOFND|NAMEFND|MODECHGFind unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %d: bad first %s: not found on tape expected next file %d, got %d unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %d type should be LEAF$FreeBSD: src/sbin/restore/dirs.c,v 1.14.2.1 2000/07/21 09:00:08 dwmalone Exp $Extract directories from tape /tmp/%srstdir%d-XXXXXXw%s - cannot create directory temporary fopen%srstmode%d%s - cannot create modefile fopen/opendirfile: %s Root directory is not on tape .Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %d char lsMangled directory: reclen not multiple of 4 reclen less than DIRSIZ (%d < %d) reclen name too big (%d > %d) bad seek pointer to rst_seekdir %ld error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopen: %s cannot open mode file %s set owner/mode for '.'cannot find directory inode %d error setting directory modes Cannot find directory inode %d named %s %s: cannot create file: %s write error extracting inode %d, name %s read: %s write: %s no memory directory table $FreeBSD: src/sbin/restore/symtab.c,v 1.7 1999/08/28 00:14:08 peter Exp $addino: out of range %d duplicate inumdeleteino: out of range %d deleteino: %d not found %s is not a directory %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTcannot find entry in parent listbad name no space for string table Check pointing the restore wfopen: %s cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table .open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table read: %s cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c $FreeBSD: src/sbin/restore/tape.c,v 1.16.2.2 2000/09/15 15:09:37 mjacob Exp $-r/dev/ttycannot open %s: %s /dev/nullCannot allocate space for magtape buffer Cannot allocate space for tape buffer Verify tape and initialize maps %s: %s Tape is not a dump tape Converting to new file system format. .cannot stat .: %s bad block size %ld Tape is not volume 1 of the dump header read failed at %ld blocks no header after volume mark! Cannot find file removal list maxino = %d no memory for active inode map Cannot find file dump list no memory for file dump list Changing volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. %s%s%s%s%sYou have read volumes: %s%ld, Specify next volume #: Volume numbers are positive numerics Mount tape volume %ld Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) none Cannot open %s tape is not dump tape Wrong volume (%ld) Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld sSkipping %ld duplicate record%s. active file into volume 1 End-of-input encountered while extractingWarning: %s %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Dump date: %sthe epoch Dumped from: %sLevel %ld dump of %s on %s:%s Label: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract fifo %s %s: cannot create fifo: %s extract special file %s %s: cannot create special file: %s %s: cannot create file: %s ran off end of tape not at beginning of a file Missing address (header) block for %s at %ld blocks write error extracting inode %d, name %s write: %s seek error extracting inode %d, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s hole in map mid-media short read error. partial block read: %ld should be %ld Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %d continuecontinuation failed: %s End-of-tape encountered partial block read: %d should be %d tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%d) Tape block size is %ld Note: Doing Byte swapping 8l4s31ll2lNote: Doing Quad swapping gethead: unknown inode type %d NN3oldnewVolume header (%s inode format) begins with record %ldDumped inodes map headerUsed inodes map headerFile header, ino %dFile continuation header, ino %dEnd of tape header; predicted %ld blocks, got %ld blocksL4\l@unexpected tape header unknown tape header type %d resync restore, skipped %ld blocks 8, Checksum error %o, inode %d file %s $FreeBSD: src/sbin/restore/utilities.c,v 1.8 1999/08/28 00:14:09 peter Exp $mktempname: called with TMPNAMEnot on ino listRSTTMP%s%ld%luwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d symbolichardCreate %s link %s->%s warning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s NODELEAFentry type: %s inode number: %lu flags: %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump core$FreeBSD: src/sbin/dump/dumprmt.c,v 1.14.2.1 2000/07/01 06:31:52 ps Exp $Lost connection to remote host. on %s: %s%stcpkshellshell%s/tcp: unknown service who are you? RMT/etc/rmtlogin to %s as %s failed. Connection to %s established. IP_TOS:IPTOS_THROUGHPUT setsockoptTCP_NODELAY setsockoptinvalid user name %s O%.226s %d C closeR%d readW%d writeL%d %d seekS statusI%d %d ioctl%s: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). @(#) Copyright (c) 1980, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/swapon/swapon.c,v 1.8.2.1 2000/07/01 06:31:52 ps Exp $aswnoautoswapon: adding %s as swap device %s: device already in use%susage: swapon [-a] [special_file ...] @(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/umount/umount.c,v 1.22 1999/11/22 04:23:11 dillon Exp $Aafh:t:vonly one -t option may be specifiednfscannot umount %s, %s is mounted there, umount it first/etc/fstab%sfstab reading failure/rwrorq%s: unknown mount typemalloc failedstrdup%s: not currently mountedcan't get net id for hostunmount of %s failed%s: unmount from %s Cannot MNT PRCBad MNT RPCcannot remove entry %s:%scalloc4))X(**malloc umount -a | -A [-fv] [-h host] [-t type]usage: umount [-fv] special | node%s %s $FreeBSD: src/sbin/mount/vfslist.c,v 1.4 1999/08/28 00:13:27 peter Exp $malloc failed$FreeBSD: src/usr.sbin/rpc.umntall/mounttab.c,v 1.2 2000/01/15 14:28:14 green Exp $a/var/db/mounttab%ld %s %s rcan't open %s mallocwcan't write to %swrite entry %s:%scan't remove %sdelete entries host %sdelete entry %s:%sskip bad line in mounttab with entry %s$FreeBSD: src/sbin/mount_msdos/mount_msdos.c,v 1.19.2.1 2000/07/20 10:35:13 kris Exp $nowin95longnamesshortnamesupdatesyncforceclusterwclusterrunionrdonlysymfollowsuidsuiddirexecdevatimeautorwrogroupquotauserquotasl9u:g:m:o:L:W:stat %smsdosvfsload(msdos)msdos filesystem is not available%s4555555555555555555t555555555555555555555555555(555554P555555455unknown group id: %sunknown user id: %sinvalid file mode: %s [-s] [-l] [-9] [-L locale] [-W table] bdev dirusage: mount_msdos [-o options] [-u user] [-g group] [-m mask]%s %s /usr/libdata/msdosfs/%srcan't read u2w table row %d near line %d%i%i%i%i%i%i%i%iu2w table: missing item(s) in row %d, line %dcan't read d2u table row %d near line %dd2u table: missing item(s) in row %d, line %dcan't read u2d table row %d near line %du2d table: missing item(s) in row %d, line %d$FreeBSD: src/sbin/mount/getmntopts.c,v 1.9 1999/10/09 11:54:06 phk Exp $,-o %s: option not supported%s: not a directory%s: %s$FreeBSD: src/sbin/mount_cd9660/mount_cd9660.c,v 1.15 1999/10/09 11:54:08 phk Exp $jolietrripgensextattupdateclusterwclusterrunionrdonlysymfollowsuidsuiddirexecdevatimeautorwrogroupquotauserquotaegjo:rs:vcould not determine starting sector, using very first session using starting sector %d cd9660vfsload(cd9660)cd9660 filesystem is not availableAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA@A@AA@AAAA@AA@@AA Ausage: mount_cd9660 [-egrv] [-o options] [-s startsector] special node $FreeBSD: src/sbin/mount/getmntopts.c,v 1.9 1999/10/09 11:54:06 phk Exp $,-o %s: option not supported%s: not a directory%s: %s/LtenexEebcdicimageIbinaryAasciiusage: %s [ %s%s | ]Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.typeWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] STOUSTORAPPElocal-filesusage: %s local-files mputContinue with%s: not foundr+wwusage: %s remote-file [ local-file ] local: %sRETRremote-filesusage: %s remote-files mgetonoffand logged inConnected %sto %s. Not connected.Connected for proxy commands to %s. No proxy connection.(none)Gate ftp: %s, server %s, port %s. Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off.Nmap: (in) %s (out) %s Nmap: off.Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT cmds: %s. Command line editing: %s. Macros: %s usage: %s [ on | off ] %s %s. Bell modeEditing modePacket tracingusage: %s [ on | off | bytecount ] mark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark).Verbose modeUse of PORT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] %s: bad gateport value. %ldDisabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD.XCWD %susage: %s local-directory Local directory now %s getcwd: %susage: %s remote-file DELE %smdeletefrom-nameto-nameusage: %s from-name to-name RNFR %sRNTO %s-usage: %s remote-directory local-file nlistNLSTLISToutput to local-file:usage: %s remote-files local-file mlsSHELL/bin/shsh-c%sTry again laterusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed.PWDPWD command not recognized, trying XPWD.XPWDLocal directory %s getcwddirectory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD.XMKD %sRMD %sRMD command not recognized, trying XRMD.XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITE %smodefile-nameusage: %s mode file-name SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:commandusage: %s command ?Ambiguous command.?Invalid command.?Invalid proxy command. Case mappingCarriage Return strippingNtrans off.Nmap off.mapoutusage: %s [mapin mapout] nmap: unbalanced brackets.Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP.XCUPusage: %s [restart_point] restart: Invalid offset `%s' No restart point definedRestarting at %qd for next get, put or append SYSTLimit of 16 macros have already been defined.macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line.macdef: end of file encountered.Macro not defined - 4K buffer exceeded.Restricted data portsfilenameusage: %s filename %s %qd %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". PAGERmoreCan't allocate memory for $PAGER|%s?verboseuserumasktypetracetenexsystemsuniquestructstatussizesitesendportsendruniquerstatusrmdirrhelprestrictrestartresetrrrenameregetrecvquotequitpwdputcproxypromptprogresspreservepassivepageopenntransnmapnlistnewermsendLmputmoremodtimemodemlsmkdirmgetmdirRmdeletemacdeflslpwdlessllcdimageidleChelphashglobgategetftpformexiteditdisconnectrldirdeletedebugcrclosenrchmodcduprcdcasebyebinarybellasciilrappendaccount$!...Can't allocate memory for local dircompleteCan't allocate memory for remote dir %s Must be logged in to complete.44444444̈44444444444444444444444444444̈44444macro nameusage: %s macro_name '%s' macro not found. ?Ambiguous command.?Invalid command.Not connected.Can't allocate memory to parse URLhttp://ftp://url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %shost %s, port %s, path %s, save as %s. %s: %sCan't create socketCan't bind to %sCan't connect to %sRequesting %s Requesting %s (via %s) /GET %s%s HTTP/1.0 Writing HTTP request200Error retrieving file: %sContent-Length: Can't open %sWriting %sReading from socketSuccessfully retrieved file.Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %s http fetch aborted.ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.:@/Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'cd*?[]{}Retrieving %s/%s %s/%sgetmget%s: %ssocketbindconnect to address %sTrying %s... connectgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockopt---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUIT%c%c%c421 Service not available, remote server has closed connection.%s: send aborted waiting for remote to finish abort.sentlocal: %s remote: %s -%slocal: %s%s: not a plain file. STORAPPEREST %qdr+w%s %snetout receive aborted waiting for remote to finish abort.receivedRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly.Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: EPSV return code must be 229PASVLPSVPassive mode refused.wrong server: return code must be 227%d,%d,%d,%d,%d,%dwrong server: return code must be 228%d,%d,%d,%d,%d,%d,%d,%d,%d%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dwrong server: return code must be 229%c%c%c%d%cPassive mode address scan failure. Shouldn't happen!setsockopt (reuse address)setsockopt PORTRANGE (ignored)listenEPRT |%d|%s|%d|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dacceptSTOUproxy server does not support third party transfers.No primary connection.PORT %slocal: %s remote: %s abortresetrunique: can't find unique file name.Lost control connection for abort.%cABOR ftphttpFTPSERVERPORT%sftpgateTMPDIR/tmp/FTP_PASSIVE_MODEnopftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumb46adeginpP:s:tUvV%s: %s||||||||||||||||||||||||||(||||Xp|||||||||||||||||||||4L|dftp> sorry, input line too long.?Ambiguous command.?Invalid command.Not connected.!$Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46adeginptUvV] [-P port] [-s src_addr] [host [port]] %s host:path[/] %s ftp://host[:port]/path[/] %s http://host[:port]/file macdefmachineaccountpasswdpasswordlogindefaultHOME.%s/.netrc%s/.netrc: %sr%scan't strdup *anameanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.can't strdup *apassRemove account or make file unreadable by others.can't strdup *aacctMissing macdef name argument.Limit of 16 macros have already been defined.Macro definition missing null line terminator.4K macro buffer exceeded.Unknown .netrc keyword %sAlready connected to %s, use close first. tousage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s asciinon-printstreamfile8SYSTRemote system type is %s. 215 UNIX Type: L8binaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$initsorry, arguments too long.(%s) ftpXXXXXX%s/%sunable to create temporary file %swNLSTarcan't find list of remote files, oops.%s %s? Interactive mode: off.Prompting off for duration of %s. %s: not foundSIZE %sMDTM %s%*s %16s1919%03d%02d%02d%02d%02d%02d%04d%02d%02d%02d%02d%02dCan't convert %s to a time. KMGTP %3d%% **********************************************************************************************************************************************************|%.*s%*s| %5qd %c%c --:-- ETA - stalled -%2d: %02d:%02d ETA.AMKs%qd byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d .A>P?emacsContext sensitive argument completionftp-complete^I0isipv6addr: got %d for %sn%s sequence challenge /usr/bin/keyfork!^?offwontwilldontdohelpDisplay send options?Send request for STATUSgetstatusPerform Telnet 'Synch operation'synchSend Telnet End of File CharactereofSend Telnet 'Suspend Process'suspSend Telnet 'Abort Process'abortSend Telnet 'End of Record'eorSend Telnet 'No operation'nopintrinterruptintpSend Telnet Interrupt ProcessipSend Telnet 'Go Ahead' sequencegaSend current escape characterescapeSend Telnet Erase LineelSend Telnet Erase CharacterecbreakSend Telnet BreakbrkSend Telnet 'Are You There'aytSend Telnet Abort outputaoneed at least one argument for 'send' command 'send ?' for help Unknown send argument '%s' 'send ?' for help. Ambiguous send argument '%s' 'send ?' for help. sNeed %d argument%s to 'send %s' command. 'send %s ?' for help. ?Need to be connected first. There is not enough room in the buffer TO the network to process your request. Nothing will be done. ('send synch' will throw away most data in the network buffer, if this might help.) Telnet 'send' error - argument disappeared! SENTUsage: send %s "value" must be from 0 to 255 Valid options are: "%s" '%s': ambiguous argument ('send %s ?' for help). '%s': unknown argument ('send %s ?' for help). '%s': bad value ('send %s ?' for help). %-15s %s setsockopt (SO_DEBUG)Will send carriage returns as telnet . Will send carriage returns as telnet . Already operating in binary mode with remote host. Negotiating binary mode with remote host. Already in network ascii mode with remote host. Negotiating network ascii mode with remote host. Already receiving in binary mode. Negotiating binary mode on input. Already receiving in network ascii mode. Negotiating network ascii mode on input. Already transmitting in binary mode. Negotiating binary mode on output. Already transmitting in network ascii mode. Negotiating network ascii mode on output. print hexadecimal representation of terminal traffic(debugging) toggle printing of hexadecimal terminal datatermdatashow option processingviewing of options processing (debugging)optionsprint user readable output for "netdata"output of "netdata" to user readable format (debugging)prettydumpprint hexadecimal representation of network trafficprinting of hexadecimal network data (debugging)netdataturn on socket level debuggingdebuggingdebug recognize certain control characterslocal recognition of certain control characterslocalcharsmap carriage return on outputmapping of received carriage returnscrmodsending carriage returns as telnet crlfsending of binary dataoutbinaryreceiving of binary datainbinarysending and receiving of binary databinaryskip reading of ~/.telnetrc filedon't read ~/.telnetrc fileskiprcsend interrupt characters in urgent modeautomatic sending of interrupt characters in urgent modeautosynchflush output when sending interrupt charactersflushing of output when sending interrupt charactersautoflush%-15s toggle %s display help informationenabledisable%-15s %s %s Need an argument to 'toggle' command. 'toggle ?' for help. '%s': ambiguous argument ('toggle ?' for help). '%s': unknown argument ('toggle ?' for help). WillWon't%s %s. alternate AYT characterforw2alternate end of line characterforw1character to use for XOFFstopcharacter to use for XONstartcharacter to use to erase a wordworderasecharacter to use for line reprintreprintcharacter to cause a Suspend Processcharacter to use for literal nextlnextcharacter to use to erase a linekillcharacter to use to erase a charactereraseThe following are for local editing in linemodecharacter to cause an EOF character to cause an Abort processquitcharacter to cause an Interrupt Processcharacter to cause an Abort OutputflushoutputThe following need 'localchars' to be toggled truefile to write trace information totracefilerlogin escape characterrlogincharacter to escape back to telnet command modecharacter to toggle local echoing on/offechoTelnet rlogin escape character is '%s'. Telnet escape character is '%s'. Format is 'set Name Value' 'set ?' for help. '%s': unknown argument ('set ?' for help). '%s': ambiguous argument ('set ?' for help). onFormat is 'set togglename [on|off]' 'set ?' for help. %s set to "%s". %s character is '%s'. Need an argument to 'unset' command. 'unset ?' for help. '%s': unknown argument ('unset ?' for help). '%s': ambiguous argument ('unset ?' for help). %s reset to "%s". ?Need to have LINEMODE option enabled first. 'mode ?' for help. Print help informationkludgelineDisable literal character echo-litecho+litechoEnable literal character echolitecho-softtabs+softtabsEnable tab expansionsofttabsDisable character editing-edit+editEnable character editingeditDisable signal trapping-isig+isigEnable signal trappingisigThese require the LINEMODE option to be enabled(or enable obsolete line-by-line mode)Enable LINEMODE optionline(or disable obsolete line-by-line mode)Disable LINEMODE optioncharacterformat is: 'mode Mode', where 'Mode' is one of: 'mode' command requires an argument Unknown mode '%s' ('mode ?' for help). Ambiguous mode '%s' ('mode ?' for help). won't %s. %-15s [%s] %-15s "%s" ?Ambiguous argument '%s'. ?Unknown argument '%s'. Deprecated usage - please use 'set escape%s%s' in the future. new escape character: Escape character is '%s'. Deprecated usage - please use 'toggle crmod' in the future. %s map carriage return on output. Fork failed SHELL/bin/sh-cExeclConnection closed. fromquitbyeVerify remote special character definitionscheckUse remote special character definitionsimportUse local special character definitionsexportNeed an argument to 'slc' command. 'slc ?' for help. '%s': unknown argument ('slc ?' for help). '%s': ambiguous argument ('slc ?' for help). List the current environment variableslistSend an environment variablesendDon't mark an environment variable for automatic exportunexportMark an environment variable for automatic exportUndefine an environment variableundefineDefine an environment variabledefineNeed an argument to 'environ' command. 'environ ?' for help. '%s': unknown argument ('environ ?' for help). '%s': ambiguous argument ('environ ?' for help). only Need %s%d argument%s to 'environ %s' command. 'environ ?' for help. DISPLAYunix:%s%sUSERLOGNAMEPRINTERCannot send '%s': Telnet ENVIRON option not enabled Cannot send '%s': variable not defined %c %-20s %s Connected to %s. notmuchOperating with LINEMODE option LocalNo%s line editing %s catching of signals Operating in obsolete linemode Operating in single character mode Catching signals locally Remote%s character echo %s flow control No connection. status?Already connected to %s open (to) -l-a-susage: telnet [-l user] [-a] [-s src_addr] host-name [port] %s: %s telnetBad source route option: %s Trying %s... telnet: socketsetsockopt (source route)telnet: setsockopt (IP_TOS) (ignored)bindconnect to address %sUnable to connect to remote hostConnection closed by foreign host. skeyenvironzslctoggleunsetsetopenmodedisplaylogoutclose%s> %s ?Ambiguous command ?Invalid command Commands may be abbreviated. Commands are: %-*s %s ?Ambiguous help command %s ?Invalid help command %s HOME/.telnetrcrDEFAULT?Ambiguous command: %s ?Invalid command: %s ?Need to be connected first for %s. [host-name [port]][-r] [-s src_addr] [-n tracefile] [-4] [-6] [-8] [-E] [-L] [-N] [-S tos] [-a] [-c] [-d] [-e char] [-l user]Usage: %s %s%s%s%s rlog468EKLNS:X:acde:fFk:l:n:rs:t:x%s: Warning: -S ignored, no parsetos() support. %s: Warning: -f ignored, no Kerberos V5 support. %s: Warning: -F ignored, no Kerberos V5 support. %s: Warning: -k ignored, no Kerberos V4 support. %s: Warning: -t ignored, no TN3270 support. %s: Warning: -x ignored, no ENCRYPT support. -l-sN{=xBu<q?i?gIdNaI^K[LXMwswmwlwiwawttytypettytstotltagswsmdsmslowshsectscrroreparaoptnumodelinesliichtgtexedebdircobfawapaiCDPATH:cdpath=%sTMPDIR/tmpdirectory=%sescapetime=6keytime=6matchtime=7/usr/share/vi/catalog/msgcat=%sreport=5paragraphs=IPLPPPQPP LIpplpipbppath=%s/var/tmp/vi.recoverrecdir=%ssections=NHSHH HUnhshSHELL/bin/shshell=%sshellmeta=~{[*?$`'"\shiftwidth=8sidescroll=16tabstop=8tags=%sscroll=%ldwindow=%lu031|Unable to set default %s optionall032|Usage: %s291|set: the %s option may not be turned off313|set: the %s option may never be turned on034|set: [no]%s option doesn't take a value035|set: %s option isn't a boolean036|set: %s option: %s037|set: %s option: %s: value overflow038|set: %s option: %s is an illegal number314|set: the %s option may never be set to 0039|set: %s option isn't a boolean305|No %s edit option specified%ld%*s no%s%s%s=%ld%s="%s"set %s set no%s set %s=%-3ld set 033|set: no %s option: 'set all' gives all option values@(#)options_f.c 10.25 (Berkeley) 7/12/96040|Screen columns too small, less than %d041|Screen columns too large, greater than %d042|Screen lines too small, less than %d043|Screen lines too large, greater than %d044|The lisp option is not implemented048|The paragraph option must be in two character groups049|The section option must be in two character groups@(#)put.c 10.11 (Berkeley) 9/23/96053|The default buffer is empty054|Buffer %s is empty@(#)screen.c 10.15 (Berkeley) 9/15/96@(#)search.c 10.25 (Berkeley) 6/30/96072|File empty; nothing to search073|Reached end-of-file without finding the pattern074|No previous search pattern075|Pattern not found076|Reached top-of-file without finding the pattern077|Search wrappedyz zz$z0z078|Searching...@(#)seq.c 10.10 (Berkeley) 3/30/96 %s@(#)recover.c 10.21 (Berkeley) 9/15/96%s055|Files with newlines in the name are unrecoverable%s/vi.XXXXXX056|Modifications not recoverable if the session fails057|Copying file for recovery...058|Preservation failed: %s059|Modifications not recoverable if the session fails060|File backup failed: %s061|Copying file for recovery...062|Information on user id %u not found%s/recover.XXXXXX063|Unable to lock recovery filePrecedence: bulkSubject: Nvi saved the file To: From: root (Nvi recovery program)Reply-To: rootX-vi-recover-path: X-vi-recover-file: %s%s %s%s %s %s %s%s %s%s %s -r : to this file using the -r option to You can recover most, if not all, of the changes , when it was saved for recovery. on the machine was editing a file named , the user On %s%.24s%s%s%s%s%s%s%s%s%s%s%s%s%s%s 064|Recovery file buffer overrun065|Recovery file.recdir: %srecover.r+066|%s: malformed recovery file%.24s: %s vi: no files to recover. %s/%s067|%s: malformed recovery file068|No files named %s, readable by you, to recover069|There are older versions of this file for you to recover070|There are other files for you to recover/usr/sbin/sendmail071|not sending email: %s%s -t < %s@(#)util.c 10.11 (Berkeley) 9/15/96@(#)ex.c 10.57 (Berkeley) 10/10/96script 170|Interrupted!#&*<=>@~080|Unknown command name1bca1082|%s: command not available in ex mode083|Count may not be zero084|%s: bad line specification085|Internal syntax table error (%s: %s)lr086|Usage: %s088|Flag offset to before line 1089|Flag offset past end-of-file090|@ with range running when the file/screen changed091|Global/v command running when the file/screen changed092|Ex command failed: pending commands discarded093|Ex command failed: mapped keys discarded<<rrrrrrr<r<rrr<r<rrrrrrrrrrrrrȞx$$4(@$PPH$HHH$094|The second address is smaller than the firstmxxxxxxxxxxxxxxxxxxxxxxmxxxxXxxxxxxxxxxxxxxxxxxxxɻ$0123456789'\/?.+-^095|No mark name supplied096|\ not followed by / or ?097|Reference to a line number less than 0         L˿ľľľľľľľľľľ     Կ                            098|The %s command is unknown099|Address value overflow100|Address value underflow101|Illegal address combination102|Illegal address: only %lu lines in the file103|Illegal address: the file is empty104|The %s command doesn't permit an address of 0$@(#)ex_abbrev.c 10.7 (Berkeley) 3/6/96105|No abbreviations to display106|Abbreviations must end with a "word" character107|Abbreviations may not contain tabs or spaces108|Abbreviations may not mix word/non-word characters, except at the end109|"%s" is not an abbreviation@(#)ex_append.c 10.30 (Berkeley) 10/23/96 273|Entering ex input mode.@(#)ex_args.c 10.16 (Berkeley) 7/13/96111|No more files to edit112|No previous files to edit113|No previous files to rewind114|No file list to display ][%s%s%s@(#)ex_argv.c 10.26 (Berkeley) 9/20/96echo 115|No previous command to replace "!"116|No filename to substitute for %%117|No filename to substitute for #./%s304|Shell expansion failed289|Shell expansions not supported when the secure edit option is setpiperfdopenvfork-c118|Error: execl: %s119|I/O error: %s@(#)ex_at.c 10.12 (Berkeley) 9/15/96@(#)ex_bang.c 10.33 (Berkeley) 9/23/96!!%s 303|File modified since last write.! @(#)ex_cd.c 10.10 (Berkeley) 8/12/96120|File modified since last complete write; write or use ! to overrideHOME121|Unable to find home directory location%s/%s122|New current directory: %s%s@(#)ex_cmd.c 10.20 (Berkeley) 10/10/96(3 @n@!2 0f zigdZ B@` 1|Z Bi1pYN8L4 A "_\WE("W ( , Bl@ B @7@ 3@ 3D  3`]A 3P   ha1N3.# B)* 2 @ - B* x' oh* j[HC ? 2 a0 D (3  4e 4X T1 <v`: q`@(: <; 11 j|uA rb@ȉ a @C WT @( U  `_ ` `  , Bkg RJP =(!L  Б ws 4i@14 @*T)  `  $ !`@ 3&ܱ  $da $@t $ $WpkP g@   f ` replace previous RE with previous replacement string,[line [,line]] ~ [cgr] [count] [#lp]~display different screens of the file[line] z [-|.|+|^|=] [count] [flags]3c01zcopy lines to a cut buffer[line [,line]] ya[nk] [buffer] [count]bcayankexit[line [,line]] x[it][!] [file]xitwrite the file and exit[line [,line]] wq[!] [>>] [file]wqwrite the file and switch to the next file[line [,line]] wn[!] [>>] [file]wnwrite the file[line [,line]] w[rite][!] [ !cmd | [>>] [file]]writedisplay vi key usage statement[viu]sage [key]viusageedit another file (from vi mode only)[Vv]i[sual][!] [+cmd] [file]enter visual (vi) mode from ex mode[line] vi[sual] [-|.|+|^] [window_size] [flags]2c11visualdisplay the program version informationversionexecute a global command on lines NOT matching an RE[line [,line]] v [;/]RE[;/] [commands]vdelete an input or command mapunm[ap][!] word!w1runmapdelete an abbreviationuna[bbrev] wordunabbreviateundo the most recent changeu[ndo]undorun the tcl interpreter with the commandtc[l] cmdtcldiscard all tagstagt[op][!]tagtopmove to the previous tagtagpr[ev][!]tagprevreturn to the previous group of tagstagp[op][!] [number | file]tagpopmove to the next tagtagn[ext][!]tagnext[Tt]a[g][!] [string]tag[line [,line]] t line [flags]tsu[spend][!]suspendsuspend the edit sessionst[op][!]stopread a file of ex commandsso[urce] filef1rsourcesuspend editing and run a shellsh[ell]shellset options (use ":set all" to see all options)se[t] [option[=[value]]...] [nooption ...] [option? ...] [all]wNsetrun a shell in a screensc[ript][!] [file]scriptsubstitute on lines matching an RE[line [,line]] s [[/;]RE[/;]repl[/;] [cgr] [count] [#lp]]edit the file containing the tag[Rr]ta[g][!] [string]!w1ortagre-edit all the files in the file argument listrew[ind][!]rewindgrow or shrink the current screenresize [+-]rowsc+resizerecover a saved filerecover[!] filerecoverappend input from a command or file to the line[line] r[ead] [!cmd | [file]]readexit ex/viq[uit][!]quitappend a cut buffer to the line[line] pu[t] [buffer]putedit the previous file in the file argument list[Pp]rev[ious][!]previouspreserve an edit session for recoverypre[serve]preserverun the perl interpreter with the command, on each lineperld[o] cmdperldorun the perl interpreter with the commandpe[rl] cmdperldisplay lines[line [,line]] p[rint] [count] [#l]printenter "open" mode (not implemented)[line] o[pen] [/RE/] [flags]openchange display to number lines[line [,line]] nu[mber] [count] [l]numberedit (and optionally specify) the next file[Nn][ext][!] [+cmd] [file ...]!fNnextwrite a .exrc filemkexrc[!] file!f1rmkexrcmap input or commands to one or more keysmap[!] [keys replace]!Wmap[line] ma[rk] keymarkmove lines elsewhere in the file[line [,line]] m[ove] linelmovedisplay lines in an unambiguous form[line [,line]] l[ist] [count] [#]listmark a line position[line] k keykjoin lines into a single line[line [,line]] j[oin][!] [count] [flags]!ca1joininsert input before a line[line] i[nsert][!]insertdisplay help statementhe[lp]helpexecute a global command on lines matching an RE[line [,line]] g[lobal][!] [;/]RE[;/] [commands]globalbring a backgrounded screen into the foreground[Ff]g [file]fgdisplay (and optionally set) file namef[ile] [name]filedisplay ex command usage statement[exu]sage [command]w1oexusage[Ee]x[!] [+cmd] [file]exbegin editing another file[Ee][dit][!] [+cmd] [file]f1oeditdisplay buffers, connections, screens or tagsdisplay b[uffers] | c[onnections] | s[creens] | t[ags]w1rdisplaydelete lines from the file[line [,line]] d[elete][flags] [buffer] [count] [flags]bca1deletecreate a set of tags using a cscope commandcs[cope] command [args]!scscopecopy lines elsewhere in the file[line [,line]] co[py] line [flags]l1copychd[ir][!] [directory]chdirchange the current directorycd[!] [directory]!f1ocdchange lines to input[line [,line]] c[hange][!] [count]!cachangeput a foreground screen into the backgroundbgdisplay file argument listar[gs]argsspecify an input abbreviationab[brev] [word replace]Wabbreviateappend input to a line[line] a[ppend][!]append@ [buffer]@shift lines right[line [,line]] >[>...] [count] [flags]>display line number[line] = [flags]1=shift lines left[line [,line]] <[<...] [count] [flags]<execute a buffer* [buffer]b*repeat the last subsitution[line [,line]] & [cgr] [count] [#lp]s&display numbered lines[line [,line]] # [count] [l]ca1#filter lines through commands or run commands[line [,line]] ! commandS!scroll lines^D@(#)ex_cscope.c 10.13 (Berkeley) 9/15/96vt\GB   ymg @gDiscard all current cscope connectionsresetkill numberKill a cscope connectionkillhelp [command]Show help for cscope commandshelpfind c|d|e|f|g|i|s|t buffer|pattern c: find callers of name d: find all function calls made from name e: find pattern f: find files with name as substring g: find definition of name i: find files #including name s: find all uses of name t: find assignments to nameQuery the databases for a patternfindadd file | directoryAdd a new cscope databaseadd309|Use "cscope help" for helpCSCOPE_DIRS :cscope.out%s/%scscope.tpath%s:pipevforkcd '%s' && exec cscope -dl -f %s-csh/bin/shexecl: %swr310|No cscope connections running%d%s 278|No matches for querysgdct efi311|%s: unknown search type: use one of %scscope: %d lines%1[ ]%s: "%s" %s doesn't match any cscope command Command: %s (%s) Usage: %s cscope commands: %*s: %s 312|%d: no such cscope session1No cscope connections. %2d %s (process %lu) @(#)ex_delete.c 10.9 (Berkeley) 10/23/96@(#)ex_display.c 10.12 (Berkeley) 4/10/96buffersconnectionsscreenstags123|No cut buffers to displaydefault buffer (line mode) (character mode)********** %s%s @(#)ex_edit.c 10.10 (Berkeley) 4/27/96@(#)ex_equal.c 10.10 (Berkeley) 3/6/96%ld @(#)ex_file.c 10.12 (Berkeley) 7/12/96@(#)ex_filter.c 10.34 (Berkeley) 10/23/96piperfdopenvfork-cexecl: %sfilterforkwparent-writerfilter read@(#)ex_global.c 10.22 (Berkeley) 10/10/96124|The %s command can't be used as part of a global or v commandpp@(#)ex_init.c 10.26 (Berkeley) 8/12/96/etc/vi.exrcNEXINITEXINITHOME.nexrc%s/%s.exrc125|%s/%s: not sourced: not owned by you or root126|%s/%s: not sourced: not owned by you127|%s/%s: not sourced: writeable by a user other than the owner128|%s: not sourced: not owned by you or root129|%s: not sourced: not owned by you130|%s: not sourced: writeable by a user other than the owner@(#)ex_join.c 10.10 (Berkeley) 9/15/96131|No following lines to join.?!@(#)ex_map.c 10.9 (Berkeley) 3/6/96132|No input map entries133|No command map entries134|The %s character may not be remapped135|"%s" isn't currently mapped@(#)ex_mark.c 10.8 (Berkeley) 3/6/96136|Mark names must be a single character@(#)ex_mkexrc.c 10.11 (Berkeley) 3/6/96.exrc137|%s exists, not written; use ! to override%swabbreviate map map! 138|New exrc file: %s@(#)ex_move.c 10.10 (Berkeley) 9/15/96139|Destination line is inside move range@(#)ex_open.c 10.7 (Berkeley) 3/6/96140|The open command requires that the open option be set141|The open command is not yet implemented@(#)ex_preserve.c 10.12 (Berkeley) 4/27/96142|Preservation of this file not possible143|File preserved@(#)ex_print.c 10.18 (Berkeley) 5/12/96%6lu TOOBIG $ [ynq]%c@(#)ex_put.c 10.7 (Berkeley) 3/6/96@(#)ex_quit.c 10.7 (Berkeley) 4/27/96@(#)ex_read.c 10.38 (Berkeley) 8/12/96!!%s ! r%s145|Only regular files and named pipes may be read146|%s: read lock was unavailable147|Reading...148|%s: %lu lines, %lu characters@(#)ex_screen.c 10.11 (Berkeley) 6/29/96149|No background screens to display @(#)ex_script.c 10.30 (Berkeley) 9/24/96150|The script command is only available in vi modetcgetattrptyforkemacsTERMemacs:TERMCAPtEMACS-iexecl: %sselectError: timed outError: shell: EOFshell151|No command to execute script-shellttypqrs0123456789abcdef@(#)ex_set.c 10.7 (Berkeley) 3/6/96@(#)ex_shell.c 10.38 (Berkeley) 8/19/96%s -i vfork-cexecl: %swaitpid; core dumped ...%.*s%s: received signal: %s%s%.*s%s: exited with status %d'   v^Y F3 # kT<Filesize limit exceededCputime limit exceededWindow size changesVirtual timer expiredUser defined signal 2User defined signal 1Urgent I/O conditionStopped (tty output)Stopped (tty input)SuspendedTrace/BPT trapTerminatedBad system callSuspended (signal)Segmentation faultQuitProfiling timer expiredBroken pipeKilledIOT trapI/O possibleInterruptInformation requestIllegal instructionHangupFloating point exceptionEMT trapContinuedChild exitedBus errorAlarm clockAbort trapUnknown signal: %d@(#)ex_shift.c 10.11 (Berkeley) 9/15/96152|shiftwidth option set to 0@(#)ex_source.c 10.12 (Berkeley) 8/10/96%s@(#)ex_stop.c 10.10 (Berkeley) 3/6/96@(#)ex_subst.c 10.37 (Berkeley) 9/15/96153|Count overflow154|Count underflow155|Regular expression specified; r flag meaningless156|The #, l and p flags may not be combined with the c flag in vi mode169|Confirm change? [n]157|No match foundi i i i i i i i i i i i i i i i i i i i i i i i i i (i i i i i i i i 4h i @h i i Lh Lh Lh Lh Lh Lh Lh Lh Lh Lh i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i 8i i i i ti i i i i i i i i i i i [[:<:]][[:>:]]^.[]$*([ ]|/\*([^*]|\*/)*\*/)*\^.[]$*+?()|{}RE error: %s          ` ` ` ` ` ` ` ` ` `            `                                `       p          @(#)ex_tag.c 10.36 (Berkeley) 9/15/96158|No previous tag entered282|Already at the last tag of this group255|Already at the first tag of this group159|Less than %s entries on the tags stack; use :display t[ags]160|No file %s on the tags stack to return to; use :display t[ags]292|Display too small.%2d ... %*.*s %*.*s* %s%.*s 164|%s: the tag's line number is past the end of the file165|The tags stack is empty166|%s: search pattern not foundrxxglobal -%s '%s'r162|%s: tag not found%s 163|%s: corrupted tag in %smunmapclose%s/%s@(#)ex_txt.c 10.17 (Berkeley) 10/10/964  4 Ĩ        ̩  Ы Ы Ы Ы t Ы Ы Ы ~ Ы Ы Ы Ы Ы Ы Ы  %c%6lu %.*s@(#)ex_undo.c 10.6 (Berkeley) 3/6/96@(#)ex_usage.c 10.13 (Berkeley) 5/3/96To see the list of vi commands, enter ":viusage" To see the list of ex commands, enter ":exusage" For an ex command usage statement enter ":exusage [cmd]" For a vi key usage statement enter ":viusage [key]" To exit, enter ":q!" The %.*s command is unknown Command: %s Usage: %s ^D%*s: %s The %s key has no current meaning Key:%s%s Usage: %s %s @(#)ex_util.c 10.23 (Berkeley) 6/19/96167|%d more files to edit168|Buffer %s is empty144|%s: expanded into too many file names283|The %s command requires the ex terminal interface272|That form of %s requires the ex terminal interface274|Command failed, no file read in yet.173|The %s command requires that a file have already been read in171|No previous buffer to execute172|No previous regular expression230|This screen may not be suspended290|The %s command is not supported when the secure edit option is set284|That form of %s is not supported when the secure edit option is set174|Usage: %s|      ȶ Զ    @(#)ex_version.c 10.31 (Berkeley) 8/22/96Version 1.79 (10/23/96) The CSRG, University of California, Berkeley.@(#)ex_visual.c 10.13 (Berkeley) 6/28/96175|The visual command requires that the open option be set%luz%c%lu%luz%c @(#)ex_write.c 10.30 (Berkeley) 7/12/96! 253|Writing...%s@(#)ex_yank.c 10.7 (Berkeley) 3/6/96@(#)ex_z.c 10.10 (Berkeley) 3/6/96---------------------------------------- @(#)ex_tcl.c 8.10 (Berkeley) 9/15/96302|Vi was not loaded with a Tcl interpreter@(#)ex_perl.c 8.10 (Berkeley) 9/15/96306|Vi was not loaded with a Perl interpreter@(#)getc.c 10.10 (Berkeley) 3/6/96177|Empty file@  @  | @(#)v_at.c 10.8 (Berkeley) 4/27/96 %lu@(#)v_ch.c 10.8 (Berkeley) 3/6/96    $ t     178|No previous F, f, T or t search179|%s not found@(#)v_cmd.c 10.9 (Berkeley) 3/28/96, "@T"11  0000  0`0 <0$0  00 //h  D// D// // HD/`/ DJ/4/T D*// //  @..d  .... .. .v. s.a.U. .l ..  @.-l --D  D--  ,`- -  ,,  D,, "@D,, ,, (C,`, "@DL,6,p "@D-,, HD ,+<  D++T HD+`+K+0+T "@"++4  @+*8 **  D**P  ,s*U*  ,?* *< "@*)  ))  ))c  D)))~)t)[) `  DR)8)  F%)) HE((( E((  (`(  P(B( E9( (p E(( "@('  ''\  ''l 'm'  d'N'=''H  F '&,Y  &&[  D&&Th  &`&A&4&l 1&&   @D&&  @D&%  D%% @D%% "B%%H  %v%c  Dm%[%  =%)%  %$$`  D$$@  F$$h  D$s$p  j$R$ DI$3$T D*$$D  D $# ## "@(#  ##  ##(  \#G#  6##  F #"\Y  ""\  D""g  ""h  i"@"i @"!l "@D!!`  D!!x "@D!!U  !p! ~ reverse case[count]~ } move forward paragraph[count]} | move to column[count]| { move back paragraph[count]{ z reposition the screen[line]z[window_size][-|.|+|^|] y copy text to motion into a cut buffer[buffer][count]y[count]motion x delete character[buffer][count]x w move to next word[count]w u undo last changeu t before character in line forward search[count]t character s substitute character[buffer][count]s r replace character[count]r character p insert after cursor from buffer[buffer]p o append after line[count]o n repeat last search m set markm[a-z] l move right by columns[count]l k move up by lines[count]k j move down by lines[count]j i insert before cursor[count]i h move left by columns[count]h f character in line forward search[count]f character e move to end of word[count]e d delete to motion[buffer][count]d[count]motion c change to motion[buffer][count]c[count]motion b move back word[count]b a append after cursor[count]a ` move to mark`[`a-z] _ move to first non-blank_ ^ move to first non-blank^]] move forward section]][[ move back section[[ZZ save file and exitZZ Y copy line[buffer][count]Y X delete character before cursor[buffer][count]X W move to next bigword[count]W U Restore the current lineU T before character in line backward search[count]T character S substitute for the line(s)[buffer][count]S R replace characters[count]R Q switch to ex modeQ P insert before cursor from buffer[buffer]P O insert above line[count]O N reverse last searchn M move to screen middleM L move to screen bottom[count]L J join lines[count]J I insert before first nonblank[count]I H move to count lines from screen top[count]H G move to line[count]G F character in line backward search[count]F character E move to end of bigword[count]E D delete to end-of-line[buffer]D C change to end-of-line[buffer][count]C B move back bigword[count]B A append to the line[count]A @ execute buffer@buffer ? search backward?RE[? offset] > shift lines right to motion[count]>[count]motion < shift lines left to motion[count]<[count]motion ; repeat last F, f, T or t search[count]; : ex command:command [| command] ... 0 move to first character0 / search forward/RE[/ offset] . repeat the last command. - move up by lines (to first non-blank)[count]- , reverse last F, f, T or t search[count], + move down by lines (to first non-blank)[count]+ ) move forward sentence[count]) ( move back sentence[count]( ' move to mark (to first non-blank)'['a-z] & repeat substitution& % move to match% $ move to last column [count]$ # number increment/decrement[count]# +|-|# ! filter through command(s) to motion[count]![count]motion command(s) move right by columns[count]' '^^ switch to previous file^^^] tag push cursor word^] ^\ switch to ex mode^\^[ exit input mode, cancel partial commands^[ ^Z suspend editor^Z^Y page up by lines[count]^Y^W move to next screen^W^V input a literal character^V^U half page up (set count)[count]^U^T tag pop^T^R redraw screen^R^P move up by lines[count]^P^N move down by lines[count]^N^M move down by lines (to first non-blank)[count]^M^L redraw screen^L^J move down by lines[count]^J^H move left by characters[count]^H^G file status^G^F scroll down by screens[count]^F^E scroll down by lines[count]^E^D scroll down by half screens (setting count)[count]^D^C interrupt an operation (e.g. read, write, search)^C^B scroll up by screens[count]^B^A search forward for cursor word[count]^A@(#)v_delete.c 10.9 (Berkeley) 10/23/96@(#)v_ex.c 10.42 (Berkeley) 6/28/96207|The Q command requires the ex terminal interface <>suspend180|No previous file to edit!307|No ex command to execute@(#)v_increment.c 10.12 (Berkeley) 3/19/9622222%#0*lo0x%0*lx0X%0*lX%+ld%ldabcdefABCDEF181|Cursor not in a number182|Resulting number too large183|Resulting number too small@(#)v_init.c 10.8 (Berkeley) 3/30/96@(#)v_itxt.c 10.16 (Berkeley) 10/23/96@(#)v_left.c 10.7 (Berkeley) 3/6/96@(#)v_mark.c 10.8 (Berkeley) 9/20/96@(#)v_match.c 10.8 (Berkeley) 3/6/96184|No match character on this line185|Matching character not found@(#)v_paragraph.c 10.7 (Berkeley) 3/6/96@(#)v_put.c 10.5 (Berkeley) 3/6/96        @(#)v_redraw.c 10.6 (Berkeley) 3/6/96@(#)v_replace.c 10.17 (Berkeley) 6/30/96186|No characters to replace X X 6  t     d @(#)v_right.c 10.7 (Berkeley) 3/6/96@(#)v_screen.c 10.10 (Berkeley) 4/27/96308|Enter to execute a command, :q to exit187|No other screen to switch to@(#)v_scroll.c 10.9 (Berkeley) 4/27/96@(#)v_search.c 10.18 (Berkeley) 9/19/96search+%lu188|Characters after search string, line offset and/or z command[[:>:]][[:<:]]%s%s%s189|No previous search pattern190|Search wrapped to original position@(#)v_section.c 10.7 (Berkeley) 3/6/96@(#)v_sentence.c 10.7 (Berkeley) 3/6/96 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0    0 0 0 0  0  0 0 0 0  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0  @(#)v_status.c 10.9 (Berkeley) 5/15/96@(#)v_txt.c 10.87 (Berkeley) 10/13/96191|Abbreviation exceeded expansion limit: characters discarded 192|Illegal character; quote to enter" ! ! 8+ ! ! ! ! ! ! ! @2 , - 2 2 2 2 % * 2 x2 % ,2 ,2 2 L. T1 P2 . , 193|Already at the beginning of the insert%s %s%*s Unmatched %s194|No more characters to erase@(#)v_ulcase.c 10.7 (Berkeley) 3/6/96@(#)v_undo.c 10.5 (Berkeley) 3/6/96@(#)v_util.c 10.11 (Berkeley) 6/30/96195|Movement past the end-of-file196|Movement past the end-of-line197|No cursor movement made198|Already at the beginning of the file199|Movement past the beginning of the file200|Already in the first column201|Buffers should be specified before the command209|The file is empty202|Already at end-of-file203|Already at end-of-line204|%s isn't a vi commandWindow resize interrupted text input mode205|Usage: %s[ [ [ [ [ [ [ [ @(#)v_word.c 10.5 (Berkeley) 3/6/96@(#)v_xchar.c 10.9 (Berkeley) 10/23/96206|No characters to delete@(#)v_yank.c 10.9 (Berkeley) 5/19/96@(#)v_z.c 10.10 (Berkeley) 5/16/96@(#)v_zexit.c 10.6 (Berkeley) 4/27/96@(#)vi.c 10.57 (Berkeley) 10/13/96110|Vi command failed: mapped keys discarded231|Interrupted: mapped keys discarded236|Interruptedsn n p s n q V  ,AA ~ change case to motion[count]~[count]motion234|Only one buffer may be specified208|No command to repeat210|%s may not be used as a motion command211|Already in command mode214|Windows option value is too large, max is %u%d screens backgrounded; use :display to list them212|Cursor not in a word235|Number larger than %lu ͂ ͂  Ԃ       Ԃ @(#)vs_line.c 10.19 (Berkeley) 9/26/96%7lu @(#)vs_msg.c 10.77 (Berkeley) 10/13/96|/-\%s %.*s. ; .+=+=+=+=+=+=+=+%.*s @(#)vs_refresh.c 10.44 (Berkeley) 10/13/96NDCD7D,D D219|Replace218|Insert217|Command216|Change215|Append%lu,%lu @(#)vs_relative.c 10.11 (Berkeley) 5/13/96@(#)vs_smap.c 10.25 (Berkeley) 7/12/96        220|Movement past the end-of-screen221|Movement past the beginning-of-screen@(#)vs_split.c 10.31 (Berkeley) 10/13/96222|Screen must be larger than %d lines to split223|There are no background screens224|There's no background screen editing a file named %s225|You may not background your only displayed screen227|The screen cannot shrink228|The screen cannot grow226|The screen can only shrink to %d rowsMemory exhausted:blank:]:cntrl:]:graph:]:print:]:alnum:]:punct:]:space:]:xdigit:]:digit:]:lower:]:upper:]:alpha:]Unfinished \ escapeunfinished repeat countmalformed repeat countUnbalanced [ P P P P P P P P P P P P P P P P P P P P P P P P P  P P  0 l  4 P P  P P x x x x x x x x x P P  P 0  P P  P P P P P P P P P P P P P P P P P P P P $ P P P  8 P d P  P \ P P P P P P P P P P P P P P P P P P P P $ P P P                     Unbalanced (No syntax specifiedUnbalanced )                   d d out of memoryPOSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: invalid option -- %c %s: option requires an argument -- %c %s: option `-W %s' is ambiguous %s: option `-W %s' doesn't allow an argument 0123456789A:B:C::EFGHIRUVX:abcd:e:f:hiLlnqrsuvwxyZzword-regexpwith-filenameversionunix-byte-offsetsbinarytextsilentinvert-matchregexprecursivequietnull-datanulldecompressno-messagesno-filenamemmapline-regexpline-numberignore-casehelpfixed-stringsfixed-regexpfiles-without-matchfiles-with-matchesfileextended-regexpdirectoriescountcontextbyte-offsetbinary-filesbefore-contextbasic-regexpafter-context%s: %s: %s %s: %s memory exhaustedrfstatlseek%s%cwriting output--Binary file %s matches (standard input)%d recursive directory loop%s: warning: %s: %s Memory exhaustedUsage: %s [OPTION]... PATTERN [FILE]... Try `%s --help' for more information. Usage: %s [OPTION]... PATTERN [FILE] ... Search for PATTERN in each FILE or standard input. Example: %s -i 'hello world' menu.h main.c Regexp selection and interpretation: -E, --extended-regexp PATTERN is an extended regular expression -F, --fixed-strings PATTERN is a set of newline-separated strings -G, --basic-regexp PATTERN is a basic regular expression -e, --regexp=PATTERN use PATTERN as a regular expression -f, --file=FILE obtain PATTERN from FILE -i, --ignore-case ignore case distinctions -w, --word-regexp force PATTERN to match only whole words -x, --line-regexp force PATTERN to match only whole lines -z, --null-data a data line ends in 0 byte, not newline Miscellaneous: -s, --no-messages suppress error messages -v, --invert-match select non-matching lines -V, --version print version information and exit --help display this help and exit -Z, --decompress decompress input before searching (HAVE_LIBZ=1) --mmap use memory-mapped input if possible Output control: -b, --byte-offset print the byte offset with output lines -n, --line-number print line number with output lines -H, --with-filename print the filename for each match -h, --no-filename suppress the prefixing filename on output -q, --quiet, --silent suppress all normal output --binary-files=TYPE assume that binary files are TYPE TYPE is 'binary', 'text', or 'without-match'. -a, --text equivalent to --binary-files=text -I equivalent to --binary-files=without-match -d, --directories=ACTION how to handle directories ACTION is 'read', 'recurse', or 'skip'. -r, --recursive equivalent to --directories=recurse. -L, --files-without-match only print FILE names containing no match -l, --files-with-matches only print FILE names containing matches -c, --count only print a count of matching lines per FILE --null print 0 byte after FILE name Context control: -B, --before-context=NUM print NUM lines of leading context -A, --after-context=NUM print NUM lines of trailing context -C, --context[=NUM] print NUM (default 2) lines of output context unless overridden by -A or -B -NUM same as --context=NUM -U, --binary do not strip CR characters at EOL (MSDOS) -u, --unix-byte-offsets report offsets as if CRs were not there (MSDOS) `egrep' means `grep -E'. `fgrep' means `grep -F'. With no FILE, or when FILE is -, read standard input. If less than two FILEs given, assume -h. Exit status is 0 if match, 1 if no match, and 2 if trouble. Report bugs to . conflicting matchers specifiedGREP_OPTIONSinvalid context length argumentegrepfgrepgrepreadskiprecurseunknown directories method-without-matchunknown binary-files type2.4%s (GNU grep) %s Copyright (C) 1988, 1992-1998, 1999 Free Software Foundation, Inc. This is free software; see the source for copying conditions. There is NO warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. defaultZ Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z Z HV HV HV HV HV HV HV HV HV HV Z Z Z Z Z Z Z `V V V Z W (W 4W @W Z Z Z Y Z Z Z Z Z X Z Z Z LW Z \W Z PZ Z Z Z Z Z Z Z tW W W (X |X Z |Y Y Z Z Y Z Y Z Z Y X Z Z Z  Z 0Z @Z Y `Z Z Z Z Z Z lZ memory exhaustedmemory exhaustedfgrepawkegrepgrepdefaultmemory exhausted^\(\(^\|[^[:alnum:]_]\)\(\)\([^[:alnum:]_]\|$\)\)$^((^|[^[:alnum:]_])()([^[:alnum:]_]|$))$$FreeBSD: src/crypto/telnet/libtelnet/genget.c,v 1.2.8.1 2000/09/20 02:32:05 jkh Exp $\\#$FreeBSD: src/lib/libutil/logwtmp.c,v 1.14 2000/01/15 03:26:54 shin Exp $0123456789invalid hostname%d/var/log/wtmp%d%02d%03d Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ L Ԇ Ԇ Ԇ Ԇ Ԇ  Ԇ Ԇ  Ԇ Ԇ Ԇ  ܅ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ x Ԇ Ԇ Ԇ  Ԇ Ć Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ Ԇ  Ԇ Ԇ Ԇ Ԇ p Ԇ Ԇ Ԇ Ԇ  Ԇ Ԇ Ԇ `  dddddddddddddddd}dzdwdtdqdndkdhdedbd_d\dYdVdSdPdMdJdGdDdAd>d;d8d5d2d/d,dxrptNLMTncnsbsYGYFYEYDYCYBYAhlutccNDNPNRHC5inxxoulhzxtesosmsmidbdainhskmhcgneoxnxsxbambweeeeeeeeeeeeeeeeeeeeeee}ezeweteqenekeheeebe_e\eYeVeSePekndTdBdNdCugYpYoBTYnYmYlYkYjYiYhYgYfYeYdYcYbYaNCpaCoMWmalwlhNlwsvtpbsglmliitcoqq q qqqqppppppppppppppppppppppppppppppppppppppppppp|pypvpspppmpjpgpdpap^p[pXpUpRpOpLpIpFpCp@p=p:p7p4p1p.p+p(p%p"ppppppp p ppppooooooooooooooooooooooooooooooooooooooooooo}ozowotoqonokohoeobo_o\oYoVoSoPoMoJoGoDoAo>o;o8o5o2o/o,o)o&o#o ooooooo oooonnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn~n{nxnunrnonlninfncn`n]nZnWnTnQnNnKnHnEnBn?n850-(%"kcuu1uptakhtsstkentnlkcuf1ndkcub1lekICimkich1ickhomehokrmireikcud1dokdl1dlkdch1dctbcctkclrclkelcekedcdkcbtbtkil1al  %s$<%d>hardware tabs with a width other than 8: %dhardware tabs with a non-^I tab string %sunknown capability `%.*s' in ko stringko translation table is invalid, I give upno value for ko capability %s%s (%s) already has an explicit value %s, ignoring koacsc string synthesized from XENIX capabilities``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~acsc string synthesized from AIX capabilitiesHOMEOut of memory%s/.terminfo@%&*!#Illegal character (expected alphanumeric or %s) - %spremature EOFempty longname fieldwhitespace in name or alias fieldslashes aren't allowed in names or aliases$[]!*?dubious character `%c' in name or alias fieldSeparator inconsistent with syntaxMissing separator after `%s', have %sno value given for `%s'Missing separatorIllegal character - %sPremature EOFIllegal ^ character - %sAllow ^? as synonym for \177Non-octal digit `%c' in \ sequenceIllegal character %s in \ sequenceVery long string found. Missing separator?                                                           L                            T l   L |      \  \    d t  Can't backspace off beginning of line } z w s nkeb_\XSNIC?951-(# !"# $  ݲ ز Ѳ ˲Dz.zsl Dhda]YSPMIC ? I: 5 / *$ ߱۱ֱб ˱!DZ"±#$%&'()*+,-./01;{2Lx3s4o5l6h7c8^9bX:R;M<G=A>=?9@5A1B,C(D$E FG=HIJ KLMNOPQRSްT7ڰUiհVϰWQʰXŰYZ[\]^!_`abc^defghij}kyltmqnmoipeqar[s3UtQuMvIwExAy=z9{5|~2}/~+($!  ߯ۯ֯Яʯů6}xsniFd_ZUPKFA<72-P(# e߮ڮծ Ѯ̮HǮ®}xsni+d_ZUPK F!A"<#7$2%-&(#()*+, -./02345ݭ6ح7ӭ8έ9ɭ:ĭ<=>?@ABCD F G H~ Iz vqOlLhc^XS%MID>93.(#  !"#$% &'()*+,-.E/0ݬ1٬2լ3Ь4ʬ5Ĭ6789:;<N=>?@ABC{DpuEoFkGfH`IZJTK5OLIM/BN=O8P3Q.R*S%TUVWXYZ[X\]^|_`ݫaثb[ҫc̫dƫefWghijklmnmopqrzsutmugvawXxQytKzE{?|:}R5~/)# !ݪ%ت&Ӫ'Ϊ"ɪ#Ī ()$%&*+~ytoje`<[yVQLbox1memumemlOTGCOTGVOTGHOTGDOTGUOTGLOTGROTG4OTG1OTG3OTG2OTxrOTptOTmaOTkoOTknOTdTOTdBOTNLOTMTOTbcOTnlOTdNOTdCOTncOTnsOTbsOTugOTrsOTi2slengthsgr1evhlmethlmerhlmelohlmelhlmehhlmscesascescpctrmrmscsmscrmpchsmpchdispcslinessetcolorendbidefbicolornmbicrbinelbirepsmgtbsmglrs3dss2dss1dss0dscsindevtpfxlsetabsetafgetmreqmpminfokmouscsnmzeromdocrsupcssubcsrcsdrbimscsdsbimsmgtpsmgtsmgrpsmglpsmgbpsmgbscsmcuumcufmcubmcudpordermcuu1mvpamcuf1mcub1mcud1mhparumrsupmrsubmrshmrmicmrlmritmrwidmsumssupmssubmsshmsnrmqsnlqsmicmslmsitmsdrfqswidmdefccvrchrlpicpisetbsetfscpinitpinitcocopu9u8u7u6u5u4u3u2u1u0waitpausehookpulsetoneqdialdialhupwingocwinrmclkdclksclkflnsmgrsmglmgcel1kf63kf62kf61kf60kf59kf58kf57kf56kf55kf54kf53kf52kf51kf50kf49kf48kf47kf46kf45kf44kf43kf42kf41kf40kf39kf38kf37kf36kf35kf34kf33kf32kf31kf30kf29kf28kf27kf26kf25kf24kf23kf22kf21kf20kf19kf18kf17kf16kf15kf14kf13kf12kf11rfikUNDkSPDkSAVkRESkRITkRPLkRDOkPRTkPRVkOPTkNXTkMOVkMSGkLFTkICkHOMkHLPkFNDkEXTkEOLkENDksltkDLkDCkCRTkCPYkCMDkCANkBEGkundkspdksavkreskrstkrplkrfrkrefkrdokprtkprvkoptkopnknxtkmovkmsgkmrkkhlpkfndkextkentkendkcrtkcpykcmdkclokcankbegrmlnsmlnenacsxoffcxoncrmamsmamrmxonsmxonkcbtplnacscrmpmc5pkc3kc1kb2ka3ka1iproghuuctslhtwindhtssgrriindscvparcrfrs3rs2rs1repmc5mc4mc0pfxpflocpfkeycuurincufcubilindnichcuddldchpadnelsmmrmmlf9lf8lf7lf6lf5lf4lf3lf2lf10lf1lf0smkxrmkxkcuu1khtskrikindkcuf1kppknpkllkcub1kil1kich1khomekf9kf8kf7kf6kf5kf4kf3kf2kf10kf1kf0kedkelkrmirkcud1kdl1kdch1kctabkclrktbckbsipil1ich1ifis3is2is1fslffflashrmulrmsormirrmdcrmcupsgr0rmacsechsmulsmsorevprotinvissmirdimsmdcsmcupboldblinksmacshddsldl1dch1cvviscuu1llcuf1cnormmrcupcub1civishomecud1cupcmdchhpaedelcleartbccsrcrbelcbtbitypebitwinbtnswidcscpsorviorhiorlorcnpinsmlsmcsmjumpmaddrspinhspinvbufszncvpairscolorswnummalwlhnlabwslvtpbxmclmlinesitcolslpixcpixsamxvpadaisycrxmxhpahlsbcecccndscrnpcnrrmcchtsmc5inxonxonulhzxteslokosmsgrmirdbdainhskmhcgneoxenlxhpxsbambw̨<ll p Pԣ(|xИHĤ4ЧLȔؖ(̓XЛ t$T`ܛHtܘȚ@ p̙`lD0hD`$8,ԗ L,DĞ\(ġ0ԩ<\̢\d0TxxL8 4TܤԚ,PX,8$@LěħԔx<8h|X4XԦp<0ȩ8D$0$Xp\TXؓ4,d̟ب|PĘt@H@PxdL, ؟4T\|\ȣ <PPԠxPl d(̜tȦ\tܧx hxhȗ$`htؙL,̥8 } z w  kb_\ !"#$  ݲ  ~ {xurolifc`]ZWTQNKHE B?a<9630-* ' $ !     !"#$%&'(M)*+,-./0f12x345l6789:;<=>?@ABCDEFGHI|JyKvLsMpNmOjPgQdRaS^T[UXVUWRXOYLZI[F\#C]@^=_:`7a4b1c.d+e(fx%g"hijklmn o poqrstuvwxyz{|2}/~( %u~}zwttqnakmhebd_ \YvV`SPWMJGDA>;852/,)&#  z.'X(/56789:;<=>?@ABDE~{xurolifc^`]ZWTQN K H E B ?<9630-*'$!  !"#$% &'()* + ,-./01234506789:;<=>?@ABCDgEFhGHIJKLMNOPQRSTUVWXYZ|[y\v]s^p_m`jagbdcad^e[fXgUhRiOjLkIlFmCCn@o<pU=q:r7s4t1u.v+w(x%y"z{|}e~fgh i !%&'"#=()$%&ݲ{*+bxmumlGCGVGHGDGUGLGRG4G1G3G2xrptkokndTdBNLbcnldNdCncnsbsugrsi2sLsAXvXtXrXoXlXhS8S7S6S5S4S3S2S1YZYzYyYxYwYvZzXyMTs3s2s1s0cidvxlABAFGmRQMiKmZyZxZwZvZuZtZsZrZqZpZoZnZmZlZkZjZiZhZgZfZeZdZcZbZaZZZYZXZWZVZUZTZSZRZQZPZOZNZMZLZKZJZIZHZGZFZEZDZCZBZASbSfspIpIcWAPAfhPUTOQDDIHUWGCWRCDKSCLfMRMLMCcbFrFqFpFoFnFmFlFkFjFiFhFgFfFeFdFcFbFaFZFYFXFWFVFUFTFSFRFQFPFOFNFMFLFKFJFIFHFGFFFEFDFCFBFAF9F8F7F6F5F4F3F2F1RF!3!2!1%j%i%h%g%f%e%d%c%b%a#4#3#2#1*0*9*8*7*6*5*4*3*2*1&0&9&8&7&6&5&4&3&2&1%0%9%8%7%6%5%4%3%2%1@0@9@8@7@6@5@4@3@2@1LFLOeAXFXNRASARXSXkBpnacrPpOK5K4K2K3K1iPtstawistsasrsfcvr3r2r1rppopfpspxplpkUPSRRILEALSFICDODLDCpcnwmmmol9l8l7l6l5l4l3l2lal1l0kskekukTkRkFkrkPkNkHklkAkIkhk9k8k7k6k5k4k3k2k;k1k0kSkEkMkdkLkDktkCkakbalici3isi1fsvbueseeitemeaeecussomrmpmkimmhdmtimdmbasdsdcvsupndveCMlevihodocmCCchcdceclctcsblbtYpYoBTYnYmYlYkYjYiYhYgYfYeYdYcYbYaNCpaCoMWNlwssglicoYGYFYEYDYCYBYAhlutccNDNPNRHC5inxxoesmsmixnxsxb(h0X|P8 tl0X8 @xP@LP t,HX<h\ lT<\<@D|tTl\4$0`d `Tl Dd\,\L@(,8h`<ldHTh@0x(`DdxHhL(x @<pTP$x(x 8h4$DDpTtPXlxP(Htd,T8$Ldx,LHL|l`\$48<D40<D\ptL h0P<|`04pH`0$L }vgdzUqBCKFKEKDKCKBTekKAIRISHSIBMkqGGGcGvGhGdGuGrG8G5G7G6RTPSPNPDLDHMENCOCFGSGEXENIXEEXSDSCVCIAT&TBOBSDsb}wq֯lkselkbtabfont3font2font1font0Out of memorystring too complex to convertI'm confused%'%{string may not be optimal%Pa%ga%p%{96}%^%{127}%^saw %%r twice in %ssaw %%m twice in %ssaw %%n twice in %s%i%{10}%/%{16}%*%{10}%m%+%{2}%*%-%?%>%t%+%;%+%-%*%/%+%c%s%-%c%c%2d%3d%d%\unknown %% code %s (%#x) in %s$</>̵         D  `  n    d        ȶ    d                               D     ܹ   T     0                         @ \%03o%>%%%%?%%{%d}%%>%%t%%{%d}%%+%%;%%?%%{%d}%%>%%t%%'%c'%%+%%;%%?%%'%c'%%>%%t%%{%d}%%+%%;%%?%%'%c'%%>%%t%%'%c'%%+%%;%B%%{%d}%%+%%c%%'%c'%%+%%c%D%n%mdoxX.%.%r                                                              ` T            |   p Out of memory.~{xurolifc`]ZWTQOMKIGECA?=;97531/-+)'%#!   ~{xurolifc`]ZWTQNKHEB?<9630.,*(&$"   ~|zxvtrp~_~^~]~\~[~Z~Y~X~W~V~U~T~S~R~Q~P~O~N~M~L~K~J~I~H~G~F~E~D~C~B~A~@^?~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"! ^_^^^]^\^[^Z^Y^X^W^V^U^T^S^R^Q^P^O^N^M^L^K^J^I^H^G^F^E^D^C^B^A^@(null)(cancelled)\%03o"%s", line %d, col %d, terminal '%s' `]YUPMJGDA>;84/,&#  OTxrOTptOTNLOTMTOTncOTnsOTbslpixcpixsamxvpadaisycrxmxhpahlsbcecccndscrnpcnrrmcchtsmc5inxonxonulhzxteslokosmsgrmirdbdainhskmhcgneoxenlxhpxsbambwwjZG:- thQF5 {cR>,return_does_clr_eolhas_hardware_tabslinefeed_is_newlinegnu_has_meta_keyno_correctly_working_crcrt_no_scrollingbackspaces_with_bslpi_changes_rescpi_changes_ressemi_auto_right_marginrow_addr_glitchhas_print_wheelcr_cancels_micro_modecol_addr_glitchhue_lightness_saturationback_color_erasecan_changenon_dest_scroll_regionno_pad_charnon_rev_rmcuphard_cursorprtr_silentneeds_xon_xoffxon_xofftransparent_underlinetilde_glitchdest_tabs_magic_smsostatus_line_esc_okover_strikemove_standout_modemove_insert_modememory_belowmemory_aboveinsert_null_glitchhas_status_linehas_meta_keyhard_copygeneric_typeerase_overstrikeeat_newline_glitchceol_standout_glitchno_esc_ctlcauto_right_marginauto_left_marginOLFC?<950-*'" OTknOTdTOTdBOTdNOTdCOTugbitypebitwinbtnswidcscpsorviorhiorlorcnpinsmlsmcsmjumpmaddrspinhspinvbufszncvpairscolorswnummalwlhnlabwslvtpbxmclmlinesitcolsG=F-}m\K9* |mV@1! number_of_function_keyshorizontal_tab_delaybackspace_delaynew_line_delaycarriage_return_delaymagic_cookie_glitch_ulbit_image_typebit_image_entwiningbuttonswide_char_sizeprint_rateoutput_res_vert_inchoutput_res_horz_inchoutput_res_lineoutput_res_charnumber_of_pinsmicro_line_sizemicro_col_sizemax_micro_jumpmax_micro_addressdot_horz_spacingdot_vert_spacingbuffer_capacityno_color_videomax_pairsmax_colorsmaximum_windowsmax_attributeslabel_widthlabel_heightnum_labelswidth_status_linevirtual_terminalpadding_baud_ratemagic_cookie_glitchlines_of_memoryinit_tabscolumns~ytnic]XUPJEA=:4.)# |xtpkgc_[WSOKE?:40,(" |xtqnjgc`\XSPLIF@<840,'# {vqlgb]XSNID?;72-(# {vqlgb]XSNID?:50+&! }xrmgb_\YVSPMJGDA>82.)$  |wrmid^XRMGB=83-'" ~ytnhb\VOIC=80+&!            box1memumemlOTGCOTGVOTGHOTGDOTGUOTGLOTGROTG4OTG1OTG3OTG2OTmaOTkoOTbcOTnlOTrsOTi2slengthsgr1evhlmethlmerhlmelohlmelhlmehhlmscesascescpctrmrmscsmscrmpchsmpchdispcslinessetcolorendbidefbicolornmbicrbinelbirepsmgtbsmglrs3dss2dss1dss0dscsindevtpfxlsetabsetafgetmreqmpminfokmouscsnmzeromdocrsupcssubcsrcsdrbimscsdsbimsmgtpsmgtsmgrpsmglpsmgbpsmgbscsmcuumcufmcubmcudpordermcuu1mvpamcuf1mcub1mcud1mhparumrsupmrsubmrshmrmicmrlmritmrwidmsumssupmssubmsshmsnrmqsnlqsmicmslmsitmsdrfqswidmdefccvrchrlpicpisetbsetfscpinitpinitcocopu9u8u7u6u5u4u3u2u1u0waitpausehookpulsetoneqdialdialhupwingocwinrmclkdclksclkflnsmgrsmglmgcel1kf63kf62kf61kf60kf59kf58kf57kf56kf55kf54kf53kf52kf51kf50kf49kf48kf47kf46kf45kf44kf43kf42kf41kf40kf39kf38kf37kf36kf35kf34kf33kf32kf31kf30kf29kf28kf27kf26kf25kf24kf23kf22kf21kf20kf19kf18kf17kf16kf15kf14kf13kf12kf11rfikUNDkSPDkSAVkRESkRITkRPLkRDOkPRTkPRVkOPTkNXTkMOVkMSGkLFTkICkHOMkHLPkFNDkEXTkEOLkENDksltkDLkDCkCRTkCPYkCMDkCANkBEGkundkspdksavkreskrstkrplkrfrkrefkrdokprtkprvkoptkopnknxtkmovkmsgkmrkkhlpkfndkextkentkendkcrtkcpykcmdkclokcankbegrmlnsmlnenacsxoffcxoncrmamsmamrmxonsmxonkcbtplnacscrmpmc5pkc3kc1kb2ka3ka1iproghuuctslhtwindhtssgrriindscvparcrfrs3rs2rs1repmc5mc4mc0pfxpflocpfkeycuurincufcubilindnichcuddldchpadnelsmmrmmlf9lf8lf7lf6lf5lf4lf3lf2lf10lf1lf0smkxrmkxkcuu1khtskrikindkcuf1kppknpkllkcub1kil1kich1khomekf9kf8kf7kf6kf5kf4kf3kf2kf10kf1kf0kedkelkrmirkcud1kdl1kdch1kctabkclrktbckbsipil1ich1ifis3is2is1fslffflashrmulrmsormirrmdcrmcupsgr0rmacsechsmulsmsorevprotinvissmirdimsmdcsmcupboldblinksmacshddsldl1dch1cvviscuu1llcuf1cnormmrcupcub1civishomecud1cupcmdchhpaedelcleartbccsrcrbelcbt////////}/k/\/P/D/3/'///.........o._.Q.?.0.. .-------x-g-V-C-/-"---,,,,,,,,,,,x,q,h,`,X,P,I,B,:,3,,,%,,,, ,,+++++++++++++++x+p+i+b+[+T+M+F+?+8+/+'+++ +**********t*j*]*T*L*@*2*$** *)))))))))))u)k)d)])V)O)H)?)2)())))(((((((((((|(s(h(`(V(M(D(;(2(&((( (''''''''''''{'o'b'X'L'D'<'1'(''' ''&&&&&&&&&&&|&q&g&Z&P&B&:&2&*&"&&& &&%%%%%%%%%%%%%%%%z%r%j%b%Z%R%J%B%:%2%*%"%%% %%$$$$$$$$$$$$$$$t$c$V$L$>$1$#$$$$#xr###############v#f#W#H#9#'###"""""""m"X"F"1"""!!!!!!!r!]!R!G!;!)! !!!       o ` L < )   tcYM?2% yjZJ4 ucL;,}tkaWNB4(box_chars_1memory_unlockmemory_lockacs_plusacs_vlineacs_hlineacs_tteeacs_bteeacs_rteeacs_lteeacs_lrcorneracs_urcorneracs_llcorneracs_ulcornerarrow_key_mapother_non_function_keysbackspace_if_not_bslinefeed_if_not_lftermcap_resettermcap_init2set_pglen_inchset_a_attributesenter_vertical_hl_modeenter_top_hl_modeenter_right_hl_modeenter_low_hl_modeenter_left_hl_modeenter_horizontal_hl_modealt_scancode_escscancode_escapepc_term_optionsexit_scancode_modeenter_scancode_modeexit_pc_charset_modeenter_pc_charset_modedisplay_pc_charset_page_lengthset_color_bandend_bit_image_regiondefine_bit_image_regioncolor_namesbit_image_carriage_returnbit_image_newlinebit_image_repeatset_tb_marginset_lr_marginset3_des_seqset2_des_seqset1_des_seqset0_des_seqcode_set_initdevice_typepkey_plabset_a_backgroundset_a_foregroundget_mousereq_mouse_posmouse_infokey_mousechar_set_nameszero_motionthese_cause_crsuperscript_characterssubscript_charactersstop_char_set_defstop_bit_imagestart_char_set_defstart_bit_imageset_top_margin_parmset_top_marginset_right_margin_parmset_left_margin_parmset_bottom_margin_parmset_bottom_marginselect_char_setparm_up_microparm_right_microparm_left_microparm_down_microorder_of_pinsmicro_upmicro_row_addressmicro_rightmicro_leftmicro_downmicro_column_addressexit_upward_modeexit_superscript_modeexit_subscript_modeexit_shadow_modeexit_micro_modeexit_leftward_modeexit_italics_modeexit_doublewide_modeenter_upward_modeenter_superscript_modeenter_subscript_modeenter_shadow_modeenter_normal_qualityenter_near_letter_qualityenter_micro_modeenter_leftward_modeenter_italics_modeenter_draft_qualityenter_doublewide_modedefine_charchange_res_vertchange_res_horzchange_line_pitchchange_char_pitchset_backgroundset_foregroundset_color_pairinitialize_pairinitialize_colororig_colorsorig_pairuser9user8user7user6user5user4user3user2user1user0wait_tonefixed_pauseflash_hookquick_dialdial_phonehangupgoto_windowcreate_windowremove_clockdisplay_clockset_clocklabel_formatset_right_marginset_left_marginclear_marginsclr_bolkey_f63key_f62key_f61key_f60key_f59key_f58key_f57key_f56key_f55key_f54key_f53key_f52key_f51key_f50key_f49key_f48key_f47key_f46key_f45key_f44key_f43key_f42key_f41key_f40key_f39key_f38key_f37key_f36key_f35key_f34key_f33key_f32key_f31key_f30key_f29key_f28key_f27key_f26key_f25key_f24key_f23key_f22key_f21key_f20key_f19key_f18key_f17key_f16key_f15key_f14key_f13key_f12key_f11req_for_inputkey_sundokey_ssuspendkey_ssavekey_srsumekey_srightkey_sreplacekey_sredokey_sprintkey_spreviouskey_soptionskey_snextkey_smovekey_smessagekey_sleftkey_sickey_shomekey_shelpkey_sfindkey_sexitkey_seolkey_sendkey_selectkey_sdlkey_sdckey_screatekey_scopykey_scommandkey_scancelkey_sbegkey_undokey_suspendkey_savekey_resumekey_restartkey_replacekey_refreshkey_referencekey_redokey_printkey_previouskey_optionskey_openkey_nextkey_movekey_messagekey_markkey_helpkey_findkey_exitkey_enterkey_endkey_createkey_copykey_commandkey_closekey_cancelkey_beglabel_offlabel_onena_acsxoff_characterxon_characterexit_am_modeenter_am_modeexit_xon_modeenter_xon_modekey_btabplab_normacs_charschar_paddingprtr_nonkey_c3key_c1key_b2key_a3key_a1init_progup_half_lineunderline_charto_status_linetabset_windowset_tabset_attributesscroll_reversescroll_forwardsave_cursorrow_addressrestore_cursorreset_filereset_3stringreset_2stringreset_1stringrepeat_charprtr_onprtr_offprint_screenpkey_xmitpkey_localpkey_keyparm_up_cursorparm_rindexparm_right_cursorparm_left_cursorparm_insert_lineparm_indexparm_ichparm_down_cursorparm_delete_lineparm_dchpad_charnewlinemeta_onmeta_offlab_f9lab_f8lab_f7lab_f6lab_f5lab_f4lab_f3lab_f2lab_f10lab_f1lab_f0keypad_xmitkeypad_localkey_upkey_stabkey_srkey_sfkey_rightkey_ppagekey_npagekey_llkey_leftkey_ilkey_ickey_homekey_f9key_f8key_f7key_f6key_f5key_f4key_f3key_f2key_f10key_f1key_f0key_eoskey_eolkey_eickey_downkey_dlkey_dckey_ctabkey_clearkey_catabkey_backspaceinsert_paddinginsert_lineinsert_characterinit_fileinit_3stringinit_2stringinit_1stringfrom_status_lineform_feedflash_screenexit_underline_modeexit_standout_modeexit_insert_modeexit_delete_modeexit_ca_modeexit_attribute_modeexit_alt_charset_modeerase_charsenter_underline_modeenter_standout_modeenter_reverse_modeenter_protected_modeenter_secure_modeenter_insert_modeenter_dim_modeenter_delete_modeenter_ca_modeenter_bold_modeenter_blink_modeenter_alt_charset_modedown_half_linedis_status_linedelete_linedelete_charactercursor_visiblecursor_upcursor_to_llcursor_rightcursor_normalcursor_mem_addresscursor_leftcursor_invisiblecursor_homecursor_downcursor_addresscommand_charactercolumn_addressclr_eosclr_eolclear_screenclear_all_tabschange_scroll_regioncarriage_returnbellback_tab_HiStOrY_V1_ rw%s         $  | h T ( 8  *?_-.[]~=bindtelltcsettcechotcsetty           T p    /.editrcHOME%s%sr^DEditline extended commanded-commandMove down one lineed-next-lineMove up one lineed-prev-lineSearch next in history for a line matching the currented-search-next-historySearch previous in history for a line matching the currented-search-prev-historyMove to the next history lineed-next-historyMove to the previous history lineed-prev-historyFirst character in a bound sequenceed-sequence-lead-inErase current line and start from scratched-start-overRedisplay everythinged-redisplayClear screen leaving current line at the toped-clear-screenDelete the character to the left of the cursored-delete-prev-charExecute commanded-newlineTty allow output charactersed-tty-start-outputTty disallow output charactersed-tty-stop-outputTty suspend charactered-tty-sigtstpTty quit charactered-tty-sigquitTty flush output charactersed-tty-flush-outputTty delayed suspend charactered-tty-dsuspTty interrupt charactered-tty-sigintIndicates unbound charactered-unassignedDigit that starts argumented-argument-digitAdds to argument or enters a digited-digitAdd the next character typed verbatimed-quoted-insertMove to the left one charactered-prev-charMove to the beginning of the current worded-prev-wordMove to the right one charactered-next-charExchange the character to the left of the cursor with the one under ited-transpose-charsMove cursor to the beginning of lineed-move-to-begMove cursor to the end of lineed-move-to-endCut to the end of lineed-kill-lineDelete character under cursored-delete-next-charDelete from beginning of current word to cursored-delete-prev-wordAdd character to the lineed-insertIndicate end of fileed-end-of-fileEmacs incremental reverse searchem-inc-search-prevEmacs incremental next searchem-inc-search-nextCopy current word to cursorem-copy-prev-wordSwitch from insert to overwrite mode or vice versaem-toggle-overwriteAdd 8th bit to next character typedem-meta-nextUniversal argument (argument times 4)em-universal-argumentExchange the cursor and markem-exchange-markSet the mark at cursorem-set-markLowercase the characters from cursor to end of current wordem-lower-caseCapitalize the characters from cursor to end of current wordem-capitol-caseUppercase the characters from cursor to end of current wordem-upper-caseMove next to end of current wordem-next-wordExchange the two characters before the cursorem-gosmacs-trasposeCopy area between mark and cursor to cut bufferem-copy-regionCut area between mark and cursor and save in cut bufferem-kill-regionCut the entire line and save in cut bufferem-kill-linePaste cut buffer at cursor positionem-yankCut from cursor to end of current wordem-delete-next-wordDelete character under cursor or list completions if at end of lineem-delete-or-listVi repeat current character search in the opposite search directionvi-repeat-prev-charVi repeat current character search in the same search directionvi-repeat-next-charVi move up to the character specified previousvi-to-prev-charVi move up to the character specified nextvi-to-next-charVi move to the character specified previousvi-prev-charVi move to the character specified nextvi-next-charVi repeat current search in the opposite search directionvi-repeat-search-prevVi repeat current search in the same search directionvi-repeat-search-nextVi search history nextvi-search-nextVi search history previousvi-search-prevVi cut from beginning of line to cursorvi-kill-line-prevVi list choices for completion or indicate end of file if empty linevi-list-or-eofVi move to previous character (backspace)vi-delete-prev-charVi move to the beginning of linevi-zeroVi enter command mode (use alternative key bindings)vi-command-modeVi undo all changesvi-undo-lineVi undo last changevi-undoVi move to the end of the current wordvi-to-end-wordVi move to the end of the current space delimited wordvi-end-wordVi delete prefix commandvi-delete-metaVi enter insert mode at end of linevi-add-at-eolVi enter insert mode after the cursorvi-addVi enter insert modevi-insertVi change to end of linevi-change-to-eolVi substitute entire linevi-substitute-lineVi replace character under the cursor and enter insert modevi-substitute-charVi enter replace modevi-replace-modeVi replace character under the cursor with the next character typedvi-replace-charVi enter insert mode at the beginning of linevi-insert-at-bolVi change prefix commandvi-change-metaVi change case of character under the cursor and advance one charactervi-change-caseVi move to the next wordvi-next-wordVi move to the next space delimited wordvi-next-space-wordVi move to the previous wordvi-prev-wordVi move to the previous space delimited wordvi-prev-space-wordVi paste previous deletion to the left of the cursorvi-paste-prevVi paste previous deletion to the right of the cursorvi-paste-next%d %skey_add: Null extended-key not allowed. key_add: sequence-lead-in command not allowed key_delete: Null extended-key not allowed. Unbound extended key "%s" Some extended keys too long for internal print buffer "%s..." %-15s-> %s ""[]no inputemacsvi%s -> %s %-15s-> is undefined %-4s to %-7s-> %s Standard key bindings Alternative key bindings Multi-character bindings Arrow key bindings %s %s %s: Invalid switch `%c'. %s: Invalid \ or ^ in instring. %s: Invalid \ or ^ in outstring. %s: Invalid command `%s'. ( x) x) x) 4) x) x) x) x) x)  ) D) x) x) x) x) x) ) ( x) x) $) history. . . . . . . . : 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-unknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data check e   ? n   M |   ) 0  deflate 1.1.3 Copyright 1995-1998 Jean-loup Gailly \\ \d dd d d d1.1.3q     invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeat<!T"!###incompatible versionbuffer errorinsufficient memorydata errorstream errorfile errorstream endneed dictionary1.1.3       L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c         (08@P`p  0@`  0@`invalid literal/length codeinvalid distance codeDEpFFG HIJJJ inflate 1.1.3 Copyright 1995-1998 Mark Adler  #+3;CScspp !1Aa  0@` oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengthsinvalid distance codeinvalid literal/length code-csh/bin/sh./%s: illegal option -- %c %s: option requires an argument -- %c $FreeBSD: src/lib/libc/stdtime/strftime.c,v 1.25.2.1 2000/10/26 14:25:02 ache Exp $@(#)strftime.c 7.38@(#)strftime.c 5.4 (Berkeley) 3/14/89%c?%02d%a %Ef %T %Y%m/%d/%y%2d%03d %H:%M%I:%M:%S %p%ld%lu%H:%M:%S %d%04d%e-%b-%Y+-ihshshshshshshshshshshshshshshshshshshshshshshshshshshshshshshshshshshshshshshshshshs4shshshshshshshshshshshshshshshshshshshshshsijjkPkk ol0lhshshsmhslkhshsmmPnn opLqqrhshshshshshsijk0kkk ojhslll0mPmhslmhsm nhnnp,qxqq|r shut up gcc*** unknown regexp error code ***invalid argument to regex routineREG_INVARG"can't happen" -- you found a bugREG_ASSERTempty (sub)expressionREG_EMPTYrepetition-operator operand invalidREG_BADRPTout of memoryREG_ESPACEinvalid character rangeREG_ERANGEinvalid repetition count(s)REG_BADBRbraces not balancedREG_EBRACEparentheses not balancedREG_EPARENbrackets ([ ]) not balancedREG_EBRACKinvalid backreference numberREG_ESUBREGtrailing backslash (\)REG_EESCAPEinvalid character classREG_ECTYPEinvalid collating elementREG_ECOLLATEinvalid regular expressionREG_BADPATregexec() failed to matchREG_NOMATCHREG_0x%x0%dxdigitupperspacepunctprintlowergraphdigitcntrlblankalphaalnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNUL XTTdTD[:<:]][:>:]]PL<8   0\t%drcmd: getaddrinfo: %s rcmd: socket: All ports in use rcmd: socket: %s connect to address %s: Trying %s... %s: %s rcmd: write (setting up stderr): %s rcmd: too many files rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: accept: %s socket: protocol failure in circuit setup. rcmd: %s: %s 0r/etc/hosts.equiv/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts owner.rhosts writeable by other than owner$FreeBSD: src/lib/libc/locale/setlocale.c,v 1.25.2.2 2000/09/08 07:31:52 kris Exp $LC_MESSAGESLC_TIMELC_NUMERICLC_MONETARYLC_CTYPELC_COLLATELC_ALLLANGC/PATH_LOCALE/usr/share/localePOSIX0%X%X(LLLLLLLLLLLLLLLLLLLLLLLL/var/run/dev.db/dev/$FreeBSD: src/lib/libc/gen/strtofflags.c,v 1.18.2.1 2000/06/28 01:52:24 joe Exp $nouunlinknouunlnknoopaquenodumpnouimmutablenouchangenouchgnouappendnouappndnosunlinknosunlnknosimmutablenoschangenoschgnoarchivednoarchnosappendnosappnd ,stringlist: %m ߈ڈՈЈ̈Ljˆusr2usr1infowinchprofvtalrmxfszxcpuiottouttinchldconttstpstopurgtermalrmpipesyssegvbuskillfpeemtabrttrapillquitinthupSignal 0|wcTI@' ۊЊs^Q:" ̉User defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangup \pp ,pPh%ur+sh-c/bin/shHOME.$FreeBSD: src/lib/libc/gen/getvfsbyname.c,v 1.5 1999/08/27 23:58:45 peter Exp $passwd.byname%upasswd.byuid/etc/pwd.db/etc/spwd.db%s: %mpasswd.adjunct.byname:##master.passwd.bynamemaster.%s%sw+/dev/tty /etc/netgroupr%c*%s.%s%s.**.%s*.*netgroup.byusernetgroup.byhost), , netgroup%s %sgroup.byname%dgroup.bygidr/etc/group: :BLOCKSIZEGKM%s: unknown blocksizemaximum blocksize is %ldGminimum blocksize is 512%ld%s-blocks/kernel...//dev/ : xxswufsswap ,rwrqror/etc/fstabfstab: :%d: PATH/usr/bin:/bin:.execvp: : path too long sh/bin/shggggg?hPgggg?hggggggggggggg?hggggggggggggggggggggggggggggggggggggg̙waJ8$Θ˜`1"ߗr\MA P? ƕ`? O5ub@ ے̒dR>(j@Illegal byte sequenceOperation canceledValue too large to be stored in data typeNo message of desired typeIdentifier removedNeed authenticatorAuthentication errorInappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisc quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0W$FreeBSD: src/lib/libc/gen/disklabel.c,v 1.9 1999/11/04 04:46:18 ache Exp $DOC2KVinumCCDfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownvinumbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunused/etc/disktabb0b1tyremovablesimulatedsfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdxauthunix_create: out of memory auth_none.c - Fatal marshalling problemϝ˝ǝÝ|ukcZQMIEA=95.' Ԝ|ukcZQΜȜ%B %e%b %e%a %Ef %X %Z %YPMAM%m/%d/%y%H:%M:%SSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJanCPOSIX//LC_TIMECPOSIXPATH_LOCALE/usr/share/locale//LC_CTYPErNONEUTF2EUCBIG5MSKanjiRuneMagi/%s.dbtcr$FreeBSD: src/lib/libc/gen/err.c,v 1.6 1999/08/27 23:58:33 peter Exp $%s: : %s ֱPܰٱ0 St,(Ե;Ե;;d;;;;;;;ȵȵȵȵȵȵ;;;;;;;;;;;;;;;;;;;;;;;;;ȵȵȵȵȵȵ;;;;;;;;;;;;;;;;;||ttttttttttCPOSIX//LC_COLLATEr1.0 __collate_substitute__collate_strdup: xdr_array: out of memory udptcp%d%u/etc/host.confrhostslocalfilefilesdnsbindnis# /etc/hosts0123456789abcdefip6.intin-addr.arpa;; res_query(%s, %d, %d) ;; res_query: mkquery failed ;; res_query: send error ;; rcode = %d, ancount=%d @L4(LL;; res_querydomain(%s, %s, %d, %d) %s.%sHOSTALIASESr;; res_mkquery(%d, %s, %d, %d) /&LOCALDOMAINr/etc/resolv.confdomain searchnameserver%dsortlistoptionsconfRES_OPTIONSenv;; res_setoptions("%s", "%s")... ndots:;; ndots=%d debug;; res_setoptions("%s", "%s").. ;; debug inet6no_tld_queryȧħȧħȧħtcpudpUnknown errorArgument res is NULLResolved protocol is unknownInvalid value for hintsSystem error returned in errnoai_socktype not supportedservname not supported for ai_socktypehostname nor servname provided, or not knownNo address associated with hostnameMemory allocation failureai_family not supportedNon-recoverable failure in name resolutionInvalid value for ai_flagsTemporary failure in name resolutionAddress family for hostname not supportedSuccess# /etc/host.confrhostslocalfilefilesdnsbindnisGAI# /etc/hostst''h'\'''%s.%s%d/%sservices.byportservices.byname%.*s %s/%sr/etc/services# ,/nisyellowpagesypdomaindnsbindhtablehosttable/etc/hostshostsr/etc/host.conf ,:; hosts.bynamehosts.byaddrr/etc/hosts# gethostby*.gethostanswer: asked for "%s", got "%s"gethostby*.gethostanswer: asked for "%s %s %s", got type "%s"size (%d) too big Too many addresses (%d) Impossible condition (type=%d) res_search failed (%d) %u.%u.%u.%u.in-addr.arpa%x.%x.ip6.intres_query failed (%d) static buffer is too small (%d) syslog: unknown facility/priority: %x<%d>%.15s %s[%d]: %m /dev/console /var/run/log/dev/log$FreeBSD: src/lib/libc/yp/yplib.c,v 1.34 2000/01/27 23:06:55 jasone Exp $SuccessInternal ypbind errorDomain not boundSystem resource allocation failureUnknown ypbind error: #%d /var/yp/binding%s/%s.%dclnttcp_createYP: server for domain %s not responding, retrying clntudp_createfcntl: F_SETFDyp_match: clnt_callyp_first: clnt_callyp_next: clnt_callclnttcp_create failed yp_order: clnt_callyp_master: clnt_callyp_maplist: clnt_callRequest arguments badRPC failureCan't bind to server which serves this domainNo such map in server's domainNo such key in mapYP server errorLocal resource allocation failureNo more records in map databaseCan't communicate with portmapperCan't communicate with ypbindCan't communicate with ypservLocal domain name not setServer data base is badYP server version mismatch - server can't supply service.Access violationDatabase is busyYP unknown error %d ooooooopppp p(p0p8p@pHp$FreeBSD: src/lib/libc/yp/xdryp.c,v 1.9 1999/08/28 00:02:58 peter Exp $clntudp_create: out of memory |,|t|D|\||V}{||||| }$}V}V}V}<}clnttcp_create: out of memory 8Pt ȃ܃%s: %s; errno = %s ; low version = %lu, high version = %lu ; why = %s (unknown authentication error - %d) ; s1 = %lu, s2 = %lu Du\H1"յ`G5RPC: Unknown protocolRPC: Failed (unspecified error)RPC: Program not registeredRPC: Port mapper failureRPC: Unknown hostRPC: Remote system errorRPC: Server can't decode argumentsRPC: Procedure unavailableRPC: Program/version mismatchRPC: Program unavailableRPC: Authentication errorRPC: Incompatible versions of RPCRPC: Timed outRPC: Unable to receiveRPC: Unable to sendRPC: Can't decode resultRPC: Can't encode argumentsRPC: SuccessRPC: (unknown error code)%s: %s - %s %s: %s oW># Failed (unspecified error)Invalid server verifierClient credential too weakServer rejected verifierInvalid client verifierServer rejected credentialInvalid client credentialAuthentication OKGMT/etc/localtime/usr/share/zoneinfo/mnposixrulesTZSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%.3s %.3s%3d %02d:%02d:%02d %d : HPHPPPPPPPPPHPPPPPPPPPPPPHPPPPHPPPPPPPPPPPPPPPPPPPPPPPPPPPH01234567890123456789abcdef0123456789ABCDEF[inet_ntoa error]0123456789$FreeBSD: src/include/rpcsvc/yp.x,v 1.12 1999/08/27 23:45:12 peter Exp $xdr_reference: out of memory xdrrec_create: out of memory dlt|%u.%u.%u.%u%xxdr_bytes: out of memory xdr_string: out of memory union/usr/bin:/bin:/usr/sbin:/sbin:%$sniglet^&TMPDIR/tmp%s/bt.XXXXXXXXXX/dev/urandom$9999p9]9J9799S:F:9:,::::_`_``__`_`a`aaHa`aHampool_new: page allocation overflow. InfNaN0123456789abcdef(null)0123456789ABCDEF00..zzz{{|}}}}}}}}}}~~dT~~$~~0~|:~h#pЙЙЙЙЙЙЙЙ4ЙЙ\\\\\\\\\ЙЙЙЙЙЙЙЙЙЙؕЙЙЙЙЙЙЙЙЙЙЙЙЙЙЙЙЙЙЙЙЙЙЙЙەەЙЙЙ4Й\ЙЙЙtttttttttt$8tL`tt$FreeBSD: src/lib/libc/i386/gen/isinf.c,v 1.6 1999/08/27 23:59:21 peter Exp $@?5?55?5?InfinityNaN0?aCoc?`(?yPD?$@@@? D'K error: warning: /etc/malloc.confMALLOC_OPTIONSunknown char in MALLOC_OPTIONS mmap(2) failed, check limits. $dDT4tjunk pointer, too low to make sense. junk pointer, too high to make sense. modified (page-) pointer. modified (chunk-) pointer. chunk is already free. pointer to wrong page. page is already free. freelist is destroyed. malloc() has never been called. in malloc():recursive call. out of memory. in free(): in realloc():No address associated with nameUnknown server errorHost name lookup failureUnknown hostResolver Error 0 (no error): Resolver internal errorUnknown resolver error?res_send: %s ([%s].%s): %s res_send: %s: %s ;; res_send() kqueue;; Querying server (# %d) address = %s socket(vc)connect/vcwrite failedread failed;; response truncated ;; undersized: %d read(vc);; old answer (unexpected): socket(dg)connect(dg)sendsendtos out-of-boundskevent;; timeout recvfrom;; old answer: ;; not our server: ;; wrong query name: server rejected query: ;; truncated answer ;; got answer: < "ZLZ";; res options: %s;; ns_parserr: %s ;; %s SECTION: .;; %s, type = %s, class = %s ;; ns_sprintrr: %s ;; ns_initparse: %s ;; ->>HEADER<<- opcode: %s, status: %s, id: %d ; flags: qr aa tc rd ra ?? ad cd; %s: %d, %s: %dYSPIE@NONEANYHESIODHSCHAOSINADDITIONALAUTHORITYANSWERQUERY UPDATEPREREQUISITEZONEtp]ZRO= :. )$   sm[WKF96/*`D  !"{vhb@9!#E"any"URN Naming AuthorityNAPTRmail agent (deprecated)MAILAmailbox-related data (deprecated)MAILBzone transferAXFRincremental zone transferIXFRATM address (unimplemented)ATMAserver selectionSRVNIMROD locator (unimplemented)NIMLOCendpoint identifier (unimplemented)EIDnext valid name (unimplemented)NXTlocationLOCIPv6 addressAAAAgeographical position (withdrawn)GPOSmapping informationPXkeyKEYsignatureSIGNSAP_PTRnsap addressNSAProuterRTISDN addressISDNX25 addressX25DCE or AFS serverAFSDBresponsible personRPtextTXTmail exchangerMXmailbox informationMINFOhost informationHINFOdomain name pointerPTRwell-known service (deprecated)WKSnullNULLmail renameMRmail group memberMGmailboxMBstart of authoritySOAcanonical nameCNAMEmail forwarder (deprecated)MFmail destination (deprecated)MDname serverNSaddressA%dinitdebugaaonly(unimpl)usevcprimry(unimpl)igntcrecursdefnamstyopndnsrchinsecure1insecure2?0x%lx?%u%ld.%.2ld,88888888 8888 888,8888888888888,88888888 8888 888,?; error: unknown LOC RR version%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %sm%04d%02d%02d%02d%02d%02dZONEREFZONEINIT131211109876UPDATENOTIFYCQUERYUCQUERYMIQUERYQUERYNOCHANGE14ZONEERRNOTAUTHNXRRSETYXRRSETYXDOMAINREFUSEDNOTIMPNXDOMAINSERVFAILFORMERRNOERRORADDITIONALPREREQUISITESZONE. @ %s %s ( %lu; serial ; refresh ; retry ; expiry ); minimum %u %u %u %u %u %u %u ( %d )0x%04x %u %u ( %s %d %lu %s %sunknown RR typeRR format error\#( ; %s %02x ; `|++||||+8%|$4 !$4 `!4  "+(& +H""*++,$+"" "\\len <= *buflen/usr/src/lib/libc/../libc/net/ns_print.c ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=assertion "%s" failed: file "%s", line %d W>>>>a>>>>>o>>>>>>}>>>>L>%d%crDEDEEDDEDHASH: Out of overflow pages. Increase page size xqPqqq\qxqqqqqxqurqvkvdvTavp^v`[vȿVv\QvLvIvFv@v =v,:v4v'.vp()v4*#vh*vh*v/v3vZv]uPzuX}uhuuuu8uL4u$@uEuu u u u  u(|@Bʚ;Ƥ~@P.~xr)$ݺغк˺ź/tmp/EdDk.XXXXXXXXXXh|f@,   ` 9@MNOPQRxVuaoc@d%eu xbZQJ2 ooooo@@  @| o  tqnic_ZRMC@<6 -@$@ ##.A)6)3)0)+)%)!)))))@(( (@(((((((@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. ...}.x.r.n.i.a.\.R.@K.E. <.@3.,.%. ...`111{1y1s1y1l1j1d1b1sB2A2send account command to remote serverappend to a fileset ascii transfer typebeep when command completedset binary transfer typetoggle mget upper/lower case id mappingchange remote working directorychange remote working directory to parent directorychange file permissions of remote fileconnect to remote ftp servertoggle carriage return stripping on ascii getstoggle/set debugging modedelete remote filelist contents of remote directoryterminate ftp sessionexecute macrotoggle command line editingset file transfer formattoggle gate-ftp; specify host[:port] to change proxytoggle metacharacter expansion of local file namestoggle printing `#' marks; specify number to set sizeprint local help informationget (set) idle timer on remote sidechange local working directoryprint local working directorylist contents of remote directorydefine a macrodelete multiple fileslist contents of multiple remote directoriesget multiple filesmake directory on the remote machinelist contents of multiple remote directoriesset file transfer modeshow last modification time of remote filesend multiple filesget file if remote file is newer than local file nlist contents of remote directoryset templates for default file name mappingset translation table for default file name mappingview a remote file through your pagerenter passive transfer modetoggle use of PORT cmd for each data connectiontoggle preservation of modification time of retreived filestoggle transfer progress meterforce interactive prompting on multiple commandsissue command on alternate connectionprint working directory on remote machineterminate ftp session and exitsend arbitrary ftp commandreceive fileget file restarting at end of local fileget help from remote serverrename fileclear queued command repliesrestart file transfer at bytecounttoggle restriction of data port rangeremove directory on the remote machineshow status of remote machinetoggle store unique for local filessend one fileescape to the shellsend site specific command to remote server Try "rhelp site" or "site help" for more informationshow size of remote fileshow current statusset file transfer structuretoggle store unique on remote machineshow remote system typeset tenex file transfer typetoggle packet tracingset file transfer typeget (set) umask on remote sidesend new user informationtoggle verbose modeBrBfBBDB`BoBBHBBHBBZBBGBBoBBrB@Bt_B`BXyBBmBBdoBBrB/BL^BIB(aB`BxcuBBdopBB8ZkBBofBB|HbBBH^BBOYBB<\TB B^OB`BZJBHBCBBn=BBG9B7B$`2BBx~-BBj*B@Bxc#BbBzBqBaBBdBBS BBkB BdBMBXHABx}ABx~AAPJAAPJAB<~ABxcA@B tABrABHABx~ABxA`B(^AB[AB\AApAdBHA@BLjABoABLlABO}ABxOvA%sAbmA1BeA`By\AB|VA BnPABkHAB~@A@B4y;AdBH2A B[-ABl(AB|!ABDVA0BHA`By ABpzAB4H@B`Z@BE@ BHn@ Bh@9 B[@HBTSSSSSS S@(#)authenc.c 8.1 (Berkeley) 6/6/93@(#)commands.c 8.2 (Berkeley) 12/15/93V^=^9^^^^^]]]]]]]]|]^]Y]O]J]F]+]'] ]]\\\\\\`\8\ \\ \h\h\0[P[p[jjx `j9jjiiip `iEi i8  ih!hh!hh h`hЕ;h0hh\gg1_ggt gqg@ggff `fJf ffeee\@"\@"Ip p]o̕ooToo`#g1_g@o#oo?O]n8nn9\Pn0g1_g nnm3mm5m`m>\ m:ml6ll4~lel<`lFl=@l l1l l19^lB`uHu)1_ utt)1_t1_1_1_thtQt*Kt*Et-t*(tt* t*ts*ss*s*ss*ss*s*s`s*\*9sd)1_1_\"s*xxux`xuLx xu\1\"s1zz5zz6x`z68zz7yy47yy7\2\"s2connect to a siteclose current connectionforcibly logout remote user and close the connectionexit telnetprint status informationprint help informationtransmit special characters ('send ?' for more)set operating parameters ('set ?' for more)unset operating parameters ('unset ?' for more)toggle operating parameters ('toggle ?' for more)change state of special charaters ('slc ?' for more)display operating parameterssuspend telnetcompute response to s/key challengeinvoke a subshellchange environment variables ('environ ?' for more)try to enter line or character mode ('mode ?' for more)01u+@$+~::nl1y@$l'}X8#@$2,/[/3\Fdeprecated command -- use 'toggle crmod' insteaddeprecated command -- use 'set escape' instead\F].h.@(#) Copyright (c) 1988, 1990, 1993 The Regents of the University of California. All rights reserved. @(#)main.c 8.2 (Berkeley) 12/15/93@(#)network.c 8.2 (Berkeley) 12/15/93@(#)ring.c 8.1 (Berkeley) 6/6/93@(#)sys_bsd.c 8.2 (Berkeley) 12/15/93@(#)telnet.c 8.2 (Berkeley) 12/15/93|""""@(#)terminal.c 8.1 (Berkeley) 6/6/93@(#)tn3270.c 8.2 (Berkeley) 5/30/95@(#)utilities.c 8.2 (Berkeley) 12/15/93,'!  }vje`[TMF?81* ԊƊ~wqh_SD<0  !,'ߋۋ׋ҋ͋Nj(standard output)\^:   }) 0/dev/ptyXX7GP G G G G G@ Gx G G G zGX qG ?NANGNBNNbNCNcvNdfNEaNfNNl:NL-NFNFNNiNnMxM MhMsMZMMzMqMrMeMvMqMaMUvMunMV`MHTMwp ;`Ts v 6`Ts v 0`t v ,`t v &`y z ԃ $FreeBSD: src/lib/msun/src/s_ilogb.c,v 1.6 1999/08/28 00:06:49 peter Exp $\]^7ba_`c8V9Mdefg:U;J<H=>LhW?O@NiAB CD  !"#$%E &'()*+,-./F 0123456789G :;<=>?@ABCH D E F GIJKjkLMKNIOP[lmcnoQRpqRSrZstuvwxSyz{|}~TPUQVTW@ s f%%p%c%%{10}%%/%%{16}%%*%%p%c%%{10}%%m%%+@(#)history.c 8.1 (Berkeley) 6/4/930 \     , ( L      P  t      L    p        |  $     |   ( d          D     ą ̂    Ȁ     l  ~ (~ h D~ ~ \   ̇  H  d   D Ĉ    H VGF GFGFFIFYFJBBU`B:BX&BBYBA;AAZAjA=@A%AB@@A@@Rr@c@QL@6@M@?N??C`?L?H ? ?V>>W>>K@>$>L=='=g=&@=$=5=<,<<-`<P<% <;);;0;\;4 ;:#::.`:A:1*::(99399/9S92 99$88*88+8]8H8>8$887777 n7_7 @7%7 7666 `6J6 655555`5?5$55"444444y4j4W4H4244!43 33 33`3M3 3 322222b2@2022111`1<1+11 110H1 ' ""   !,-5/"""""""""""""""""""""""""""""""$""""""""""""""""""""""""#&"0"""""."""""4"%""""""""#&"0""""".""""""4"%"""""""B=   !A;""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" "" """   !"A""""/""" """ """"""L"RZK"""Q"7I: UH""@""NG"PTWY"D"""" ""6J9<>C"? "M"F"OSVX"E"""""8""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""j0X( |0 k XJ o00h v0@i 0y ? fwdbck:JO7O4O'O$OOONNNNNNNNNNNNNNsNpNXNUNINFN5N2N NNN NMMMMMMMMMMMMMMrMoM`M]MGMDM6M3M#M MMMMLLLLLLLLLLLqLnL\LYLHLOOOOOyOvOiOfOPOMOiO[1~[4~OAOBOCODKQOQTTSSST@TSS SaT@TSSS =,A"'B" """"UUUUUU U@{UuUpUjUdU\U VUPUIUBU Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`??w$FreeBSD: src/lib/libc/stdio/asprintf.c,v 1.6 1999/08/28 00:00:55 peter Exp $}}}q}d}J}?}'}}}|||||| |q| g|K| @|(| || |{{{{{b{@{"{{~ ~~}}}}}}} } } ݀ӀЀ ̀ ɀ        {wsokgd`\XUQNJGC@} /! "#$%&'()*+,--../w/r0n1j2d3_4Z5V6P7J8E9?:5;&<=>~?~@~[~\~\~]~^~^~_x~_k~``~{M~{?~|3~}~}~~~߅ӅȅCCCCCCC/dev/Ӈɇ‡}slbUNE<2L@(#)getbsize.c 8.1 (Berkeley) 6/4/93|vpjc\XRLښ˚ĚP{X{{<|0}C  h|P*`>$_@ ڧ̧ |$@,!  u{{{h}{,Ԃ,܂08DL@(#)localtime.c 7.57WILDABBR^^@(#)asctime.c 7.7$FreeBSD: src/lib/libc/net/ns_netint.c,v 1.2 1999/08/28 00:00:14 peter Exp $$FreeBSD: src/lib/libc/net/ns_name.c,v 1.2 1999/08/28 00:00:14 peter Exp $0123456789Unknown error: |H \,lT,l TlRuneMagiNONEBBBBB@(((((((((((((((          (((((((    ((((((    ((((  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~@`9 0000000000000000}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMD7yACnF?O8M20HwZa  ,n}HCd_ nobody*Unprivileged user/nonexistent/sbin/nologin3pop*DPost Office Owner/nonexistent/sbin/nologin2pop*DPost Office Owner/nonexistent/sbin/nologin1popxten*CCX-10 daemon/usr/local/xten/sbin/nologin1xtenbind*55Bind Sandbox//sbin/nologin35kmem*KMem Sandbox//sbin/nologin3tty*Tty Sandbox//sbin/nologin2rdrnobody*Unprivileged user/nonexistent/sbin/nologin2kmem*KMem Sandbox//sbin/nologin2vq)$games* Games pseudo-user/usr/games/sbin/nologin3games* Games pseudo-user/usr/games/sbin/nologin2tty*Tty Sandbox//sbin/nologin1ttybin*Binaries Commands and Source,,,//sbin/nologin1bin PK news*News Subsystem//sbin/nologin3news*News Subsystem//sbin/nologin2 kmem*KMem Sandbox//sbin/nologin1kmemrootCharlie &/root/bin/csh3rootCharlie &/root/bin/csh2 kf}c}nobody*Unprivileged user/nonexistent/sbin/nologin1nobodyman* Mister Man Pages/usr/share/man/sbin/nologin3 man* Mister Man Pages/usr/share/man/sbin/nologin2 daemon*Owner of many system processes/root/sbin/nologin3toor*Bourne-again Superuser/root20+ZV  n D n uucp*BBUUCP pseudo-user/var/spool/uucppublic/usr/libexec/uucp/uucico3Bbind*55Bind Sandbox//sbin/nologin2 man* Mister Man Pages/usr/share/man/sbin/nologin1manoperator*System &//sbin/nologin3operator*System &//sbin/nologin1operatordaemon*Owner of many system processes/root/sbin/nologin2daemon*Owner of many system processes/root/sbin/nologin1daemontoor*Bourne-again Superuser/root1toorrootCharlie &/root/bin/csh1rootrl$E@ s xten*CCX-10 daemon/usr/local/xten/sbin/nologin3Cuucp*BBUUCP pseudo-user/var/spool/uucppublic/usr/libexec/uucp/uucico2 uucp*BBUUCP pseudo-user/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpbind*55Bind Sandbox//sbin/nologin1bindnews*News Subsystem//sbin/nologin1newsgames* Games pseudo-user/usr/games/sbin/nologin1gamesbin*Binaries Commands and Source,,,//sbin/nologin3operator*System &//sbin/nologin2to)$pop*DPost Office Owner/nonexistent/sbin/nologin3Dxten*CCX-10 daemon/usr/local/xten/sbin/nologin2 tty*Tty Sandbox//sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin2