<fjQPS1Pjf1ɎَѼ|}r,g|uuƀrIᾬ}R1҉ 5w ޿))0`duddu`ûDL Ss*}}0r4uRZr?tfFRff1fC0fZf=wD@(f8r^P[s Ot0FsF ^(Fw.yURAZoUd]BReadBoot error PUWEVfd1440P$@ ,WEV(i @ @ @ BTX@1мfjf9W_s uU}EEE Efh ( f"1ɱѱ8ٺ6 -)б3QPhj+5 QQQQRja 1f֐ юَH"1Ўػptr4!PP 栈!桰!桰!XX!j@j td>0tc>2tk> u~tEj$USm]]fEfE EfCe[]XPPPP`jr11t$PV^=1ɱ󥖋D$@t+rBR/=_D$HuKKf)8󥑉-w1)ثufȫd$aσuD$ `X6rtltŰ=Vtf\tGt3CRu fu6 Ж1t -t ^ u 뎪PXPX$< i/ u`1ɴPf 8cuf1< tPЀfBPr0ƀrf Pffag ?P}9m(t int@errDeflPeipHeax4ebx(ecx0edx,esiediebp espcsLds es fsgssscs:eipHss:espBTX halted'00b1001h01 51Çl$EMU ]$PXE(PD$E,D$Xu0}4l$UWVS0 0 ) *1Ҁ= *|$*(* )@,*`00Tj10j%001۾p00000tO00 ы0 у? C~h"vthh@*P@*=@*t&Sh"h" S t1@*tH@,=@,u:u#j h"S j7u Su jh"S h@,0*aP5(*$*# *Ph"x #tt jZtw@*j ƃ u ttA, t"u"@*vOj j 1"-@*=}GtV uj 1h@*t j h@, UUWVSEP8u =0 URh#n j4EP8PEf= t=ELFh#h$#, }+00uS8R|E%uS8PUqE%EË0ډ0jEPS E܅PS8P!]jS8R3VS8PlE裸0Dž41f}t=1j \/S8R;u 4FE9} 4~11\/+0D/0t/S8P8T F~ŋE%Ë0ډ0UMA9DE죸0jP0Z=0tCPh"!.K:Sut @A:uu:kCÍ9rhS6߃t=0tj 1ۅ~:/uB 1u[^_US]Su u#9u1h#h$#V] UWVS]=<*u}=*uh@7**jj5*{u+hd5*h$=\)TthE#80$ *<*u19*5*15$lj $$!=$=$15x$Ƌ `$> d$P5*f15x$)5* *0* *E E05))9uvuUU6 P$0  <)k)9*tI=*uh@*5* d$)P5*)*C=t$*:  C P$ )9wu;)w50$5)#58)5@)#5L$9= *t* P d$P5*S= *0#8));uvuV*PMQu50)uEe[^_ UWVS=<*U=*uhx*4*jj5* *þ,*ǃw=1ڀzu uw Fu t Fvڃ=,*u,*t#t\{t hN#C4*j4*@P5*(uy *9WEVu WEVt=0*tihT#E=8*ufyu $*8*0*9suhZ#h$#4#4*u4*E E Pue[^_ UWVS}u %Gst% ctut0xt+vvo^;tdPqC;uSEuuE F]1u#CȅuKE9rP&KE9sPGN1e[^_US] uj S]UVSuUM t ACJu[^ U=*u01%)У**U‰*UE000UWVS]} u##Phd#b00%0 0=0f0؃00 5 *50k00u1W0Phh#e[^_ UVSu=@0|21jt l+0u9r9r1e[^US]#t(0%00#tS؋]US]=@0|I#tjBt u&j3*#ttu t1]US]00u 0 04[fRf fZBB--uf1ɵ@ tD$ f1$Ðdafd wdad%s /boot.config%s: %s/boot/loader/kernel >> FreeBSD/i386 BOOT Default: %u:%s(%u,%c)%s boot: No %s formatInvalid %s yesnoKeyboard: %s Not ufs slicelabelpartition%cDisk error 0x%x (lba=0x%x) DhaCcdgnPrsv  """""0123456789abcdef/|\- 08t=@   t=!|`H/mnt@@<@T 08t=@   t=!|`S}@@<@TU t=@ H0(7 < h_Yd66|At=t=t=-`As=t=t=-.b7r=r=t=W0>z!r=r=t=#2!r=r=t=X!r=r=t=Z%!r=r=t= 4!r=r=t=5~!r=r=t= !r=r=t= (9!r=r=t='!r=r=t=2U!r=r=t=˰l!r=r=t=+YZ!r=r=t=$b!r=r=t=zn!r=r=t=Nwa*mAs=t=t=vX>!r=r=t= !r=r=t=22!r=r=t=v!r=r=t=ڂ!4!r=r=t=Uy!r=r=t=E1!r=r=t=s"!r=r=t=>)!r=r=t={6(!r=r=t= Yu!r=r=t= 0$%!r=r=t= _m^!r=r=t= B0r!r=r=t= MΔ!r=r=t= @!r=r=t= qn)l!r=r=t= .D!r=r=t= @!r=r=t= ˓p!r=r=t= 2N`!r=r=t= t!r=r=t= ?!r=r=t= #W!r=r=t= E#!r=r=t= rhU!r=r=t= !r=r=t= &}!r=r=t= E8!r=r=t= O!r=r=t= |R(!r=r=t= }v!r=r=t= X]`'!r=r=t= '[!r=r=t= Cm!r=r=t= 1[!r=r=t= c'T!r=r=t= d}!r=r=t= S}!r=r=t= }!r=r=t= ބ%!r=r=t= 2ir!r=r=t= Е##!r=r=t=tU!r=r=t=tsd!r=r=t=td4!r=r=t=tVrD!r=r=t=tP!r=r=t=tIVx!r=r=t=t^!r=r=t=tA!r=r=t=tzQ"Y!r=r=t=t 1{!r=r=t=tۊA!r=r=t=tkuyr!r=r=t=tw!r=r=t=teN!r=r=t=t'Jx!r=r=t=t)|!r=r=t=t8O!r=r=t=t!r=r=t=tD!r=r=t=tbE!r=r=t=ty8!r=r=t=u !r=r=t=uW3!r=r=t=vE!r=r=t=vwGu!r=r=t=v/ 1!r=r=t=v+!r=r=t=v:s!r=r=t=vȴV!r=r=t=vO6!r=r=t=v*!r=r=t=vyG[!r=r=t=v-h!r=r=t=v4J!r=r=t=v 9 !r=r=t=v59!r=r=t=vIC!r=r=t=vc~!r=r=t=vPя{!r=r=t=v!r=r=t=vkOy!r=r=t=v=!r=r=t=v-QR!r=r=t=vn|!r=r=t=wJ T!r=r=t=wS!r=r=t=B5!r=r=t=!s=s=t= UpqD!s=s=t= _M!s=s=t= 0#!s=s=t=c!s=s=t= ɒS{!s=s=t= 't=t=t=ttyv0!s=s=t= mBD!s=s=t=$DBD!s=s=t=,BD!s=s=t=1!s=s=t=c=n!s=s=t=_f!s=s=t=êQ!s=s=t=D!s=s=t=n!s=s=t=;re!s=s=t=gCX!s=s=t=?.!s=s=t=TI>!s=s=t=Qe!s=s=t=|@!s=s=t=%B!s=s=t=q|!s=s=t=t!s=s=t=[h!s=s=t=7!s=s=t=n!s=s=t= Q+!s=s=t= Hq!s=s=t=!s=s=t=/k!s=s=t=w~!s=s=t=7@C!s=s=t=$Q!s=s=t=`!s=s=t=,& !s=s=t=N!s=s=t==U!s=s=t=n!s=s=t=?0n!s=s=t=|!dD!s=s=t=!s=s=t={ T!s=s=t=>q!s=s=t=N !s=s=t=,NB!s=s=t= C!s=s=t=hy_!s=s=t=35!s=s=t=O)<!s=s=t=f;P!s=s=t=gQ!s=s=t=Jny!s=s=t=Dm!s=s=t=!s=s=t=-"H!s=s=t=e^p!s=s=t= ʏ>!s=s=t=@X[!s=s=t=@b!s=s=t=p}}B!s=s=t=_G!s=s=t=#$!s=s=t= !s=s=t=c!s=s=t= b!s=s=t= !s=s=t=RQg!s=s=t=i8!s=s=t=j\z!s=s=t=oVU!s=s=t=4%:}!s=s=t=^0E!s=s=t=)!s=s=t=' F lpI30y*doy5q^Jk8dldI?)%!qp1uE/\jlT1Y.;dZ$#|``2' /=Z7?ǃv my %=ǔ qJmZxKY%|p o篂B~ T1:+do " QLsV1r60"FM FiDJH& ... . .. 0 1 2 3 4 5 6 7 8|9# . ..$ fixit_crunch$ cat$chmod $chroot$ cp$ dd$ df$echor $exprr $killr $ ln$ ls$mkdir $ mv$ rm$rmdir $sleep $syncr $chown $clrir $ disklabel $dmesg $fdisk $mknod $mount $reboot$restore$swapon$umount$ mount_msdos$ mount_cd9660$rrestoret $chgrp $ ftp$telnet$ vi$grepr $viewr $ ex%tar- .... .../ ... . .. dev#stand& bin'sbinn( etc- mnt.mnt1n/mnt2n0mnt3n1mnt4n2 tmp3 usr7@.profilem` chmod 444 meteor$unit ;; bktr?) unit=`expr $i : 'bktr\(.*\)'` mknod bktr$unit c 92 `unit2minor $unit` mknod tuner$unit c 92 `unit2minor $((16 + $unit))` mknod vbi$unit c 92 `unit2minor $((32 + $unit))` chmod 444 bktr$unit tuner$unit vbi$unit ;; tun*) ntun=`expr $i : 'tun\(.*\)$'` unit=0 while [ $unit -le $ntun ]; do mknod tun$unit c 52 `unit2minor $unit` unit=$(($unit + 1)) done ;; tap*) ntap=`expr $i : 'tap\(.*\)$'` unit=0 while [ $unit -le $ntap ]; do mknod tap$unit c 149 `unit2minor $unit` root:network unit=$(($unit + 1)) done ;; sysmouse) mknod sysmouse c 12 128 mknod consolectl c 12 255 ;; jogdial) mknod jogdial c 160 0 ;; snp?) unit=`expr $i : 'snp\(.*\)'` mknod snp$unit c 53 `unit2minor $unit` ;; # dufault@hda.com: If I do much more work on other A-D boards # then eventually we'll have a "ad" and "dio" interface and some of these # "labpcaio" ones will be gone. # labpcaio: D-A and A-D. # labpcdio: Digital in and Digital out. # labpc*) umask 7 case $i in labpcaio*) name=labpcaio unit=`expr $i : 'labpcaio\(.*\)'` all="0 1 2 3 4 5 6 7" offset=0 ;; labpcdio*) name=labpcdio unit=`expr $i : 'labpcdio\(.*\)'` all="0 1 2 3" offset=8 ;; *) die 3 "Don't know LabPC type $i" ;; esac if [ -z "${unit}" ]; then unit=all fi case $unit in 0|1|2|3|4|5|6|7) mknod $name$unit c 66 $(($offset + $unit)) ;; all) for i in $all do mknod $name$i c 66 $(($offset + $i)) done ;; *) echo "No such LabPC unit: $unit" ;; esac umask 77 ;; perfmon) mknod perfmon c 2 32 root:kmem chmod 640 perfmon ;; ipl) mknod ipl c 79 0 mknod ipnat c 79 1 mknod ipstate c 79 2 mknod ipauth c 79 3 ;; kbd*) unit=`expr $i : 'kbd\(.*\)'` chr=112 mknod kbd$unit c $chr `unit2minor $unit` ;; i4b) mknod i4b c 60 0 ;; i4bctl) mknod i4bctl c 55 0 ;; i4brbch*) unit=`expr $i : 'i4brbch\(.*\)'` mknod i4brbch$unit c 57 `unit2minor $unit` ;; i4bteld*) offset=64 unit=`expr $i : 'i4bteld\(.*\)'` mknod i4bteld$unit c 56 `unit2minor $(($offset + $unit))` ;; i4btel*) unit=`expr $i : 'i4btel\(.*\)'` mknod i4btel$unit c 56 `unit2minor $unit` ;; i4btrc*) unit=`expr $i : 'i4btrc\(.*\)'` mknod i4btrc$unit c 59 `unit2minor $unit` ;; aac*) unit=`expr $i : 'aac\(.*\)'` mknod aac$unit c 150 `unit2minor $unit` ln -fs aac$unit afa$unit ln -fs aac$unit hpn$unit ;; mlx*) unit=`expr $i : 'mlx\(.*\)'` mknod mlx$unit c 130 `unit2minor $unit` ;; amr*) unit=`expr $i : 'amr\(.*\)'` mknod amr$unit c 132 `unit2minor $unit` ;; ciss*) unit=`expr $i : 'ciss\(.*\)'` mknod ciss$unit c 166 `unit2minor $unit` ;; agpgart) mknod agpgart c 148 0 ;; twe*) unit=`expr $i : 'twe\(.*\)'` mknod twe$unit c 146 `unit2minor $unit` ;; tw*) unit=`expr $i : 'tw\(.*\)'` mknod tw$unit c 19 `unit2minor $unit` root:operator ;; cfs*) unit=`expr $i : 'cfs\(.*\)'` mknod cfs$unit c 93 $unit root:operator ;; nsmb*) unit=`expr $i : 'nsmb\(.*\)'` mknod nsmb$unit c 144 $unit ;; local) umask 0 # XXX should be elsewhere sh MAKEDEV.local umask 77 ;; *) echo $i - no such device name ;; esac done #!/bin/sh - # # Copyright (c) 1990 The Regents of the University of California. # All rights reserved. # # Written and contributed by W. Jolitz 12/90 # # Redistribution and use in source and binary forms are permitted provided # that: (1) source distributions retain this entire copyright notice and # comment, and (2) distributions including binaries display the following # acknowledgement: ``This product includes software developed by the # University of California, Berkeley and its contributors'' in the # documentation or other materials provided with the distribution and in # all advertising materials mentioning features or use of this software. # Neither the name of the University nor the names of its contributors may # be used to endorse or promote products derived from this software without # specific prior written permission. # THIS SOFTWARE IS PROVIDED ``AS IS'' AND WITHOUT ANY EXPRESS OR IMPLIED # WARRANTIES, INCLUDING, WITHOUT LIMITATION, THE IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. # # @(#)MAKEDEV 5.2 (Berkeley) 6/22/90 # $FreeBSD: src/etc/MAKEDEV,v 1.243.2.47 2002/04/21 19:47:06 will Exp $ # # Device "make" file. Valid arguments: # all makes all known devices, standard number of units (or close) # std standard devices # jail suitable for a jail(8) # local configuration specific devices # mach-4 mach4&lites+devices for Mach's XFree86 distribution # (see http://www.cs.hut.fi/lites.html for more info on LITES) # # Tapes: # wt* QIC-interfaced (e.g. not SCSI) 3M cartridge tape # sa* SCSI Sequential Access Devices # # Disks: # aac* Adaptec FSA RAID controllers # aacd* Adaptec FSA RAID # acd* ATAPI CD-ROM disks # amrd* AMI MegaRAID # cd* SCSI CD-ROM disks # da* SCSI Direct Access Devices # fd* floppy disk drives (3 1/2", 5 1/4") # fla* M-Systems DiskOnChip # idad* Compaq Smart-2 RAID arrays # matcd* Matsushita (Panasonic) CD-ROM disks # mcd* Mitsumi CD-ROM disks # md* Memory (or malloc) disk # mlx* Mylex DAC960 RAID controllers # mlxd* Mylex DAC960 RAID disk volumes # scd* Sony CD-ROM disks # vn* vnode disks # wd* "Winchester" disk drives (ST506,IDE,ESDI,RLL,...) # wfd* IDE floppy disk drives (LS-120) # # Console ports: # vty* virtual console devices for syscons/pcvt/codrv # # Pointing devices: # mse* Logitech and ATI Inport bus mouse # psm* PS/2 mouse # jogdial Sony VAIO Jogdial # sysmouse Mousesystems mouse emulator for syscons # # Time devices: # refclock-* serial ports used by xntpd parse refclocks # # Terminal ports: # tty* general purpose serial ports # cua* dialout serial ports # ttyA* Specialix SI/XIO dialin ports ('*' = number of devices) # cuaA* Specialix SI/XIO dialout ports # ttyD* Digiboard - 16 dialin ports # cuaD* Digiboard - 16 dialout ports # ttyE* Stallion EasyIO (stl) dialin ports # cuaE* Stallion EasyIO (stl) dialout ports # ttyF* Stallion Brumby (stli) dialin ports # cuaF* Stallion Brumby (stli) dialout ports # ttyR* Rocketport dialin ports # cuaR* Rocketport dialout ports # # stlN Stallion EasyIO board N dialin and dialout # stliN Stallion Brumby board N dialin and dialout # # Pseudo terminals: # pty* set of 32 master and slave pseudo terminals # vty* virtual terminals using syscons/pcvt/codrv console # # Parallel port: # lpt* Printer # ppi* Parallel port i/o # pps* Pulse per second timing interface # pcfclock* Parallel time sync interface # # I2C and SMBus: # iic* I2C devices # smb* SMBUS devices # # USB devices: # usb* USB bus control device # ugen* generic USB device # uhid* Human Interface Device (HID) # ulpt* printer # umodem* modems # ums* mouse # urio* Diamond Rio 500 # uscanner* USB scanners # usio* USB serial devices # # SCSI devices (other than CD-ROM, tape and disk): # ch* SCSI Media-Changer (juke box) driver # pt* Processor Type (HP scanner, as one example) # pass* CAM Passthrough device # ses* SES (SCSI Environmental Services) and # SAF-TE (Scsi Accessable Fault-Tolerant Enclosures) device # # PC-CARD (previously called PCMCIA) support # card* PC-CARD slots # # ISDN devices: # i4b isdnd call control device # i4bctl debugging control device # i4btrc* trace data interface(s), one per passive card # i4btel* telephony interface(s) # i4bteld* telephony dialout interface(s) # i4brbch* raw b channel access device(s) # # Special purpose devices: # apm Advanced Power Management BIOS # apmctl APM BIOS control device # bpf* packet filter # speaker pc speaker # tw* xten power controller # snd* various sound cards # pcaudio PCM audio driver # socksys iBCS2 socket system driver # vat VAT compatibility audio driver (requires snd*) # gsc Genius GS-4500 hand scanner # joy pc joystick # tun* Tunneling IP device # tap* Ethernet Tunneling device # snp* tty snoop devices # spigot Video Spigot video acquisition card # ctx* Cortex-I video acquisition card # meteor* Matrox Meteor video acquisition card (pci) # bktr* Bt848 based video acquisition card (pci) # labpc* National Instrument's Lab-PC and LAB-PC+ # perfmon CPU performance-monitoring counters # pci PCI configuration-space access from user mode # ipl ipfilter control devices (ipl, ipnat, ipstate, ipauth) # kbd keyboard devices # agpgart AGP interface # cfs* Coda Distributed Filesystem # nsmb* SMB/CIFS protocol interface # if [ -n "$MAKEDEVPATH" ]; then PATH="$MAKEDEVPATH" else PATH=/sbin:/bin fi umask 77 # Usage: die exitcode msg die() { echo $2 exit $1 } # Convert integer to partition name dkitop() { local p case $1 in 0) p=a;; 1) p=b;; 2) p=c;; 3) p=d;; 4) p=e;; 5) p=f;; 6) p=g;; 7) p=h;; *) p="?";; esac echo $p } # Convert integer to slice name dkitos() { local s case $1 in 0) s="";; 1) s="";; *) s=s$(($1-1));; esac echo $s } # Convert disk (type, unit, slice, partition) to minor number dkminor() { echo $(($1 << 25 | ($2 / 32) << 21 | ($2 % 32) << 3 | $3 << 16 | $4)) } # Override mknod(2) to add extra handling to it. mknod=/sbin/mknod for i in `IFS=':'; echo $PATH`; do if [ -x "${i}/mknod" ]; then mknod="${i}/mknod" break fi done mknod() { rm -f "$1" || exit 1 case $# in 4) "$mknod" "$@" root:wheel || die 2 "$mknod $@ failed";; 5) "$mknod" "$@" || die 2 "$mknod $@ failed";; *) die 2 "bad node: mknod $@";; esac } # Convert tape (ctrl, unit, mode, access) to minor number saminor() { echo $(($1 << 29 | ($2 / 16) << 16 | ($2 % 16) << 4 | $3 << 2 | $4)) } # Convert the last character of a tty name to a minor number. ttyminor() { case $1 in [0-9]) m=$1;; a) m=10;; b) m=11;; c) m=12;; d) m=13;; e) m=14;; f) m=15;; g) m=16;; h) m=17;; i) m=18;; j) m=19;; k) m=20;; l) m=21;; m) m=22;; n) m=23;; o) m=24;; p) m=25;; q) m=26;; r) m=27;; s) m=28;; t) m=29;; u) m=30;; v) m=31;; *) m="?";; esac echo $m } # Convert a unit number to a minor number. unit2minor() { echo $(((($1 >> 8) << 16) | ($1 % 256))) } # For the stallion devices tty[EF] # stallion major letter card iscallout stallion () { major=$1 letter=$2 card=$3 iscallout=$4 port=0 maxport=8 pref=tty owner= minorbase=0 if [ $iscallout -gt 0 ]; then pref=cua owner=uucp:dialer minorbase=128 fi case "$card" in [0-7]);; *) die 1 "Invalid stl card number $card";; esac # make the mem interface for extracting stats & loading microcode. # 0x1000000 + card number mknod staliomem$card c $major 0x0100000$card while [ $port -lt $maxport ]; do minor=$(($minorbase + $card * 1048576 + $port)) if [ $port -ge 32 ]; then minor=$(($minor + 65504)) fi unit=$(($card * 64 + $port)) mknod ${pref}${letter}$unit c $major $minor $owner mknod ${pref}i${letter}$unit c $major $(($minor + 32)) $owner mknod ${pref}l${letter}$unit c $major $(($minor + 64)) $owner port=$(($port + 1)) done } # Raw partition for disks dkrawpart=2 # Compatibility slice for disks dkcompatslice=0 # Raw slice for disks dkrawslice=1 # Standard umasks disk_umask=037 # allow group operator to read disks tape_umask=017 # allow group operator to read/write tapes for i in $*; do case $i in all) sh MAKEDEV std # standard sh MAKEDEV fd0 fd1 # bdev, floppy disk sh MAKEDEV da0 da1 da2 da3 # bdev, SCSI disk sh MAKEDEV ata # cdev, ATA control sh MAKEDEV ad0 ad1 ad2 ad3 # bdev, ATA disk sh MAKEDEV ar0 ar1 # bdev, ATA RAID disk sh MAKEDEV acd0 afd0 ast0 # bdev, ATAPI devices sh MAKEDEV wd0 wd1 wd2 wd3 # bdev, OLD disk sh MAKEDEV wcd0 wfd0 wst0 # bdev, OLD ATAPI devs sh MAKEDEV vn0 # bdev, virtual disk sh MAKEDEV cd0 matcd0 mcd0 scd0 # bdev, cdrom sh MAKEDEV sa0 wt0 # bdev, tape sh MAKEDEV vty12 # cdev, virtual tty sh MAKEDEV cuaa0 cuaa1 cuaa2 cuaa3 # cdev, serial tty sh MAKEDEV pty0 # cdev, pseudo tty sh MAKEDEV ttyd0 ttyd1 ttyd2 ttyd3 # cdev, serial tty sh MAKEDEV zs0 # big-Alpha serial tty sh MAKEDEV kbd0 kbd1 # cdev, keyboard sh MAKEDEV mse0 psm0 jogdial sysmouse # cdev, mouse sh MAKEDEV pcaudio speaker snd0 # cdev, noise sh MAKEDEV lpt0 lpt1 lpt2 # cdev, printer sh MAKEDEV ppi0 ppi1 ppi2 # cdev, parallel port sh MAKEDEV iic0 iic1 # cdev, I2C device sh MAKEDEV smb0 smb1 # cdev, SMBus device sh MAKEDEV usb usb0 uhid0 ums0 ulpt0 ugen0 # cdev, USB devices sh MAKEDEV urio0 uscanner0 umodem0 # cdev, USB devices too sh MAKEDEV bpf0 bpf1 bpf2 bpf3 # cdev, network sh MAKEDEV ipl tun0 tun1 tun2 tun3 # cdev, network sh MAKEDEV tap0 tap1 tap2 tap3 # cdev, network sh MAKEDEV ch0 perfmon tw0 # cdev, miscellaneous sh MAKEDEV apm apmctl card0 card1 card2 card3 # cdev, laptop sh MAKEDEV pass4 xpt2 # cdev, CAM sh MAKEDEV i4b i4bctl i4btrc0 i4btrc1 # cdev, ISDN sh MAKEDEV i4btel0 i4btel1 i4bteld0 i4bteld1 # cdev, ISDN sh MAKEDEV i4brbch0 i4brbch1 # cdev, ISDN sh MAKEDEV agpgart # cdev, AGP sh MAKEDEV nsmb0 # cdev, SMB/CIFS ;; # a much restricted set of the above, to save precious i-nodes on the # fixit floppy fixit) sh MAKEDEV std # standard sh MAKEDEV fd0 # bdev, floppy disk sh MAKEDEV da0 # bdev, SCSI disk sh MAKEDEV ad0 # bdev, ATA disk sh MAKEDEV acd0 afd0 ast0 # bdev, ATAPI devices sh MAKEDEV wd0 # bdev, OLD disk sh MAKEDEV wcd0 wfd0 wst0 # bdev, OLD ATAPI devs sh MAKEDEV vn0 # bdev, virtual disk sh MAKEDEV cd0 # bdev, cdrom sh MAKEDEV sa0 # bdev, tape sh MAKEDEV vty2 # cdev, virtual tty sh MAKEDEV cuaa0 # cdev, serial tty sh MAKEDEV pty0 # cdev, pseudo tty sh MAKEDEV ttyd0 # cdev, serial tty sh MAKEDEV zs0 # big-Alpha serial tty sh MAKEDEV kbd0 # cdev, keyboard sh MAKEDEV mse0 psm0 sysmouse # cdev, mouse sh MAKEDEV lpt0 # cdev, printer sh MAKEDEV ppi0 # cdev, parallel port sh MAKEDEV iic0 # cdev, I2C device sh MAKEDEV smb0 # cdev, SMBus device sh MAKEDEV ums0 # cdev, USB devices sh MAKEDEV tun0 # cdev, network sh MAKEDEV tap0 # cdev, network sh MAKEDEV ch0 # cdev, miscellaneous sh MAKEDEV apm apmctl card0 # cdev, laptop sh MAKEDEV pass1 xpt1 # cdev, CAM sh MAKEDEV i4b i4bctl i4btrc0 i4btrc1 # cdev, ISDN sh MAKEDEV i4btel0 i4bteld0 # cdev, ISDN sh MAKEDEV i4brbch0 # cdev, ISDN rm -f fd/[1-9]? ;; std) mknod console c 0 0; chmod 600 console mknod kmem c 2 1 root:kmem; chmod 640 kmem mknod mem c 2 0 root:kmem; chmod 640 mem mknod null c 2 2; chmod 666 null mknod random c 2 3; chmod 644 random mknod urandom c 2 4; chmod 644 urandom mknod zero c 2 12; chmod 666 zero mknod io c 2 14; chmod 600 io mknod tty c 1 0; chmod 666 tty mknod klog c 7 0; chmod 600 klog mknod stdin c 22 0; chmod 666 stdin mknod stdout c 22 1; chmod 666 stdout mknod stderr c 22 2; chmod 666 stderr mknod pci c 78 0; chmod 644 pci mkdir -p fd (cd fd && i=0 && while [ $i -lt 64 ]; do mknod $i c 22 $i i=$(($i + 1)) done ) chmod 555 fd chmod 666 fd/* ;; jail) sh MAKEDEV std pty0 rm mem kmem pci io klog console # for security ln -sf null mem # for libkvm (ab)users ln -sf null kmem # --//-- ln -sf null console ;; mach-4) mknod iopl c 22 0 mknod kbd c 23 0 mknod mouse c 24 0 mknod time c 25 0 mknod timezone c 26 0 ;; # Create device files for new Archive/Wangtek QIC-02 tape driver (vak) wt*) umask $tape_umask u=`expr $i : '..\(.*\)'` if [ -z "${u}" ]; then u=0; fi # default density, 512b blocks mknod rwt${u} c 10 $(( 0 + $u)) root:operator mknod nrwt${u} c 10 $(( 4 + $u)) root:operator # default density, 1024b blocks # mknod rWt${u} c 10 $((64 + $u)) root:operator # mknod nrWt${u} c 10 $((68 + $u)) root:operator mknod rwt${u}b c 10 $((16 + $u)) root:operator # 60 megabytes mknod nrwt${u}b c 10 $((20 + $u)) root:operator mknod rwt${u}c c 10 $((24 + $u)) root:operator # 120 megabytes mknod nrwt${u}c c 10 $((28 + $u)) root:operator mknod rwt${u}d c 10 $((32 + $u)) root:operator # 150 megabytes mknod nrwt${u}d c 10 $((36 + $u)) root:operator # mknod rwt${u}e c 10 $((40 + $u)) root:operator # 300 megabytes? # mknod nrwt${u}e c 10 $((44 + $u)) root:operator # mknod rwt${u}f c 10 $((48 + $u)) root:operator # 600 megabytes? # mknod nrwt${u}f c 10 $((52 + $u)) root:operator umask 77 ;; # Individual slices. aacd*s*|ad*s*|ar*s*|afd*s*|amrd*s*|da*s*|fla*s*|idad*s*|md*s*|mlxd*s*|twed*s*|vn*s*|wd*s*|wfd*s*) umask $disk_umask case $i in aacd*s*) name=aacd; chr=151;; ad*s*) name=ad; chr=116;; ar*s*) name=ar; chr=157;; afd*s*) name=afd; chr=118;; amrd*s*) name=amrd; chr=133;; da*s*) name=da; chr=13;; fla*s*) name=fla; chr=102;; idad*s*) name=idad; chr=109;; md*s*) name=md; chr=95;; mlxd*s*) name=mlxd; chr=131;; twed*s*) name=twed; chr=147;; vn*s*) name=vn; chr=43;; wd*s*) name=wd; chr=3;; wfd*s*) name=wfd; chr=87;; esac case $i in aacd*s*|amrd*s*|idad*s*|mlxd*s*|twed*s*) unit=`expr $i : '....\([0-9]*\)s'` slice=`expr $i : '....[0-9]*s\([0-9]*\)'` part=`expr $i : '....[0-9]*s[0-9]*\(.*\)'` ;; afd*s*|fla*s*|wfd*s*) unit=`expr $i : '...\([0-9]*\)s'` slice=`expr $i : '...[0-9]*s\([0-9]*\)'` part=`expr $i : '...[0-9]*s[0-9]*\(.*\)'` ;; *) unit=`expr $i : '..\([0-9]*\)s'` slice=`expr $i : '..[0-9]*s\([0-9]*\)'` part=`expr $i : '..[0-9]*s[0-9]*\(.*\)'` ;; esac case $unit in [0-9]|[0-9][0-9]|[0-4][0-9][0-9]|50[0-9]|51[0-1]) case $slice in [0-9]|[1-2][0-9]|30) oldslice=$slice slice=$(($slice+1)) slicename=`dkitos $slice` minor=`dkminor 0 $unit $slice $dkrawpart` mknod $name$unit$slicename c $chr $minor root:operator ln -f $name$unit$slicename r$name$unit$slicename case $part in [a-h]) case $oldslice in 0) slice=$oldslice ;; esac for part in 0 1 2 3 4 5 6 7 do minor=`dkminor 0 $unit $slice $part` partname=`dkitop $part` mknod $name$unit$slicename$partname \ c $chr $minor root:operator ln -f $name$unit$slicename$partname \ r$name$unit$slicename$partname done ;; "") ;; *) echo bad partition for disk in: $i ;; esac ;; *) echo bad slice for disk in: $i ;; esac ;; *) echo bad unit for disk in: $i "(unit=$unit, slice=$slice, part=$part)" ;; esac umask 77 ;; fd*) umask $disk_umask unit=`expr $i : '..\(.*\)'` name=fd; chr=9 case $unit in 0|1|2|3) mknod ${name}${unit} c $chr $(($unit * 64)) root:operator ln -f ${name}${unit} r${name}${unit} # Fake BSD partitions for i in a b c d e f g h do ln -f ${name}${unit} ${name}${unit}$i ln -f r${name}${unit} r${name}${unit}$i done # User-readable and programmer-readable name sets mknod ${name}${unit}.1720 c $chr $(($unit * 64 + 1)) \ root:operator ln -f ${name}${unit}.1720 r${name}${unit}.1720 # ln -f ${name}${unit}.1720 ${name}${unit}135hs21 # ln -f r${name}${unit}.1720 r${name}${unit}135hs21 mknod ${name}${unit}.1480 c $chr $(($unit * 64 + 2)) \ root:operator ln -f ${name}${unit}.1480 r${name}${unit}.1480 # ln -f ${name}${unit}.1480 ${name}${unit}135hs18 # ln -f r${name}${unit}.1480 r${name}${unit}135hs18 # ln -f ${name}${unit}.1480 ${name}${unit}96hs18 # ln -f r${name}${unit}.1480 r${name}${unit}96hs18 mknod ${name}${unit}.1440 c $chr $(($unit * 64 + 3)) \ root:operator ln -f ${name}${unit}.1440 r${name}${unit}.1440 # ln -f ${name}${unit}.1440 ${name}${unit}135 # ln -f r${name}${unit}.1440 r${name}${unit}135 # ln -f ${name}${unit}.1440 ${name}${unit}135ds18 # ln -f r${name}${unit}.1440 r${name}${unit}135ds18 # ln -f ${name}${unit}.1440 ${name}${unit}96ds18 # ln -f r${name}${unit}.1440 r${name}${unit}96ds18 mknod ${name}${unit}.1200 c $chr $(($unit * 64 + 4)) \ root:operator ln -f ${name}${unit}.1200 r${name}${unit}.1200 # ln -f ${name}${unit}.1200 ${name}${unit}96 # ln -f r${name}${unit}.1200 r${name}${unit}96 # ln -f ${name}${unit}.1200 ${name}${unit}96ds15 # ln -f r${name}${unit}.1200 r${name}${unit}96ds15 # ln -f ${name}${unit}.1200 ${name}${unit}135ds15 # ln -f r${name}${unit}.1200 r${name}${unit}135ds15 mknod ${name}${unit}.820 c $chr $(($unit * 64 + 5)) \ root:operator ln -f ${name}${unit}.820 r${name}${unit}.820 # ln -f ${name}${unit}.820 ${name}${unit}96hs10 # ln -f r${name}${unit}.820 r${name}${unit}96hs10 # ln -f ${name}${unit}.820 ${name}${unit}135hs10 # ln -f r${name}${unit}.820 r${name}${unit}135hs10 mknod ${name}${unit}.800 c $chr $(($unit * 64 + 6)) \ root:operator ln -f ${name}${unit}.800 r${name}${unit}.800 # ln -f ${name}${unit}.800 ${name}${unit}96ds10 # ln -f r${name}${unit}.800 r${name}${unit}96ds10 # ln -f ${name}${unit}.800 ${name}${unit}135ds10 # ln -f r${name}${unit}.800 r${name}${unit}135ds10 mknod ${name}${unit}.720 c $chr $(($unit * 64 + 7)) \ root:operator ln -f ${name}${unit}.720 r${name}${unit}.720 # ln -f ${name}${unit}.720 ${name}${unit}96ds9 # ln -f r${name}${unit}.720 r${name}${unit}96ds9 # ln -f ${name}${unit}.720 ${name}${unit}135ds9 # ln -f r${name}${unit}.720 r${name}${unit}135ds9 mknod ${name}${unit}.360 c $chr $(($unit * 64 + 8)) \ root:operator ln -f ${name}${unit}.360 r${name}${unit}.360 # ln -f ${name}${unit}.360 ${name}${unit}48 # ln -f r${name}${unit}.360 r${name}${unit}48 # ln -f ${name}${unit}.360 ${name}${unit}48ds9 # ln -f r${name}${unit}.360 r${name}${unit}48ds9 mknod ${name}${unit}.640 c $chr $(($unit * 64 + 9)) \ root:operator ln -f ${name}${unit}.640 r${name}${unit}.640 # ln -f ${name}${unit}.640 ${name}${unit}96ds8 # ln -f r${name}${unit}.640 r${name}${unit}96ds8 # ln -f ${name}${unit}.640 ${name}${unit}135ds8 # ln -f r${name}${unit}.640 r${name}${unit}135ds8 mknod ${name}${unit}.1232 c $chr $(($unit * 64 + 10)) \ root:operator ln -f ${name}${unit}.1232 r${name}${unit}.1232 # ln -f ${name}${unit}.1232 ${name}${unit}96ds8 # ln -f r${name}${unit}.1232 r${name}${unit}96ds8 # ln -f ${name}${unit}.1232 ${name}${unit}135ds8 # ln -f r${name}${unit}.1232 r${name}${unit}135ds8 ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; aacd*|ad*|ar*|afd*|amrd*|da*|fla*|idad*|md*|mlxd*|twed*|vn*|wd*|wfd*) umask $disk_umask case $i in aacd*) name=aacd; chr=151;; ad*) name=ad; chr=116;; ar*) name=ar; chr=157;; afd*) name=afd; chr=118;; amrd*) name=amrd; chr=133;; da*) name=da; chr=13;; fla*) name=fla; chr=102;; idad*) name=idad; chr=109;; md*) name=md; chr=95;; mlxd*) name=mlxd; chr=131;; twed*) name=twed; chr=147;; vn*) name=vn; chr=43;; wd*) name=wd; chr=3;; wfd*) name=wfd; chr=87;; esac case $i in aacd*|amrd*|idad*|mlxd*|twed*) unit=`expr $i : '....\(.*\)'` ;; afd*|fla*|wfd*) unit=`expr $i : '...\(.*\)'` ;; *) unit=`expr $i : '..\(.*\)'` ;; esac case $unit in [0-9]|[0-9][0-9]|[0-4][0-9][0-9]|50[0-9]|51[0-1]) for slicepartname in s0h s1h s2 s3 s4 do sh MAKEDEV $name$unit$slicepartname done ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; ccd*) umask $disk_umask name=ccd chr=74 unit=`expr $i : '...\(.*\)'` case $unit in [0-9]|[0-9][0-9]|[0-4][0-9][0-9]|50[0-9]|51[0-1]) for part in 0 1 2 3 4 5 6 7 do minor=`dkminor 0 $unit 0 $part` partname=`dkitop $part` mknod $name$unit$partname c $chr $minor root:operator ln -f $name$unit$partname r$name$unit$partname done ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; # SCSI processor type driver pt[0-9]*) chr=61 name=pt unit=`expr $i : 'pt\([0-9][0-9]*\)'` if [ -z "${unit}" ]; then unit=0 fi unit=$(($unit + 1 - 1)) mknod ${name}${unit} c $chr `unit2minor $unit` ;; # SCSI SES/SAF-TE type driver ses[0-9]*) chr=110 name=ses unit=`expr $i : 'ses\([0-9][0-9]*\)'` if [ -z "${unit}" ]; then unit=0 fi unit=$(($unit + 1 - 1)) mknod ${name}${unit} c $chr `unit2minor $unit` ;; # SCSI target mode sample driver targ[0-9]*) chr=65 name=targ unit=`expr $i : 'targ\([0-9][0-9]*\)'` if [ -z "${unit}" ]; then unit=0 fi unit=$(($unit + 1 - 1)) mknod ${name}${unit} c $chr `unit2minor $unit` mknod ${name}.ctl c $chr 0xffff00ff ;; # CAM transport layer device xpt*) # This major number is temporary chr=104 name=xpt units=`expr $i : 'xpt\(.*\)'` if [ -z "${units}" ]; then units=1 fi i=0 while [ $i -lt $units ]; do dname=$name$i rm -rf $dname r$dname mknod $dname c $chr `unit2minor $i` root:operator i=$(($i + 1)) done ;; # CAM passthrough device pass*) # This major number is temporary chr=31 name=pass units=`expr $i : 'pass\(.*\)'` if [ -z "${units}" ]; then units=1 fi i=0 while [ $i -lt $units ]; do dname=$name$i rm -rf $dname r$dname mknod $dname c $chr `unit2minor $i` root:operator i=$(($i + 1)) done ;; pty*) class=`expr $i : 'pty\(.*\)'` case $class in 0) offset=0 name=p;; 1) offset=32 name=q;; 2) offset=64 name=r;; 3) offset=96 name=s;; # Note that xterm (at least) only look at p-s. 4) offset=128 name=P;; 5) offset=160 name=Q;; 6) offset=192 name=R;; 7) offset=224 name=S;; # This still leaves [tuTU]. *) echo bad unit for pty in: $i;; esac umask 0 case $class in 0|1|2|3|4|5|6|7) i=0 while [ $i -lt 32 ]; do # This was an awk substr() before. c=$(echo 0123456789abcdefghijklmnopqrstuv | dd bs=1 skip=$i count=1 2>/dev/null) mknod tty$name$c c 5 $(($offset + $i)) mknod pty$name$c c 6 $(($offset + $i)) i=$(($i + 1)) done ;; esac umask 77 ;; sa*) umask $tape_umask unit=`expr $i : '..\(.*\)'` chr=14 case $unit in [0-9]|[1-9][0-9]|[1-9][0-9][0-9]|[1-9][0-9][0-9][0-9]) mknod sa${unit}.ctl c $chr `saminor 1 ${unit} 0 0` ln -f sa${unit}.ctl rsa${unit}.ctl for m in 0 1 2 3 do mknod sa${unit}.${m} c $chr \ `saminor 0 ${unit} ${m} 0` root:operator ln -f sa${unit}.${m} rsa${unit}.${m} mknod nsa${unit}.${m} c $chr \ `saminor 0 ${unit} ${m} 1` root:operator ln -f nsa${unit}.${m} nrsa${unit}.${m} mknod esa${unit}.${m} c $chr \ `saminor 0 ${unit} ${m} 2` root:operator ln -f esa${unit}.${m} ersa${unit}.${m} done ln -f sa${unit}.0 sa${unit} ln -f sa${unit}.0 rsa${unit}.0 ln -f sa${unit}.0 rsa${unit} ln -f nsa${unit}.0 nsa${unit} ln -f nsa${unit}.0 nrsa${unit}.0 ln -f nsa${unit}.0 nrsa${unit} ln -f esa${unit}.0 esa${unit} ln -f esa${unit}.0 ersa${unit}.0 ln -f esa${unit}.0 ersa${unit} ;; *) echo bad unit for tape in: $i ;; esac umask 77 ;; ch*) umask 37 unit=`expr $i : '..\(.*\)'` case $i in ch*) name=ch; chr=17;; esac case $unit in 0|1|2|3|4|5|6) mknod ${name}${unit} c $chr $unit root:operator ;; *) echo bad unit for media changer in: $i ;; esac umask 77 ;; ata) mknod ata c 159 0 root:operator ;; ast*) umask 2 ; unit=`expr $i : '...\(.*\)'` chr=119 case $unit in 0|1|2|3) mknod ast${unit} c $chr $(($unit * 8 + 0)) root:operator chmod 640 ast${unit} mknod nast${unit} c $chr $(($unit * 8 + 1)) root:operator chmod 640 nast${unit} ;; *) echo bad unit for tape in: $i ;; esac umask 77 ;; acd*t*) umask $disk_umask units=`expr $i : '...\(.*\)t'`; tracks=`expr $i : '.*t\(.*\)'`; name=acd; chr=117; if [ -z "${units}" -o "${units}" -le 0 ]; then units=1 fi if [ -z "${tracks}" -o "${tracks}" -le 0 ]; then tracks=100 fi if [ "${units}" -le 31 -a "${tracks}" -le 169 ]; then i=0 while [ $i -le $units ]; do dname=$name$i rm -rf ${dname}t* j=1 while [ $j -le ${tracks} ]; do mknod ${dname}t$j c $chr \ $((($i * 8) + (65536 * $j))) \ root:operator j=$(($j + 1)) done i=$(($i + 1)) done else echo "$i is invalid -- can't have more than 32 cd devices or 169 tracks" fi umask 77 ;; acd*|cd*|mcd*|scd*) umask $disk_umask case $i in acd*) units=`expr $i : '...\(.*\)'`; name=acd; chr=117;; cd*) units=`expr $i : '..\(.*\)'`; name=cd; chr=15;; mcd*) units=`expr $i : '...\(.*\)'`; name=mcd; chr=29;; scd*) units=`expr $i : '...\(.*\)'`; name=scd; chr=45;; esac if [ -z "${units}" -o "${units}" -le 0 ]; then units=1 fi if [ "${units}" -le 31 ]; then i=0 while [ $i -le $units ]; do dname=$name$i rm -rf ${dname}* r${dname}* mknod ${dname}a c $chr $(($i * 8)) root:operator case $name in acd) ln -f ${dname}a ${dname}c;; *) mknod ${dname}c c $chr $(($i * 8 + 2)) root:operator;; esac ln -f ${dname}a r${dname}a ln -f ${dname}c r${dname}c i=$(($i + 1)) done else echo "$i is invalid -- can't have more than 32 cd devices" fi umask 77 ;; matcd*) umask 2 case $i in matcd*) unit=`expr $i : '.....\(.*\)'`; name=matcd; chr=46;; esac case $unit in 0|1|2|3|4|5|6|7|8|9|10|11|12|13|14|15) mknod ${name}${unit}a c $chr $(($unit * 8 + 0)) \ root:operator mknod ${name}${unit}c c $chr $(($unit * 8 + 2)) \ root:operator ln -f ${name}${unit}a r${name}${unit}a ln -f ${name}${unit}c r${name}${unit}c chmod 640 ${name}${unit}[a-h] r${name}${unit}[a-h] mknod ${name}${unit}la c $chr $(($unit * 8 + 128)) \ root:operator mknod ${name}${unit}lc c $chr $(($unit * 8 + 130)) \ root:operator ln -f ${name}${unit}la r${name}${unit}la ln -f ${name}${unit}lc r${name}${unit}lc chmod 640 ${name}${unit}l[a-h] r${name}${unit}l[a-h] ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; wcd*) umask 2 ; unit=`expr $i : '...\(.*\)'` chr=69 case $unit in 0|1|2|3|4|5|6|7) mknod wcd${unit}a c $chr $(($unit * 8 + 0)) root:operator mknod wcd${unit}c c $chr $(($unit * 8 + 2)) root:operator ln -f wcd${unit}a rwcd${unit}a ln -f wcd${unit}c rwcd${unit}c chmod 640 wcd${unit}[a-h] rwcd${unit}[a-h] ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; wst*) umask 2 ; unit=`expr $i : '...\(.*\)'` chr=90 case $unit in 0|1|2|3) mknod rwst${unit} c $chr $(($unit * 8 + 0)) root:operator chmod 640 rwst${unit} ;; esac umask 77 ;; iic*) unit=`expr $i : 'iic\(.*\)'` mknod iic$unit c 105 `unit2minor $unit` ;; smb*) unit=`expr $i : 'smb\(.*\)'` mknod smb$unit c 106 `unit2minor $unit` ;; pcfclock*) unit=`expr $i : 'pcfclock\(.*\)'` mknod pcfclock$unit c 140 `unit2minor $unit` ;; ppi*) unit=`expr $i : 'ppi\(.*\)'` mknod ppi$unit c 82 `unit2minor $unit` ;; pps*) unit=`expr $i : 'pps\(.*\)'` mknod pps$unit c 89 `unit2minor $unit` ;; usb) mknod usb$unit c 108 255 root:operator chmod 0660 usb$unit ;; usb*) umask 7 unit=`expr $i : 'usb\(.*\)'` mknod usb$unit c 108 `unit2minor $unit` root:operator umask 77 ;; uhid*) umask 7 unit=`expr $i : 'uhid\(.*\)'` mknod uhid$unit c 122 `unit2minor $unit` root:operator umask 77 ;; ums*) umask 7 unit=`expr $i : 'ums\(.*\)'` mknod ums$unit c 111 `unit2minor $unit` root:operator umask 77 ;; ulpt*) unit=`expr $i : 'ulpt\(.*\)'` minor=`unit2minor $unit` mknod ulpt$unit c 113 $minor minor=`unit2minor $(($unit + 64))` mknod unlpt$unit c 113 $minor # and the 'no prime' version ;; ugen*) umask 7 unit=`expr $i : 'ugen\([0-9][0-9]*\)'` endpoint=`expr $i : 'ugen.*\.\([0-9][0-9]*\)'` if [ -z "${unit}" ]; then echo $i - Invalid unit number fi if [ -z "${endpoint}" ]; then # ugen0 & ugen0.1 - ugen0.15 mknod ugen$unit c 114 \ `unit2minor $(($unit * 16))` root:operator i=1 while [ $i -lt 16 ]; do mknod ugen$unit.$i c 114 \ `unit2minor $(($unit * 16 + $i))` root:operator i=$(($i + 1)) done else minor=`unit2minor $(($unit * 16 + $endpoint))` mknod ugen$unit.$endpoint c 114 $minor root:operator fi umask 77 ;; urio*) umask 7 unit=`expr $i : 'urio\(.*\)'` mknod urio$unit c 143 `unit2minor $unit` root:operator umask 77 ;; usio*) umask 7 unit=`expr $i : 'usio\(.*\)'` minor=$(($unit + 128)) minor=`unit2minor $(($unit + 128))` mknod usio$unit c 138 $minor uucp:dialer umask 77 ;; uscanner*) umask 7 unit=`expr $i : 'uscanner\(.*\)'` mknod uscanner$unit c 156 `unit2minor $unit` root:operator umask 77 ;; umodem*) umask 7 unit=`expr $i : 'umodem\(.*\)'` mknod umodem$unit c 124 `unit2minor $unit` uucp:dialer umask 77 ;; lpt*) unit=`expr $i : 'lpt\(.*\)'` mknod lpt$unit c 16 `unit2minor $unit` mknod lpctl$unit c 16 `unit2minor $(($unit + 128))` ;; # Use this to create virtual consoles for syscons, pcvt or codrv # ttyv0-b # use as MAKEDEV vtyNN to create NN entries vty*) chr=12 units=`expr $i : 'vty\(.*\)'` i=0 while [ $i -lt $units ]; do mknod ttyv$(printf %01x $i) c $chr `unit2minor $i` i=$(($i + 1)) done ln -fs ttyv0 vga # XXX X still needs this pccons relic ;; nmdm*) units=`expr $i : 'nmdm\(.*\)'` chr=18 i=0 while [ $i -lt $units ]; do minor=`unit2minor $i` minor=$(($minor + $minor)) mknod nmdm${i}A c $chr $minor mknod nmdm${i}B c $chr $(($minor + 1)) i=$(($i + 1)) done ;; bpf*) nbpf=`expr $i : 'bpf\(.*\)$'` unit=0 while [ $unit -le $nbpf ]; do mknod bpf$unit c 23 `unit2minor $unit` unit=$(($unit + 1)) done ;; speaker) mknod speaker c 26 0 ;; cua?|cuaa?|cuaa??) umask 7 unit_low=`expr $i : 'cua.*\(.\)$'` case $i in cua?|cuaa?) unit_high="" m_high=0 ;; cuaa??) unit_high=`expr $i : 'cuaa\(.\).$'` m_high=`ttyminor $unit_high` ;; esac unit=$unit_high$unit_low m=$(($m_high << 16 | `ttyminor $unit_low`)) mknod cuaa$unit c 28 $(($m | 128)) uucp:dialer mknod cuaia$unit c 28 $(($m | 32 | 128)) uucp:dialer mknod cuala$unit c 28 $(($m | 64 | 128)) uucp:dialer umask 77 ;; tty?|tty0?|ttyd?|ttyd??) unit_low=`expr $i : 'tty.*\(.\)$'` case $i in tty?|tty0?|ttyd?) unit_high="" m_high=0 ;; ttyd??) unit_high=`expr $i : 'ttyd\(.\).$'` m_high=`ttyminor $unit_high` ;; esac unit=$unit_high$unit_low m=$(($m_high << 16 | `ttyminor $unit_low`)) mknod ttyd$unit c 28 $m mknod ttyid$unit c 28 $(($m | 32)) mknod ttyld$unit c 28 $(($m | 64)) ;; cuac?) umask 7 portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q r s t u v" major=48 card=`expr $i : 'cua.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=$(($card * 65536 + $minor)) name=$card$unit mknod cuac$name c $major $(($minor + 128)) uucp:dialer mknod cuaic$name c $major $(($minor + 32 + 128)) uucp:dialer mknod cualc$name c $major $(($minor + 64 + 128)) uucp:dialer done umask 77 ;; ttyc?) portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q r s t u v" major=48 card=`expr $i : 'tty.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=$(($card * 65536 + $minor)) name=$card$unit mknod ttyc$name c $major $minor mknod ttyic$name c $major $(($minor + 32)) mknod ttylc$name c $major $(($minor + 64)) done ;; # RISCom8 'rc' driver entries cuam?) umask 7 unit=`expr $i : 'cua.*\(.\)$'` m=`ttyminor $unit` mknod cuam$unit c 63 $(($m + 128)) uucp:dialer umask 77 ;; ttym?) unit=`expr $i : 'tty.*\(.\)$'` m=`ttyminor $unit` mknod ttym$unit c 63 $m ;; # Specialix SI/XIO. # Note: these are 'base 1' to match the numbers on the panels, and to match # the manual that comes with the system. ttyA*) major=68 nports=`expr $i : 'ttyA\(.*\)$'` port=1 while [ $port -le $nports ]; do minor=$(($port - 1)) name=$(printf %02d $port) mknod ttyA$name c $major $minor mknod ttyiA$name c $major $(($minor + 65536)) mknod ttylA$name c $major $(($minor + 131072)) port=$(($port + 1)) done # For the user-mode control program, 'sicontrol' mknod si_control c 68 262144 ;; cuaA*) umask 7 major=68 nports=`expr $i : 'cuaA\(.*\)$'` port=1 while [ $port -le $nports ]; do minor=$(($port - 1)) name=$(printf %02d $port) mknod cuaA$name c $major $(($minor + 128)) uucp:dialer mknod cuaiA$name c $major $(($minor + 128 + 65536)) \ uucp:dialer mknod cualA$name c $major $(($minor + 128 + 131072)) \ uucp:dialer port=$(($port + 1)) done umask 77 ;; # Alpha AS8[24]00 (TurboLaser) console. zs?) unit=`expr $i : 'zs.*\(.\)$'` m=`ttyminor $unit` mknod zs$unit c 135 $m ;; # Digiboard PC/?? 16 port card. # The current scheme of minor numbering is: # # unused{14} CARD{2} major{8} CALLOUT{1} LOCK{1} INIT{1} PORT{5} # # CARD bitfield in future versions may be extended to 3 bits. # # See dgb(4) # ttyD?) portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" major=58 card=`expr $i : 'tty.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=$(($card * 65536 + $minor)) name=$card$unit mknod ttyD$name c $major $minor mknod ttyiD$name c $major $(($minor + 32)) mknod ttylD$name c $major $(($minor + 64)) done ;; cuaD?) umask 7 portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" major=58 card=`expr $i : 'cua.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=$(($card * 65536 + $minor)) name=$card$unit mknod cuaD$name c $major $(($minor + 128)) uucp:dialer mknod cuaiD$name c $major $(($minor + 32 + 128)) uucp:dialer mknod cualD$name c $major $(($minor + 64 + 128)) uucp:dialer done umask 77 ;; # Stallion multi serial cards (stl and stli drivers) # # These drivers reserve 64 minor devices per board, even if the board # supports only 4 devices. We default to creating only 8 of the 64 devices # to keep /dev from getting too large (which => slow). The last part of the # arg is the board number to create ports for. So: # ttyE0 will create 8 dialin ports ttyE0-ttyE7, plus ttyiE* and ttylE* # cuaE0 will create 8 dialout ports cuaE0-cuaE7, plus cuaiE* and cualE* # ttyE1 will create 8 dialin ports ttyE64-ttyE71, plus ttyiE* and ttylE* # etc # If you have EasyConnect 8/32 or 8/64 cards, you will need to change the # definition of "maxport" below to get nodes for the full 32 or 64 # ports per card. # # Note that the mapping of minor device numbers (with the hole between # 32-64k) is a bit odd to keep compatibility with ttyd? for # lock/initial devices. # Minor device field for the ports is # card{3} unused{4} unit-msb{1} unused{8} callout{1} lock{1} init{1} unit-lsbs{5} # for the mem device is # 0x1000000 + card # (For stl, there is only 1 mem device per system; for stli, one per board) ttyE*) stallion 72 E `expr $i : 'tty.*\(.\)$'` 0 ;; cuaE*) stallion 72 E `expr $i : 'cua.*\(.\)$'` 1 ;; stl*) card=`expr $i : 'stl\(.\)$'` stallion 72 E $card 0 stallion 72 E $card 1 ;; ttyF*) stallion 75 F `expr $i : 'tty.*\(.\)$'` 0 ;; cuaF*) stallion 75 F `expr $i : 'cua.*\(.\)$'` 1 ;; stli*) card=`expr $i : 'stl\(.\)$'` stallion 75 F $card 0 stallion 75 F $card 1 ;; ttyM*) portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" modulelist="a b c d" major=101 card=`expr $i : 'tty.*\(.\)$'` for unit in $modulelist do moduleminor=`ttyminor $unit` moduleminor=$(($moduleminor % 10 * 16)) modulename=$unit for unit in $portlist do minor=`ttyminor $unit` minor=$(($card * 65536 + $minor + $moduleminor)) name=$card$modulename$unit rm -f tty*M$name mknod ttyM$name c $major $minor mknod ttyiM$name c $major $(($minor + 64)) mknod ttylM$name c $major $(($minor + 128)) done done ;; cuaM?) umask 7 portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" modulelist="a b c d" major=101 card=`expr $i : 'cua.*\(.\)$'` for unit in $modulelist do moduleminor=`ttyminor $unit` moduleminor=$(($moduleminor % 10 * 16)) modulename=$unit for unit in $portlist do minor=`ttyminor $unit` minor=$(($card * 65536 + $minor + $moduleminor)) name=$card$modulename$unit rm -f cua*M$name mknod cuaM$name c $major $(($minor + 262144)) \ uucp:dialer mknod cuaiM$name c $major $(($minor + 64 + 262144)) \ uucp:dialer mknod cualM$name c $major $(($minor + 128 + 262144)) \ uucp:dialer done done umask 77 ;; ttyR?) major=81 BOARD=1; Rnum=0 MINOR=$(($BOARD * 65536)) controllers=$( dmesg | while read first rest; do case "$first" in RocketPort[0-4]) echo "$first" ;; esac done ) rm -f ttyR* ttyiR* ttylR* for i in $controllers; do ndevices=$( dmesg | while read first bar ports rest; do case "$first" in $i*) echo "$ports" ;; esac done ) echo -n "Creating $ndevices devices for $i: " dev=0 while [ $dev -lt $ndevices ]; do mknod ttyR$Rnum c $major $MINOR mknod ttyiR$Rnum c $major $(($MINOR + 32)) mknod ttylR$Rnum c $major $(($MINOR + 64)) Rnum=$(($Rnum + 1)) MINOR=$(($MINOR + 1)) dev=$(($dev + 1)) done BOARD=$(($BOARD + 1)) MINOR=$(($BOARD * 65536)) echo " " done ;; cuaR?) major=81 BOARD=1; Rnum=0 MINOR=$(($BOARD * 65536)) controllers=$( dmesg | while read first rest; do case "$first" in RocketPort[0-4]) echo "$first" ;; esac done ) rm -f cuaR* cuaiR* cualR* for i in $controllers; do ndevices=$( dmesg | while read first bar ports rest; do case "$first" in $i*) echo "$ports" ;; esac done ) echo -n "Creating $ndevices devices for $i: " dev=0 while [ $dev -lt $ndevices ]; do mknod cuaR$Rnum c $major $(($MINOR + 128)) uucp:dialer mknod cuaiR$Rnum c $major $(($MINOR + 128 + 32)) \ uucp:dialer mknod cualR$Rnum c $major $(($MINOR + 128 + 64)) \ uucp:dialer Rnum=$(($Rnum + 1)) MINOR=$(($MINOR + 1)) dev=$(($dev + 1)) done BOARD=$(($BOARD + 1)) MINOR=$(($BOARD * 65536)) echo " " done ;; mse*) unit=`expr $i : 'mse\(.*\)'` chr=27 # non-blocking for X11 mknod mse$unit c $chr `unit2minor $(($unit * 2 + 1))` ;; psm*) unit=`expr $i : 'psm\(.*\)'` chr=21 # non-blocking for X11 mknod psm$unit c $chr `unit2minor $(($unit * 2 + 1))` ;; mouse*) name=`expr $i : 'mouse\(.*\)'` if [ ! -c $name ]; then $0 $name # make the appropriate device fi ln -fs $name mouse ;; pcaudio) mknod pcaudio c 24 0 mknod pcaudioctl c 24 128 ;; socksys) mknod socksys c 41 0 mknod spx c 41 1 ln -fs socksys nfsd chmod 666 socksys nfsd spx ;; snd*) # # changes from Linux voxware # minor Linux FreeBSD # 8 sequencer2 (aka music0) music0 # 17 patmgr0 sequencer1 # 33 patmgr1 sequencer2 # unit=`expr $i : 'snd\(.*\)'` chr=30 # XXX write this less verbosely, like std snd_security_hole=0 # XXX umask $snd_security_hole ln -fs mixer$unit mixer ln -fs sequencer$unit sequencer ln -fs dsp$unit dsp ln -fs audio$unit audio ln -fs dspW$unit dspW ln -fs music$unit music ln -fs pss$unit pss ln -fs dsp$unit.0 dsp$unit ln -fs audio$unit.0 audio$unit ln -fs dspW$unit.0 dspW$unit mknod mixer$unit c $chr `unit2minor $(($unit * 16 + 0))` mknod sequencer$unit c $chr `unit2minor $(($unit * 16 + 1))` mknod midi$unit c $chr `unit2minor $(($unit * 16 + 2))` for chn in 0 1 2 3 do minor=$(($chn * 65536 + $unit * 16)) mknod dsp$unit.$chn c $chr $(($minor + 3)) mknod audio$unit.$chn c $chr $(($minor + 4)) mknod dspW$unit.$chn c $chr $(($minor + 5)) done mknod sndstat c $chr 6 # minor number 7 is unused mknod music$unit c $chr `unit2minor $(($unit * 16 + 8))` mknod pss$unit c $chr `unit2minor $(($unit * 16 + 9))` # minor numbers 10-15 are unused umask 77 ;; vat) mknod vatio c 25 128 chmod 660 vatio ;; gsc*) unit=`expr $i : 'gsc\(.*\)'` mknod gsc${unit} c 47 `unit2minor $unit` mknod gsc${unit}p c 47 `unit2minor $(($unit + 8))` mknod gsc${unit}d c 47 `unit2minor $(($unit + 32))` mknod gsc${unit}pd c 47 `unit2minor $(($unit + 40))` chmod 666 gsc${unit}* ;; apm) mknod apm c 39 0 root:operator chmod 664 apm ;; apmctl) mknod apmctl c 39 8 root:operator chmod 660 apmctl ;; card*) unit=`expr $i : 'card\(.*\)'` chr=50 mknod card$unit c $chr `unit2minor $unit` chmod 644 card$unit ;; ttyx?|ttyy?|ttyz?) case $i in *0) unit=0;; *1) unit=1;; *2) unit=2;; *3) unit=3;; *4) unit=4;; *5) unit=5;; *6) unit=6;; *7) unit=7;; *8) unit=8;; *9) unit=9;; *a) unit=10;; *b) unit=11;; *c) unit=12;; *d) unit=13;; *e) unit=14;; *f) unit=15;; esac case $i in ttyy?) unit=$(($unit + 16));; ttyz?) unit=$(($unit + 32));; esac mknod $i c 42 $unit ;; cronyx) mknod cronyx c 42 63 ;; joy) mknod joy0 c 51 0 root:operator mknod joy1 c 51 1 root:operator chmod 640 joy0 joy1 ;; spigot) mknod spigot c 11 0 chmod 444 spigot ;; ctx?) unit=`expr $i : 'ctx\(.*\)'` mknod ctx$unit c 40 `unit2minor $unit` chmod 444 ctx$unit ;; meteor?) unit=`expr $i : 'meteor\(.*\)'` mknod meteor$unit c 67 `unit2minor $unit . ..MAKEDEVconsolekmem% memnull% random urandom zero% io ttyklog%stdin%stdoutstderr pci fd fd0rfd0r fd0ar rfd0a fd0br rfd0b fd0cr rfd0c fd0dr rfd0d fd0er rfd0e fd0fr rfd0f fd0gr rfd0g fd0hr rfd0h fd0.1720: rfd0.1720 fd0.1480:  rfd0.1480 !fd0.1440:! rfd0.1440 "fd0.1200:" rfd0.1200 #fd0.820#rfd0.820t $fd0.800$rfd0.800t %fd0.720%rfd0.720t &fd0.360&rfd0.360t 'fd0.640'rfd0.640t (fd0.1232:( rfd0.1232 ) da0)rda0r *da0a%*rda0a +da0b%+rda0b ,da0c%,rda0c -da0d%-rda0d .da0e%.rda0e /da0f%/rda0f 0da0g%0rda0g 1da0h%1rda0h 2da0s1%2rda0s13da0s1a3rda0s1a4da0s1b4rda0s1b5da0s1c5rda0s1c6da0s1d6rda0s1d7da0s1e7rda0s1e8da0s1f8rda0s1f9da0s1g9rda0s1g:da0s1h:rda0s1h;da0s2%;rda0s2<da0s3%<rda0s3=da0s4%=rda0s4> ad0>rad0r ?ad0a%?rad0a @ad0b%@rad0b Aad0c%Arad0c Bad0d%Brad0d Cad0e%Crad0e Dad0f%Drad0f Ead0g%Erad0g Fad0h%Frad0h Gad0s1%Grad0s1Had0s1aHrad0s1aIad0s1bIrad0s1bJad0s1cJrad0s1cKad0s1dKrad0s1dLad0s1eLrad0s1eMad0s1fMrad0s1fNad0s1gNrad0s1gOad0s1hOrad0s1hPad0s2%Prad0s2Qad0s3%Qrad0s3Rad0s4%Rrad0s4Sacd0a%Sacd0c Sracd0aSracd0cTacd1a%Tacd1c Tracd1aTracd1cUafd0%Urafd0 Vafd0a%Vrafd0aWafd0b%Wrafd0bXafd0c%Xrafd0cYafd0d%Yrafd0dZafd0e%Zrafd0e[afd0f%[rafd0f\afd0g%\rafd0g]afd0h%]rafd0h^afd0s1^rafd0s1_afd0s1a_rafd0s1at `afd0s1b`rafd0s1bt aafd0s1carafd0s1ct bafd0s1dbrafd0s1dt cafd0s1ecrafd0s1et dafd0s1fdrafd0s1ft eafd0s1gerafd0s1gt fafd0s1hfrafd0s1ht gafd0s2grafd0s2hafd0s3hrafd0s3iafd0s4irafd0s4jast0%knast0%l wd0lrwd0r mwd0a%mrwd0a nwd0b%nrwd0b owd0c%orwd0c pwd0d%prwd0d qwd0e%qrwd0e rwd0f%rrwd0f swd0g%srwd0g twd0h%trwd0h uwd0s1%urwd0s1vwd0s1avrwd0s1awwd0s1bwrwd0s1bxwd0s1cxrwd0s1cywd0s1dyrwd0s1dzwd0s1ezrwd0s1e{wd0s1f{rwd0s1f|wd0s1g|rwd0s1g}wd0s1h}rwd0s1h~wd0s2%~rwd0s2wd0s3%rwd0s3wd0s4%rwd0s4wcd0a%wcd0c%rwcd0arwcd0cwfd0%rwfd0 wfd0a%rwfd0awfd0b%rwfd0bwfd0c%rwfd0cwfd0d%rwfd0dwfd0e%rwfd0ewfd0f%rwfd0fwfd0g%rwfd0gwfd0h%rwfd0hwfd0s1rwfd0s1wfd0s1arwfd0s1at wfd0s1brwfd0s1bt wfd0s1crwfd0s1ct wfd0s1drwfd0s1dt wfd0s1erwfd0s1et wfd0s1frwfd0s1ft wfd0s1grwfd0s1gt wfd0s1hrwfd0s1ht wfd0s2rwfd0s2wfd0s3rwfd0s3wfd0s4rwfd0s4rwst0%vn0rvn0r vn0a%rvn0a vn0b%rvn0b vn0c%rvn0c vn0d%rvn0d vn0e%rvn0e vn0f%rvn0f vn0g%rvn0g vn0h%rvn0h vn0s1%rvn0s1vn0s1arvn0s1avn0s1brvn0s1bvn0s1crvn0s1cvn0s1drvn0s1dvn0s1ervn0s1evn0s1frvn0s1fvn0s1grvn0s1gvn0s1hrvn0s1hvn0s2%rvn0s2vn0s3%rvn0s3vn0s4%rvn0s4cd0a%cd0c%rcd0a rcd0c cd1a%cd1c%rcd1a rcd1c sa0.ctlrsa0.ctlt sa0.0%rsa0.0nsa0.0nrsa0.0esa0.0ersa0.0sa0.1%rsa0.1nsa0.1nrsa0.1esa0.1ersa0.1 sa0sa0.2%rsa0.2nsa0.2nrsa0.2esa0.2ersa0.2sa0.3%rsa0.3nsa0.3nrsa0.3esa0.3ersa0.3rsa0r nsa0r nrsa0 esa0r ersa0 ttyv0%ttyv1% vgacuaa0%cuaia0cuala0ttyp0%ptyp0%ttyp1%ptyp1%ttyp2%ptyp2%ttyp3%ptyp3%ttyp4%ptyp4%ttyp5%ptyp5%ttyp6%ptyp6%ttyp7%ptyp7%ttyp8%ptyp8%ttyp9%ptyp9%ttypa%ptypa%ttypb%ptypb%ttypc%ptypc%ttypd%ptypd%ttype%ptype%ttypf%ptypf%ttypg%ptypg%ttyph%ptyph%ttypi%ptypi%ttypj%ptypj%ttypk%ptypk%ttypl%ptypl%ttypm%ptypm%ttypn%ptypn%ttypo%ptypo%ttypp%ptypp%ttypq%ptypq%ttypr%ptypr%ttyps%ptyps%ttypt%ptypt%ttypu%ptypu%ttypv%ptypv%ttyd0%ttyid0ttyld0 zs0 kbd0% mse0% psm0% sysmouse: lpt0% consolectllpctl0ppi0%iic0%smb0%ums0%tun0%tap0% ch0 apmapmctlcard0%pass0%xpt0% i4bi4bctli4btrc0i4btrc1 i4btel0!i4bteld0:"i4brbch0:' ...#!/bin/sh -p # # Simple replacement for tar(1), using cpio(1). # # Copyright (c) 1996 Joerg Wunsch # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # # THIS SOFTWARE IS PROVIDED BY THE DEVELOPERS ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE DEVELOPERS BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # # For use on the fixit floppy. External programs required: # cpio(1), find(1), test(1) # # # $FreeBSD: src/release/scripts/tar.sh,v 1.5.2.1 2000/05/19 16:03:36 joerg Exp $ # archive=${TAPE:-/dev/rsa0} blocksize="20" device="" mode="none" verbose="" usage() { echo "usage: tar -{c|t|x} [-v] [-b blocksize] [-f archive] [files...]" 1>&2 exit 64 # EX_USAGE } # # Prepend a hyphen to the first arg if necessary, so the traditional form # ``tar xvf /dev/foobar'' will work, too. More kludgy legacy forms are not # supported however. # if [ $# -lt 1 ] ; then usage fi case "$1" in -*) break ;; *) tmp="$1" shift set -- -$tmp "$@" ;; esac while getopts "ctxvb:f:" option do case $option in [ctx]) if [ $mode = "none" ] ; then mode=$option else usage fi ;; v) verbose="-v" ;; b) blocksize="${OPTARG}" ;; f) archive="${OPTARG## }" ;; *) usage ;; esac done shift $(($OPTIND - 1)) if [ "X${archive}" != "X-" ] ; then device="-F ${archive}" # else: use stdin or stdout, which is the default for cpio fi case $mode in none) usage ;; t) exec cpio -it $verbose $device --block-size="$blocksize" "$@" ;; x) exec cpio -idmu $verbose $device --block-size="$blocksize" "$@" ;; c) if [ $# -eq 0 ] ; then # use current dir -- slightly bogus set -- "." fi find "$@" -print |\ cpio -o -H ustar $verbose $device --block-size="$blocksize" exit $? ;; esac ( . ..) protocols*group+spwd.db,servicesm# $FreeBSD: src/etc/group,v 1.19.2.2 2002/02/10 11:43:37 obrien Exp $ # wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: news:*:8: man:*:9: games:*:13: staff:*:20:root smmsp:*:25: mailnull:*:26: guest:*:31:root bind:*:53: uucp:*:66: xten:*:67:xten dialer:*:68: network:*:69: www:*:80: nogroup:*:65533: nobody:*:65534: # # Internet protocols # # $FreeBSD: src/etc/protocols,v 1.13.2.3 2002/02/27 03:39:00 dd Exp $ # from: @(#)protocols 5.1 (Berkeley) 4/17/89 # # See also http://www.iana.org/assignments/protocol-numbers # ip 0 IP # internet protocol, pseudo protocol number #hopopt 0 HOPOPT # hop-by-hop options for ipv6 icmp 1 ICMP # internet control message protocol igmp 2 IGMP # internet group management protocol ggp 3 GGP # gateway-gateway protocol ipencap 4 IP-ENCAP # IP encapsulated in IP (officially ``IP'') st2 5 ST2 # ST2 datagram mode (RFC 1819) tcp 6 TCP # transmission control protocol cbt 7 CBT # CBT, Tony Ballardie egp 8 EGP # exterior gateway protocol igp 9 IGP # any private interior gateway (Cisco: for IGRP) bbn-rcc 10 BBN-RCC-MON # BBN RCC Monitoring nvp 11 NVP-II # Network Voice Protocol pup 12 PUP # PARC universal packet protocol argus 13 ARGUS # ARGUS emcon 14 EMCON # EMCON xnet 15 XNET # Cross Net Debugger chaos 16 CHAOS # Chaos udp 17 UDP # user datagram protocol mux 18 MUX # Multiplexing protocol dcn 19 DCN-MEAS # DCN Measurement Subsystems hmp 20 HMP # host monitoring protocol prm 21 PRM # packet radio measurement protocol xns-idp 22 XNS-IDP # Xerox NS IDP trunk-1 23 TRUNK-1 # Trunk-1 trunk-2 24 TRUNK-2 # Trunk-2 leaf-1 25 LEAF-1 # Leaf-1 leaf-2 26 LEAF-2 # Leaf-2 rdp 27 RDP # "reliable datagram" protocol irtp 28 IRTP # Internet Reliable Transaction Protocol iso-tp4 29 ISO-TP4 # ISO Transport Protocol Class 4 netblt 30 NETBLT # Bulk Data Transfer Protocol mfe-nsp 31 MFE-NSP # MFE Network Services Protocol merit-inp 32 MERIT-INP # MERIT Internodal Protocol sep 33 SEP # Sequential Exchange Protocol 3pc 34 3PC # Third Party Connect Protocol idpr 35 IDPR # Inter-Domain Policy Routing Protocol xtp 36 XTP # Xpress Tranfer Protocol ddp 37 DDP # Datagram Delivery Protocol idpr-cmtp 38 IDPR-CMTP # IDPR Control Message Transport Proto tp++ 39 TP++ # TP++ Transport Protocol il 40 IL # IL Transport Protocol ipv6 41 IPV6 # ipv6 sdrp 42 SDRP # Source Demand Routing Protocol ipv6-route 43 IPV6-ROUTE # routing header for ipv6 ipv6-frag 44 IPV6-FRAG # fragment header for ipv6 idrp 45 IDRP # Inter-Domain Routing Protocol rsvp 46 RSVP # Resource ReSerVation Protocol gre 47 GRE # Generic Routing Encapsulation mhrp 48 MHRP # Mobile Host Routing Protocol bna 49 BNA # BNA esp 50 ESP # encapsulating security payload ah 51 AH # authentication header i-nlsp 52 I-NLSP # Integrated Net Layer Security TUBA swipe 53 SWIPE # IP with Encryption narp 54 NARP # NBMA Address Resolution Protocol mobile 55 MOBILE # IP Mobility tlsp 56 TLSP # Transport Layer Security Protocol skip 57 SKIP # SKIP ipv6-icmp 58 IPV6-ICMP # ICMP for IPv6 ipv6-nonxt 59 IPV6-NONXT # no next header for ipv6 ipv6-opts 60 IPV6-OPTS # destination options for ipv6 # 61 # any host internal protocol cftp 62 CFTP # CFTP # 63 # any local network sat-expak 64 SAT-EXPAK # SATNET and Backroom EXPAK kryptolan 65 KRYPTOLAN # Kryptolan rvd 66 RVD # MIT Remote Virtual Disk Protocol ippc 67 IPPC # Internet Pluribus Packet Core # 68 # any distributed file system sat-mon 69 SAT-MON # SATNET Monitoring visa 70 VISA # VISA Protocol ipcv 71 IPCV # Internet Packet Core Utility cpnx 72 CPNX # Computer Protocol Network Executive cphb 73 CPHB # Computer Protocol Heart Beat wsn 74 WSN # Wang Span Network pvp 75 PVP # Packet Video Protocol br-sat-mon 76 BR-SAT-MON # Backroom SATNET Monitoring sun-nd 77 SUN-ND # SUN ND PROTOCOL-Temporary wb-mon 78 WB-MON # WIDEBAND Monitoring wb-expak 79 WB-EXPAK # WIDEBAND EXPAK iso-ip 80 ISO-IP # ISO Internet Protocol vmtp 81 VMTP # Versatile Message Transport secure-vmtp 82 SECURE-VMTP # SECURE-VMTP vines 83 VINES # VINES ttp 84 TTP # TTP nsfnet-igp 85 NSFNET-IGP # NSFNET-IGP dgp 86 DGP # Dissimilar Gateway Protocol tcf 87 TCF # TCF eigrp 88 EIGRP # Enhanced Interior Routing Protocol (Cisco) ospf 89 OSPFIGP # Open Shortest Path First IGP sprite-rpc 90 Sprite-RPC # Sprite RPC Protocol larp 91 LARP # Locus Address Resolution Protocol mtp 92 MTP # Multicast Transport Protocol ax.25 93 AX.25 # AX.25 Frames ipip 94 IPIP # Yet Another IP encapsulation micp 95 MICP # Mobile Internetworking Control Pro. scc-sp 96 SCC-SP # Semaphore Communications Sec. Pro. etherip 97 ETHERIP # Ethernet-within-IP Encapsulation encap 98 ENCAP # Yet Another IP encapsulation # 99 # any private encryption scheme gmtp 100 GMTP # GMTP ifmp 101 IFMP # Ipsilon Flow Management Protocol pnni 102 PNNI # PNNI over IP pim 103 PIM # Protocol Independent Multicast aris 104 ARIS # ARIS scps 105 SCPS # SCPS qnx 106 QNX # QNX a/n 107 A/N # Active Networks ipcomp 108 IPComp # IP Payload Compression Protocol snp 109 SNP # Sitara Networks Protocol compaq-peer 110 Compaq-Peer # Compaq Peer Protocol ipx-in-ip 111 IPX-in-IP # IPX in IP vrrp 112 VRRP # Virtual Router Redundancy Protocol pgm 113 PGM # PGM Reliable Transport Protocol # 114 # any 0-hop protocol l2tp 115 L2TP # Layer Two Tunneling Protocol ddx 116 DDX # D-II Data Exchange iatp 117 IATP # Interactive Agent Transfer Protocol st 118 ST # Schedule Transfer srp 119 SRP # SpectraLink Radio Protocol uti 120 UTI # UTI smp 121 SMP # Simple Message Protocol sm 122 SM # SM ptp 123 PTP # Performance Transparency Protocol isis 124 ISIS # ISIS over IPv4 fire 125 FIRE crtp 126 CRTP # Combat Radio Transport Protocol crudp 127 CRUDP # Combat Radio User Datagram sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS # Secure Packet Shield pipe 131 PIPE # Private IP Encapsulation within IP sctp 132 SCTP # Stream Control Transmission Protocol fc 133 FC # Fibre Channel # 134-254 # Unassigned divert 254 DIVERT # Divert pseudo-protocol [non IANA] # 255 # Reserved 0 ...1 ...2 ...3 . ..4share# # Network services, Internet style # # Stripped-down version. # # $FreeBSD: src/release/fixit.services,v 1.4 1999/08/28 01:33:10 peter Exp $ # # WELL KNOWN PORT NUMBERS # echo 7/tcp echo 7/udp discard 9/tcp sink null discard 9/udp sink null systat 11/tcp users #Active Users systat 11/udp users #Active Users daytime 13/tcp daytime 13/udp chargen 19/tcp ttytst source #Character Generator chargen 19/udp ttytst source #Character Generator ftp-data 20/tcp #File Transfer [Default Data] ftp-data 20/udp #File Transfer [Default Data] ftp 21/tcp #File Transfer [Control] ftp 21/udp #File Transfer [Control] ssh 22/tcp #Secure Shell Login ssh 22/udp #Secure Shell Login telnet 23/tcp telnet 23/udp # 24/tcp any private mail system # 24/udp any private mail system smtp 25/tcp mail #Simple Mail Transfer smtp 25/udp mail #Simple Mail Transfer time 37/tcp timserver time 37/udp timserver domain 53/tcp #Domain Name Server domain 53/udp #Domain Name Server bootps 67/tcp dhcps #Bootstrap Protocol Server bootps 67/udp dhcps #Bootstrap Protocol Server bootpc 68/tcp dhcpc #Bootstrap Protocol Client bootpc 68/udp dhcpc #Bootstrap Protocol Client tftp 69/tcp #Trivial File Transfer tftp 69/udp #Trivial File Transfer gopher 70/tcp gopher 70/udp finger 79/tcp finger 79/udp http 80/tcp www www-http #World Wide Web HTTP http 80/udp www www-http #World Wide Web HTTP sunrpc 111/tcp rpcbind #SUN Remote Procedure Call sunrpc 111/udp rpcbind #SUN Remote Procedure Call auth 113/tcp ident tap #Authentication Service auth 113/udp ident tap #Authentication Service nntp 119/tcp usenet #Network News Transfer Protocol nntp 119/udp usenet #Network News Transfer Protocol rmt 411/tcp #Remote MT Protocol rmt 411/udp #Remote MT Protocol https 443/tcp https 443/udp # # Berkeley-specific services # exec 512/tcp #remote process execution; # authentication performed using # passwords and UNIX loppgin names biff 512/udp comsat #used by mail system to notify users # of new mail received; currently # receives messages only from # processes on the same machine login 513/tcp #remote login a la telnet; # automatic authentication performed # based on priviledged port numbers # and distributed data bases which # identify "authentication domains" who 513/udp whod #maintains data bases showing who's # logged in to machines on a local # net and the load average of the # machine cmd 514/tcp shell #like exec, but automatic # authentication is performed as for # login server syslog 514/udp printer 515/tcp spooler printer 515/udp spooler talk 517/tcp #like tenex link, but across # machine - unfortunately, doesn't # use link protocol (this is actually # just a rendezvous port from which a # tcp connection is established) talk 517/udp #like tenex link, but across # machine - unfortunately, doesn't # use link protocol (this is actually # just a rendezvous port from which a # tcp connection is established) ntalk 518/tcp ntalk 518/udp utime 519/tcp unixtime utime 519/udp unixtime efs 520/tcp #extended file name server router 520/udp route routed #local routing process (on site); # uses variant of Xerox NS routing # information protocol uucp 540/tcp uucpd uucp 540/udp uucpd uucp-rlogin 541/tcp uucp-rlogin 541/udp klogin 543/tcp # Kerberos (v4/v5) klogin 543/udp # Kerberos (v4/v5) kshell 544/tcp krcmd # Kerberos (v4/v5) kshell 544/udp krcmd # Kerberos (v4/v5) 4 .3 ..5miscn5 .4 ..6 scsi_modes*t1 {Maximum Write Speed Supported (kBps)} i2 {Current Write Speed Supported (kBps)} i2 }; 0x00 "Vendor-Specific"; : # $FreeBSD: src/release/fixit.profile,v 1.8.2.1 2001/11/05 11:22:04 brian Exp $ export BLOCKSIZE=K export PS1="Fixit# " export EDITOR="/mnt2/stand/vi" export PAGER="/mnt2/stand/more" export SCSI_MODES="/mnt2/usr/share/misc/scsi_modes" # the root MFS doesn't have /dev/nrsa0, pick a better default for mt(1) export TAPE=/mnt2/dev/nrsa0 alias ls="ls -F" alias ll="ls -l" alias m="more -e" echo '+---------------------------------------------------------------+' echo '| You are now running from FreeBSD "fixit" media. |' echo '| ------------------------------------------------------------- |' echo "| When you're finished with this shell, please type exit. |" echo '| The fixit media is mounted as /mnt2. |' echo '| |' echo '| You might want to symlink /mnt/etc/*pwd.db and /mnt/etc/group |' echo '| to /etc after mounting a root filesystem from your disk. |' echo '| tar(1) will not restore all permissions correctly otherwise! |' echo '| |' echo '| Note: you might use the arrow keys to browse through the |' echo '| command history of this shell. |' echo '+---------------------------------------------------------------+' echo echo 'Good Luck!' echo # Make the arrow keys work; everybody will love this. set -o emacs 2>/dev/null cd / # SCSI mode page data base. # Copyright (c) 1995 HD Associates # Copyright (c) 2001 The FreeBSD Project # (contact: dufault@hda.com) # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. The name of HD Associates # may not be used to endorse or promote products derived from this software # without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY HD ASSOCIATES ``AS IS'' AND # ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE # IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE # ARE DISCLAIMED. IN NO EVENT SHALL HD ASSOCIATES BE LIABLE # FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL # DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS # OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) # HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT # LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY # OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF # SUCH DAMAGE. # # $FreeBSD: src/share/misc/scsi_modes,v 1.6.6.4 2002/03/14 16:18:48 joerg Exp $ # # The ordering is alphabetical by page name, as it appears in the SCSI spec. # 'i' is a byte-sized integral types, followed by a field width of # 1 through 4 (1 to 4 bytes). # # 'b' is a bit-sized integral type # 't' is a bitfield type- followed by a bit field width # # 'c' values are character arrays # 'z' values are null-padded strings # # # '*' suppresses assignment (for 'seeking'). # Bitfields are MSB to LSB. # ALL DEVICE TYPES 0x0a "Control Mode Page" { {Reserved} *t7 {RLEC} t1 {Queue Algorithm Modifier} t4 {Reserved} *t2 {QErr} t1 {DQue} t1 {EECA} t1 {Reserved} *t4 {RAENP} t1 {UAAENP} t1 {EAENP} t1 {Reserved} *i1 {Ready AEN Holdoff Period} i2 } 0x02 "Disconnect-Reconnect Page" { {Buffer Full Ratio} i1 {Buffer Empty Ratio} i1 {Bus Inactivity Limit} i2 {Disconnect Time Limit} i2 {Connect Time Limit} i2 {Maximum Burst Size} i2 {Reserved} *t6 {DTDC} t2 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 } 0x09 "Peripheral Device Page" { {Interface Identifier} i2 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 } 0x1a "Power Control" { {Reserved} *i1 {Reserved} *t6 {Idle} t1 {Standby} t1 {Idle Condition Timer} i4 {Standby Condition Timer} i4 } # DIRECT ACCESS DEVICES 0x08 "Caching Page" { {IC} t1 {ABPF} t1 {CAP} t1 {DISC} t1 {SIZE} t1 {WCE} t1 {MF} t1 {RCD} t1 {Demand Retention Priority} t4 {Write Retention Priority} t4 {Disable Pre-fetch Transfer Length} i2 {Minimum Pre-fetch} i2 {Maximum Pre-fetch} i2 {Maximum Pre-fetch Ceiling} i2 } 0x05 "Flexible Disk Page" { {Transfer rate} i2 {Number of heads} i1 {Sectors per track} i1 {Data bytes per sector} i2 {Number of cylinders} i2 {Starting cylinder-write precompensation} i2 {Starting cylinder-reduced write current} i2 {Drive step rate} i2 {Drive step pulse width} i1 {Head settle delay} i2 {Motor on delay} i1 {Motor off delay} i1 {TRDY} t1 {SSN} t1 {MO} t1 {Reserved} *t5 {Reserved} *t4 {SPC} t4 {Write Compensation} i1 {Head load delay} i1 {Head unload delay} i1 {Pin 34} t4 {Pin 2} t4 {Pin 4} t4 {Pin 1} t4 {Medium rotation rate} i2 {Reserved} *i1 {Reserved} *i1 } 0x03 "Format Device Page" { {Tracks per Zone} i2 {Alternate Sectors per Zone} i2 {Alternate Tracks per Zone} i2 {Alternate Tracks per Logical Unit} i2 {Sectors per Track} i2 {Data Bytes per Physical Sector} i2 {Interleave} i2 {Track Skew Factor} i2 {Cylinder Skew Factor} i2 {SSEC} t1 {HSEC} t1 {RMB} t1 {SURF} t1 {Reserved} *t4 } 0x0b "Medium Types Supported Page" { {Reserved} *i1 {Reserved} *i1 {Medium type one supported} i1 {Medium type two supported} i1 {Medium type three supported} i1 {Medium type four supported} i1 } # Notch page (0x0c) 0x0c "Notch and Partition Page"; 0x01 "Read-Write Error Recovery Page" { {AWRE (Auto Write Reallocation Enbld)} t1 {ARRE (Auto Read Reallocation Enbld)} t1 {TB (Transfer Block)} t1 {RC (Read Continuous)} t1 {EER (Enable Early Recovery)} t1 {PER (Post Error)} t1 {DTE (Disable Transfer on Error)} t1 {DCR (Disable Correction)} t1 {Read Retry Count} i1 {Correction Span} i1 {Head Offset Count} i1 {Data Strobe Offset Count} i1 {Reserved} *i1 {Write Retry Count} i1 {Reserved} *i1 {Recovery Time Limit} i2 } 0x04 "Rigid Disk Drive Geometry Page" { {Number of Cylinders} i3 {Number of Heads} i1 {Starting Cylinder-Write Precompensation} i3 {Starting Cylinder-Reduced Write Current} i3 {Drive Step Rate} i2 {Landing Zone Cylinder} i3 {Reserved} *t6 {RPL} t2 {Rotational Offset} i1 {Reserved} *i1 {Medium Rotation Rate} i2 {Reserved} *i1 {Reserved} *i1 } 0x07 "Verify Error Recovery Page" { {Reserved} *t4 {EER} t1 {PER} t1 {DTE} t1 {DCR} t1 {Verify Retry Count} i1 {Verify Correction Span} i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Verify Recovery Time Limit} i2 } 0x0E "CD-ROM Audio Control Parameters Page" { {Reserved} *t5 {Immed} t1 {SOTC} t1 {Reserved} *t1 {Reserved} *i2 {APRVal} t1 {Reserved} *t3 {Format of LBAs / sec.} t4 {Logical Blocks per Second of Audio Playback} i2 {Reserved} *t4 {Output Port 0 Channel Selection} t4 {Output Port 0 Volume} i1 {Reserved} *t4 {Output Port 1 Channel Selection} t4 {Output Port 1 Volume} i1 {Reserved} *t4 {Output Port 2 Channel Selection} t4 {Output Port 2 Volume} i1 {Reserved} *t4 {Output Port 3 Channel Selection} t4 {Output Port 3 Volume} i1 } # SEQUENTIAL ACCESS DEVICES 0x10 "Device Configuration Page" { {Reserved} *t1 {Change Active Partition} t1 {Change Active Format} t1 {Active Format} t5 {Active Partition} i1 {Write Buffer Full Ratio} i1 {Write Buffer Empty Ratio} i1 {Write Delay Time} i2 {Data Buffer Recovery} t1 {Block Identifiers Support} t1 {Report Setmarks} t1 {Automatic Velocity Control} t1 {Stop on Consecutive Filemarks} t2 {Recover Buffer Order} t1 {Report Early-Warning} t1 {Gap Size} i1 {EOD Defined} t3 {Enable EOD Generation} t1 {Synchronize at Early-Warning} t1 {Reserved} *t3 {Buffer Size at Early-Warning} i3 {Select Data Compression Algorithm} i1 {Reserved} *t5 {SCSI-3 Associated Write Protect} t1 {SCSI-3 Persistent Write Protect} t1 {SCSI-3 Permanent Write Protect} t1 } 0x0f "Data Compression Page" { {Data Compression Enabled} t1 {Date Compression Capable} t1 {Reserved} *t6 {Data Decompression Capable} t1 {Data Decompression Report on Exception} t2 {Reserved} *t5 {Compression Algorithm} i4 {Decompression Algorithm} i4 {Reserved} *i4 } # CD-ROM (and CD-R[W]) devices 0x2a "CD capabilities and mechanical status page" { {Reserved} *t4 {Method 2} t1 {CD-RW Read} t1 {CD-R Read} t1 {Reserved} *t4 {Test Write} t1 {CD-RW Write} t1 {CD-R Write} t1 {Reserved} *t1 {Multi Session} t1 {Mode 2 Form 2} t1 {Mode 2 Form 1} t1 {Digital Port (2)} t1 {Digital Port (1)} t1 {Composite} t1 {Audio Play} t1 {Read Bar Code} t1 {UPC} t1 {ISRC} t1 {C2 Pointers are supported} t1 {R-W De-interleaved & corrected} t1 {R-W Supported} t1 {CD-DA Stream is Accurate} t1 {CD-DA Commands Supported} t1 {Loading Mechanism Type} t3 {Reserved} *t1 {Eject} t1 {Prevent Jumper} t1 {Lock State} t1 {Lock} t1 {Reserved} *t4 {S/W Slot Selection} t1 {Changer Supports Disc Present reporting} t1 {Separate Channel Mute Supported} t1 {Separate volume levels per channel} t1 {Maximum Read Speed Supported (kBps)} i2 {Number of Volume Leves Supported} i2 {Buffer Size supported by Drive (KB)} i2 {Current Read Speed Selected (kBps)} i2 {Reserved} *i1 {Reserved} *t2 {Length} t2 {LSBF} t1 {RCK} t1 {BCK} t1 {Reserved}  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x ELF 4,4 (!! FreeBSD U WVSҍu^|=~)}t#E!8t8/u H !@8ut R hx WVSP艋 U=!u@v!!@С!8ut h ~!ÍvUUth h G~ÐUU WVS} ?t8uj/75 pu7!;t(3V襡 u;tWuCvVhhhp e[^_ÉUVS]j/SN5 ޅtp!=!t$3V) u  v;u1e[^ÍvUVSu] SNVe[^ÍvU WVShhhpD 1!=!tS;׍7Ohhp 3hhp ;uhhp j> Uuu uÍvUVSu] hɛjw v$TPv<LnT`XT<@>jhq (<hhp jD hʛSVQ 1Ã=Pu-=Lu$=Tu=Xu=@u =<t jjS9h thj/ v5D螇 U WVSEEvt޿duHf1[vHjS7 ƃ}> 8-ujSƃ} Shl.0 DHv} t*hoV ƃVQ Vդ VWV莆 tEUE'e[^_ÍvUWVS}EE   uj=XtM}u9 xڈvhSq ZE$=Tt==Pu4 =Tt)EEPhqhZ $@E u^=L}$ y ;0|ʈvhj$p , =@^ y ;0|ʈhj^p =I y ;0|ʈhjI=<ÀvSj  44%M y ;0|ʈhjMo u- y ;0|ʈvhj-o )vS=i  44%^ y ;0|ʈhj^ o ?t @ y ;0| t ʈ/hQ: y ;0| tڈhSn t*OyWΞ  vPG @t$5Hhl+ Dg $@thj) e[^_UlWVS=&="EPW趁 t5Hhlj) E=s8Pv "uKhvj\) 1t6S"PW蹁 }hj+) v)ƅũ585"EP蔁 Ã}5Hhl* De[^_U|WVSjjEEP jjj ƃ Euhljh]S ߰ЃPEPV? }V迀 |SE tt&DjVA u1h}H: "jV u h}$: x[^_ÍvUuu uÍvUUrhg jEPUR9 EE vt@UB<@ %Ph#v }Gh#hjc vE%f=@t") h#hj3 v1=utUB z=t4PEp<GSUR6=t4PEp<8SUR SEPtEE=t!}uh#Urh, EEP9 E& 8thʣj6 Eh[^_ÉUEP4t4 t/t*E @4t ttut1vÐUWVSjjEp9 EuUrh(G <E@ u6hj j=5 Ãu5hj C;u5hj Ehjj hEP ƒ uuhjW v#B tuh j8 B SBЃt8 t%tthPc tLuhjj =uhj t0`tK!t2t ¯0 0hj% 1RP RP 9S vF,F-u2/2=w%v1u1Bt'H9rtU vEEe[^_UUHw r- ÉU WVS}?tf?u_O j jw É1 8th@jF w}- _we[^_ÍvUVSuHvAj?, Ãuh0j vFVRPhIS}/ ^e[^ÐUE8%ÐUWS8u 1v߰uPhN8 tIW߰u3{=u-<u$SWe[_ÉUVS];uC C%,1C8tSщ‰ t C Cue[^ÐUS] h\j臓  8uPHQRh]phcC 5>]ÐUhgj vUVS]u S uV% Se[^ÉUVS]u SuVt&SV jjvV؍e[^ÉU WVSu} VuWt9VW wv' 1RP>VSWJ F;GuF;G1QRÃVW؍e[^_ÉU WVS}u WuVt9WLVC vw[ 1RPBWV~ G;F uG;Fv QRÃWV؍e[^_ÉU WVSu} VuWt=V|Ws wv 1RP|à KVW G;F uG;Fv QR/ÃVIW@؍e[^_ÉU WVSu} V$uWtMVW wv Љ҉1RPà MvVW G;FuG;Fw QRKÃVeW\؍e[^_ÉU WVS}u W@uV0t9WV vw 1RPBWV G;FuG;Fw QR{ÃWV؍e[^_ÉU WVSu} VpuW`t9VW wv 1RP@V/W& F;GuF;Gt QRÃVW؍e[^_UWVSEU M]u}uvuv uv }}| v1[^_ÐU WVSu} Vhщƒ tWRщƒ uhtj FVGWRPÃCSRPGWRPFVRP(0th@j VW؍e[^_U WVSM] EUuu|1u}WV؃RPSQe[^_ÐU WVSu} V\щƒ tWFщƒ uhtj FV+GWRPÃCSRPGWRPFVRP(0th@j~ VW؍e[^_UVSUM ]u tQREURPG 9u9t1e[^ÍvUWVS]u S`щƒ tVJщƒ uhtj KfEUCF‰UFCEEURPǃGWRPFVRPCSRP0th@jd SVe[^_USEU M]uuuu v1[ÍvU WVS}] WTщƒ tS>щƒ uhtj C Cuhj CSRPGWRP褎 RPƋCSRPGWRP+ th@j] WSe[^_U WVS}u Wщƒ tVnщƒ uhtj F Fuhj FVRPGWRP踋 RPÃW V؍e[^_ÐU<WVS}WhE P\ jE puV t&hSVPo Shj3 vjEPjwEP u>E Eu6}|WEEGP6E؋U+EURP!}ujj h\ÃWE P EP蚃 ؍[^_ÐUVSu v'ہ'~'5)tPR PX tmp=tP5 vP t(DX1ve[^U WVS=u 1fuڻ=}t} u$y]r;ui;r G4]f0=? 4ujt0x( r;u=uhg=E$tcx[Sf<]ruG;r > 4]f0H;d=<])Ce$O@<0p0p0pB0p0p0pj0p60pv0pb0pN0p:0p&0p0p"?)‰У0)<]udu`f=}} =v}t$x r9u  4} ;r Zu*f0phs1e[^_ÉUuu uÍvUWVS] }EM3M}~b}=w%1u-j EP3" E8tE8t3hj v}~EEHv 3KE4`h} j" vhGj" 3uKM}h eָ!tRLE8-vR  44%t3 E}qb=w%1tj/EP uEv@PWhhSd ߃ EPWrg %=t tWk v=h Whhpߦ HyP98 ƃ t7t2KyS8  tuԃytYth+hp\ _Wj uWEPЃtWh4 #=tEPPWh9 1[^_ÍvUhDh`hhhp j0 Uuu uÍvUE @PE@P| ÉUE@PE @P\ ÉUUE H Ãv 8thj膺 e[^_UWVS} DžX=Hu=Lu = t DžXDžhh\ EEEEEDž|EDžtDžx;߰P ‰уu jj萹 ;:ufB$B{:u ;:u0BBBC;uz:u fEPEPEPEPEP|PxPtPhQi 40w[$<DžtDžxDž|EEEEEE4t8tx$x | |uEU DždDžLU lDž\lfy4tfy4 uHlp Pl@Pho lB  e}u"lfy4u9=u0A =lx@.u=u@ vlB&;EvE=<u =t$lA&Pȃ@P;EvEXl@9t,fx2u#=uu u63Ѝe[^ÍvUWVS}19s!vȉډF9rȉ[^_ÍvUVSutPv{ t@vv S  xhj [ue[^UE=<u =t P '=,uPhi vPw ÐU,WVSUfx2t8=Lu = t&UBH0150Ph E8+UU w<=HtvEp h = t6 0AF8V<SQRPk RPUrh EPFPn _sUr3r,F Pr$EPhR 0=DtsUrh0 F%f= tf=`u@F0=vPFPh mvF0PFPh PExt/F0V4RPEP(Rh)Ph F0V4RPUr(N=(t v=t v( vv G@P=@tFPF%f=u W xvhj e[^_ÍvU tE PhmN V EP V _ww EP: t:ww E Ph  tPE Ph躘 fgGPEPd: tPE Ph蜗 ^ wDEP3< t'^ 8-uDtwDE PhT GEG EEEEPE PG9 tE Ph2 EP tE Ph"vEP< tEPhmĖ !=dtE PEPh 1e[^_U] …uOju EPF=dt@PhKhNL hNh? j6 jEPRm uhNhVvEthNhEtPhNSD …u=jEPhhKh訏 hh蛕 j=6 jEPR uhhV:Ethh#vEu1EPhh+ Uhh hGhpqv j@ vUuu uÍvU WVS] j/3= u@ƿ&u%}uCP~5l K 1~&wp$8tap|Kp|3%h h-SEPU e)E}=pt1cv{ S 8 l;t0j2 xtS) vSS5> e[^_U WVS1=lt=pu=|u=xtu=t jPuy ƃjj( C4H $vs Pshj =pt {>sǼ PshU  v=pu3sE%f=@uS0 %v=tEPSvS4 ƃt.=pt U 8tShP =htuSh脞 $e[^_U|WVSDž} u]SEPx/ !] U B%f=>jjEPJ PRl/ =} Dž􋕜R uh'j脋 PhR E X0p4gv;u;w RPR~ 9)օuw􋅘P/m jjjR щƒ PjR E X0p4gv;u;w RPR 9)օuw􋅘P[l jjjR щƒ PhR E X0p4`;u;w RPR 9uO)օuw􋅘Pk u(􋕘R u􋅔PW 7t􋕔R2 EPh肊 x[^_ÍvUWVS}u=|tWh.hpk =xt8F%f=t)ju . u FFuFDt =lu 2EPFPE vD à ujj vW<;t:P<;tPjv Pjv P:} u<PEPh@hpj 0S hpE HyP ƃ t7t2KyS  tu1ytYue[^_ÍvUVS1];tnj/3z ƒBu:.uGzt z.u;zu5Fuh`N Cu땃됍ve[^ÐUhhhhpi j@ vUuu uÍvU WVSu] 1?tpu vhSVI uС9u1;tC3) }3hp t3 ƃ;uV, UWS]߰ЍDH9v8/t@4H9v8/t@S1) }Sh j/S豈 u1e[_ÐUhhph j Uuu uÍvUWVS]u vkhVS`H u)Í4t@EvEvRq  44%@tE͐1E8-uG vE8+uEE=w%1t&j EPu ~ 1ɉMEE8.u[]gfffvEE=w%1t!EC)‰uu}}~jEPˮ j UhhpTf j Uuu uÍvUU) j vUuu uÍvUWVS}] j/3a- Puzo%E/v7w`$EOE1BE16)EvshSWE x)ǃD=t5}t}uthjǂ vt}t=tDj:3d@ uj.3Q@ t@P3( 3jWSd ǃujj v1eC4H $v=?jSWW +s¬ PshP  8s蚬 Psh(  v}=t S<;B u=S<;B}t<55s# tZ=uQsXv55sQ' t=usRv=tsh跑 W{ ÃiH 8thjy V vUS];t1SZ uhSUv@]ÍvUS];t)S< uh"S@]ÍvUVSuG j EPV諫 G 8tVh'j~ E8tu Vh*j ؍e[^ÍvUTS]IG 8u =t'= (u-% (tSh'j8~ =ts=(uj= (ua$ (tSEPja# (M (x(;u=(}5h@j~ Sh'^ ]ÐUhhhhGhp` j Uuu u)ÍvUh@hp\` j U WVS}E E jjP; }Rhbj| jjh Q }Phbj| h PR = tQheju} \Tt"hT\PhjA} S0E M 9vE 0o ƃU 2hj| Vh ׉C!CS{xK`Kd t1 jRPQ@ }Phbj_{ vRPQ ;tPhbj{ {x(VlB1 VljؙRPP }Rhbjz QPP ;tRhbjz Q\ E E 8BR j Uuu uÍvU,WVSDž1v8$4  =(t+(v<}=(t+(c=(tn+(G=(tR+(+`!=(t.+(+hE PUR< )EM M =4t`=(u4((=(u (}*U 88/tCjcPhh5($ (dװУ( 8d=(%P5d6 @ 8ug88/t]Phh5d dװ(=(%PR%6 }5dhjzw =(($v}tM)RZÃQS4ZvDžPhmdP hjv }t(RÃShn S/=4t7}u1h jM q$Ehh WY }t](hE p֎ uU rhj2v h Pu j Qh h@+É߾ ESh@P Nv}u U ZE}t'h SM q*Ph h@É߾ E SDDžPhmdR+ hju QÍE}uh jE pmRh h@ÉߍES uSh@P>R U WVS]uu/$EP uMQhju ߉E=uD{t>C8/tPhhh` sh`( `=uC{t=C8/tPhhh@G sh@ @jsVIV } tjE PV e[^_ÐUVSu]=<t!h$ShyS#WEVǃWEVfǃ1ɉ9s f3 9rf=`ShfdV }$k; 8ta; 8th6vjjjV( EEPhmdVK }hs u V ;u)=@t655@Vq ;thGs LEEPhmdV -ShgdV }hM1e[^ÍvUS]Q: tRtmtSt`Sh^s hShs hhp `=u$hhh@ @j5, ƃ}5hjn U r(Z Ãu5hjm M q(}WS E p(WVY }5hjm V v<%Bu vt}ǾS諻 j5+ ƃ }5hj1m EPV' t5hjm v} MЋ]O(19u9v5h"jm U B(ы)REPV: }5hjl V M9s9th@jhm A9rEe[^_UWVSu} 5dhlVIO f wG4(hsGPh}VO GPjhVO GPjhVN hVN GXthVN GXthVN GXthVN hVN w(hVxN w,hVdN w0hVSN w8hV?N w4hV.N w AQ}޿b1t u Dž (L(s-tRP  L(rԃQu  v'hgPhhpE O ޿DžS޿ 1t u Z޿u <޿u  SQhhpAE t ;]U BX ޿ u]1y ;p S# ‹E \FS Å? ;6 ~, PhS' uOHv+QhhpbD E fǀ U f vu Džv޿ujQE PV z ޿ujPE P% I ޿ uUR ~ tQPhU B(v޿1uMQ~ SPRh?M A,v޿TuMP SRQh?U B8'v޿euMQ SPRh?VM A0v޿u uMP^ SRQh?U B4gv޿ uMQ SPRh?M A<v޿uMP SRQh?6U fBH޿ uMQ> SPRh?M fAJF޿ uMP }SRQh?vU fBL޿ uMQ~ }SPRh?M fAN޿ uMP }SRQh?U BP'v޿uIQ }SPRh?YM ATv<{3ƟU 9r6S`PQhhp> kvU DžuQh (vSuj PS\ tD| uD*tSPh`DžuRh }S uj PS贲 t|u9<*t.<t(SQhhpm=  vGShP((s$tSP tE(r=w%1t"S! -P(=Džv$SPhhp< DžG G  t SduSh GuRh nS S! 1wG OvSuS GuQh SuuSy 1wG uPh SS1 fGlv@M 1q(9sG G fGHG@G fG@5-(U fB!SQh hp: EPhP`p !U R%[^_U,WVSEEx(u hF&Uz,u hUMy0uhfhp9 vu~4uhyhp9 EEfxHuh0Uz8u B,B0B8My<u A8A4Au"Et }E1BЃ M̍DBЉEt { t5L5(hRW h EW h`5W =P)uSgC~5P)N=t)u =h)t5P){=`)tb=t)u=h)u =`)tg=|)uhV hV jo=|)uhtB h@OV jΜ Uhhhhp1' j補 vUS]h`U u,vShU S C~ S]ÉUWVSE)jh(+Wr uh {U G 1҉EU(ÉEEUE‰UEEEUEUGPPGPh* U C?u9PPEURPw wh`T G$?%PGPWG$%RG$?%PGPWG$%RhT e[^_ÐUlWVS5l)ujV ǃtEPW6 uVhjB EЋUԣ) ) (SQRPщ‰ tVhjB =)t5) EЋUԣ) )P )uVh@jB 5)5)W ÃtW tVhjEA ډ;)u );HtVhcj#B ve[^_U WVS]@)F@)=\1߅u^=)؉F V8e[^_UWVSE)EPhR EP =t)eh M=p)t;jV"# }u'jh&R jeEEFPEPhj tEFvEPhI tEFv EPh( tEF Vuh@B Fh /^F$%FEF$?SEPh t]EPEPh tEEWEPhm t}^?$ˆVEF^F$%FEF$?SEPh t]EPEPhtEEWEPht}^$?ЈFEF VEPthe[^_ÐUh O 5555h`O 0=?= =~hO hO 5555h`fO U WVS1ۉ)}sVh 5O uC~у=h)t }t}hO "uh@thWEPhl8t]Cw߃hCt1ۉƀ)C~Gw ƀ)e[^_ÉUhtÍvUS8h ]5ShU|tE5ShoYtE5Sh6tEh0i]UWVS]{u1{u+{ u%(+(+BCBCB C K15։15C15lj15BC?$ˆSs N1515C1515BK?$ˆS[^_ÉUhEP5 u$[ 85hvE u5h< =h)u=d)u=`)u}t1P5 u! 8uD5h*jt v5hE< ÉUSEU ]j RP5B =(uB(5(S5ߑ ;(t5((=~v5(S5觑 ]ÉUSEU ]j RP5誒 5(S5I ]UhhedA5 t^ s5h : UWV() )=)t5) 5)ބ )u h`X5)jjƃu h2)fUu)1h9 e^_ÍvU WVS=t&jvh 8 {v=)Ǿ)1+v()PRPÃtG(RP) )RPӉ9u9w1e[^_UWVuhBLH hn hjdh 8O u j裎 v װD= tUֿJt9ֿNt&ֿRtֿTu 1e^_ÍvU WVSu1ۉVEPh`nG h n hjdh ZN u jō װD= t'  vAt t tu1dAtBЃ w \Bv t uAt( t tth hF E e[^_ÉUVSu41ɺ)9uB A9|[^ÍvU WVSu ]1vR r v44%@tCύv;;#CvRq v44%@uЀ;#vRq  44%t VD2C=w%1t6EjEPS< ‹FT0 ;]t ]F9e[^_U WVS}1ۋu UDvW5h @T)=X)t5hExS5h`3 1e[^_UWVSuE@E)jS NKVSF$C <ujS EEC15t_5;=r +9vEP5h` 3 PsEPh 2 5sC C15;Cwh 2 1+s;s tVs EPh 2 s { uEP5h }2 fvS_EQX)~t5h A2 *vF EHEP5h 2 Ee[^_ÉUSE1*)1ҐB~DG\)xt5h@ 1 1 H AvQ5h 1 ؋]ÉUdSEPuE 0v=tpPppP 1H[^_U WVS}GuՃ(t>h. w(O t 0h w(h]. = tP4u8tw8w4h}. u th"O. h>?. e[^_ÍvU WVS}jEP˜ X|GWEPw tWELP^ u EKy1e[^_ÍvU WVS]u t>uth;tc߰҉‰URh ǃuhjK vVShAEPW蔻 vVG ǃt SUi e[^_ÍvU WVSEU EP8tI8-u"UCj=P t+@UƿtUGCChTEP衺 uE e[^_ÐUWVS}uhfF vhJE PhPE P uEEEEJJ߹u E P P߹u EPSEPEhTEPȹ ÃuEPg EPg 1EE v߰ЃPf ǃuhjL XfZGSW,u;tFCFuN,hTEPa Ãue[^_ÐUh`hhh+hp% jp U WVSEp0ƃVEnu~ou EEj=VZ t@] ;tdװЍxWRV uы<t<=uÃ;t*U{ tUE;Cu [ +vC!v=$-uVhLj v1hJV0ƃEP` e[^_ÍvUSUM ˀ:tB:/uz/tBA:u)؃~ y/uA[ÉUtS] SuJt3EPS芵 uE%f=@t1Shhj@ 0= PSh|j@ v]ÍvUVSu] u#13*3VE t;u=%e[^U WVS]u1;nu{ou 1؀8tv8,uF@8uP^ ǃuh 11؉ @Fj,P ue[^_ÐUuu uÍvUWVShj/E 0L PuE R t v11EE1W2wH$= E.E$vE@ hE PEPu%=uhj 諶 tjj tVjj vtph$hh Ã~Ojh'Sg }HPEPSg jh0Sg Sg }ur Åu P 3t= tj"jh Sh7j"jhD ShKj hZh[hd}u״ jj跴 uhfjd jjPf jj舴 uhsj5 j&b 1vG(Ã}uX ja 9uҿv?Pa Gj j u 8t&~˃hhp Vi09 Pjj貳 ZuRhj_ vUD= tPhhpD je UEjjEPEPh& uEhs 1ÍvUuu uÍvUVSj?: }h\ ÃuE PEPB+t$ @-j P5 7d pO8t5 hj v=pOh@j D-H- T-=h-th-PRhj h-X-\-j P5 Qc l-8t5 hj! =l-8hj `-L-P-h u uxƒZ)EE =h-uh j h|jyb ujjeb h|jSb ujj?b hpSH }uEE E J h-&$!vIj)jD I=lO~z=L-thL h VoDjQ) =L-thg h h0jhJ O,!i"jv=L-th hE jCj( =L-th h h0jhJ +V" &j4 R'=H-t5=L-th h hLjhJ {+jV@oV7CX%+V" %j4&jVr@ (Hj'jB M}hVE 0E  Vsà thSV*M}uvGjY'jcB M}t`hVE 0E } Vrà t'=X-t VihHSV'*M}uv"i$j2=H-t%j 8Uh@"h"h#h@#h#h#hp j7UWVSE 0UNM9-wPS ËE t(}@PS EEujj3 vEU:vMuUPh#s >ЃPS ujj -MB6P_ '}uE-@EEUMAMEE80}tUM u؋U +HMe[^_ÉU@ WSEEE@EEPEpEEhPhu$h@%P t7}tEEEPMy t-p-(%EPhPPPv 93$h(װHPhw$R WoÃ=X-t WehHSP&װHPh{$R WnÃS3uWh~$hp; rPPb] UװHPh$R Pd5t@uPh$hp hdpPu%װHPh$Rj cj .=H-t p-jvװHPh$R h$h$h %h@%h`%h%h%h&h@&h&h&h&h&h 'h@'h\'hx'h'hp PװHPh'Rb [PPxװHPh'R uh'hp 'vPh'hp װHPh'"װHPh'R~ wװHPh'RF ?=L-t"h'hp L-Mh'hp L-/vװHPh(Rʽ ju+װHPh(R芽 JװHPh(RN uK=H-t"h(hp, H-Yh-(hp H-;vPh@(hp [_ÉU WVS] u~=t-vhP)hp hp7 5hOhh j =  t ЍP   t   u H8 t8 t@Sh _^48u$UREPURH) EUD"t-h 5t-8u t-t-= /u&EPURh E''Ch EPh[)hS覝 UREPSFFPjj@URe }v4ha)hp ~tSFFEPFV)‹F4UR?( EUDN~uFPzq [^_ÍvUVS]vC; t; tu n;\uC;uh)hpo L;'t;"t CF<C v CF8t;uCuPh)hp" K; t ; t;u؍e[^ÍvU WVS]޿)tjh)Sѹ u)U +;/u)U f)U f)B} ҉ЍD;Erh)hpY jc,vSU R7V ] ރ;t#C/u;/tF;uN>/u] ;tsCC;/t;u)u>.uNSVU )uƒjh)V貸 uNE @9vN>/uSVT 뉐e[^_U<WVSuVÃ=H-uHdO=L-u ;V$DžEPSVV} ʉˉЉU9u13P1EǰHfE xvDžR#ÃuQk$RP^F uh)hp hV#uh)!eVh*hp DžhVS$ hhu$Sr ߰Hډv=H-uJdO=L-u5;s)s)t}C=~hCPRh*hp ?CPCPP萟 R SQ P !ÃR"u(h4*hp: Q[E h`j PRrR QPitCs.;sh4*hp RD [^_ÍvUVSu ]FP-Cƒ:t=L-u <^v?B:uf+SfS=H-t!HdOrC ^%u(t@tC *C Fw$d*FPh@*hp ;vC @6C =.C #&C %6j%u C /vC e[^ÐU,WVS} EEEME9s4;sC9E}E{ tE{ tE ;]r̃}tE}tE=L-t9Eօ~gfffvE)ƅUMTUEQ}EuEE|8}E19EU9UtM IM܋EE@U=L-t$3MQh*hpH C@EfC}tDS xyx;| tpphpR8 fCsh*hp }tBS xyx;| tpphpR7 fCU܍;Erh4*hpr `[;]}G xy x;|pphpj 17 C;]|EE9EF;uoe[^_ÍvUVSuVÃtf=L-u;t=H-uJdOst2 $ $C'$C@PCPh($ v1e[^ÍvUVSu urÃt1=H-uHdOs=L-u ;u!3!u fF@fF1e[^ÐUUE pr>a U=h-iu=(%tjh@%A= h*]u j"ÉUVSu =T-؍FdOsB=L-t&6+}u1+Ph;+h" uVh>+h ؍e[^ÍvU|WVSu}=T-ЉUE HdOr&=H-VhG+h } u=h-iu =L-=X-u/E Ph\+]SA ރuU RVXE P!ÃtS#PV_ t$WU RV#Ãu STKEx[^_ÍvUS=T-؋E HdOs)u6"t`Hxt P%؋]ÐUVS=L-tha+ha j Ãtl=L-t_h~+h0 HvsCPJOsdOsSVS\$ u;5tOV ÃVOrq=H-tS!Ph+hw {uSSS#$SPs\ %C % [uF;5tOSe[^UWVSEEE HdOЉUEP_ ǃt3Mwƃuh+Y9tEU RƃtM^[t9uEu^9tZ}uWRW" 7v=H-tW Ph+h WO1eEt"t F;EuUt G;EtM}E$,N=H-VVPUREP}uWQW! vWOURE PUR8 Ã}u S`PK=H-ASt}u Fuu/5`OVh/h-0 =h-rt1=h-Rt(h/h-: h-虀 à hh h- Ãt&h0S!S d5u)S7 h-h 0 jm}5`OVhM0h1/ =h-rt0=h-Rt'h/h1 : h1 à hh h1M Ãt&h0SaR h5u)S7 h1h`07 jDžƅƅ0ffDž xO0OOt%f=@5d5T h- l5 u%ɦ0 Ph0hp =h5t5h5PT h5Huih0IZ5`5R5|O ÃhP h. PMC`5)‰S [^ÉU-=OtO%f=@tÐUWVS] S ujSEPUvjSEPU҃hEPS E߰Ҹ)Ph0Sl ߰H rr5l55l5à t)s0u5l5vEPh 1hp t'sH1u5l5URh`1hp躾 5l5ǃ0C=v!hCPVh1hp] ?CPCPV* UR3V pW5l5H5l5Ã5l5Gǃ Z[^_ÍvUVSuS5 ؀8/u8/t1vPV>Ãu1%3h0Pfz t8uƉ؍[^ÉU WVSu u tbpp5l5FЍx5l5Ãt!C9uWVCPח ủ1e[^_ÉUWVS=D-t?}} ]9ff;tVSLVS 9r81;u -]=StSh1:=St;t=SuCCC)CuS9C $9=L-th1hԻ Ct=L-th1h谻 SC $9s!=L-t6PCPh1h~ =L-th?2h` Cƃ;S[^_ÐUS]fC $fCC5=~;5Of+5fT5d5hjQ豫5CPS5OPK 55CУ5]ÍvU5Of+5fT5d5j55Q75d5E `55U WVSU] 1BCjRsV^ ȈCfC $fCe[^_ÍvU WVS}] uW9tV)ySh`2hp蛹 j%RP7+0 %GthG P7. Ge[^_U WVS]{uBhC P3. C%=H-h2hp C;C| C맍vsD3 EfxtP)9~(=H-tFUBPh2hp詸 *vMAC9u΃0u1tsuuh3?ZvS7ƃ=\-uWH e[^_ÍvU WVSu} WÃuVWh 49>hhVO }NVhI4hpǴ hpR l0 PhN4hp蕴 1Iss5l5l50uw Njs ~SPW) uL5xO5|Oh4hp ʙ0 Ph4hp 0j=\-ukSPP ) uL5xO5|Oh4hp衳 V0o Ph4hp 0j W( P( [^_ÉUutÐU,WVS}u jj= Ãuh4<Mb)Ѝ)‰%{EC=h5ti}܋FENMb)‰UFENMb)‰UfEFdEFpEFtE5h5j$jEP؍e[^_ÉUMMb)Ѝ)‰Ћ%t 9Htu1ÐU(=1#th1{v =-#th-bv u ' US]t;tOr1'159ѡ9t 9Xt @ u1[ÍvUVSu] t;5tOrVh.5t:1599sC =H-t!9suhG5S6[ ue[^US]t;tOrShV5:1599t9Xu@@ P @ uShr59]ÍvU WVS]jƃt]CB;/t ;t9r9t;vt(W6< utCu vu1[^_U WVS}j/WA ÃtWH/u1~tWh58e[^_ÉUVS]~9C59v7)ƃP3V j 9t#N/[S59wʃVh5d8e[^ÍvU WVS=5t5C 51 'j$j$ Ãuh58E$CMQƃub} ujtEPh57MQ}ȈC[Sjj/MQ @PǰȈCsFC^ Mt6E PRƃu h57M KFC^9v} t0E Pth66SM Q6؍e[^_UVSuf~th'6Vp3~u.~th:6VS3~thW6V<3~tvvÃuhs6V39u)^S~t8vS'v[t9suFCuh6V2V65F 55e[^ÐU WVSu} WÃuh6Ve2;^tVx^CFsj/W X6% S‰߰ȈFRV;,P^8 uN fߍe[^_UMQ9Ju AB/vRvRt9JuABuh6Q1ÉUWS]uh64߰H99t 9)$Pb ǃuh6X4SWS" e[_ÉUWS]߰J9 9[_ÉU\WVS=L-th7h諪 =\-Lh"7EP Eu@50N Ph$7hp^ EPh@73jTE` ;=tOwBWÃt's FEPC$Pj3ݚ[uG;=tOvuE;=tOvWÃtj$SVL EC$EC@ F{t C@ F{t C@ F{t C@ F{ t C @ F EPjj$V%[uG;=tOb1;=9s?9<u E9@ EEPjjEPљG;=9rE EtOEԡ9EȋEEġlOE̡`OEСpOE؋EPjjEP耙E@ @t9I0b Phm7hpr EPh71EP; e[^_ÍvUWVS=L-th7h }u\tO%H99jP5 9uh71jjh7IzjjEP Ã}9T0m Ph7hp} EPh80EPSA }90 Ph"8hp0 EPh@8X0uVjL ǃuh8.0VWST |jEPS> }9|0 Ph8hp襦 EPh8/h-)‰9]܉1;9}" 9<t B;9|ߍK$9s]9AAyt AAyt AAyt AAy t A A $9rh[^_U WVS]pOP:=@-t Pvj VhOj:S讀 t;5j:S薀 C55^. j޿9h9h9 hOuw'0@ Ph9h9hpK h9h9 hOu20 Ph9h9hp j 5g Pg S_ : uh9hp轣 jve[^_US]pO;5~V=:t5:  P :uh :hpJ jT5]ÐUh=L-th`:h =5tj5:0+=5t5vjj5:2~ 5=5}5q0 P5:h:hp蔢 jvp- pO@:=5u=@-uh`K6uX : >D-h`Kuh:hp jh:hp =5tBl=D-tk:::1 HuI)ȣ:=L-u =h-tu hKlOdK`OEPh:a }10' Ph:hp7 j>EH=w 5U=w55B!t Rh:hpݠ jv=lKth ;hp赠 jvh`Ku4=H-t5>h`;hs h;)h`K=`Kth;hp5 j?vL @tO=H-tPh;h tOPj) ?uh;)?OOh, h : =`Kth<hp舟 jtOPj語 ?uh<(?dOOh, h  =SudO=h-ru >ÐUWVS}u>55 >=5t^}t0h@<'=P-u hO@ `t j=p-w=5t jq=h-Rt=h-rt =Ot]1ۅb=>u?h<h<h<h=h$=h`=h=h=hp 0h=hpҝ =f=1ۃ=v#>t.CPVh=hp臝 =fGC~h=hpU h=hp> hp 5hOhV u j tV:V Ãh >hpۜ v;p-uK >vkShF>hp蘜 h`>hp膜 5:h>hpk hp 5hOhPA u jD>u v t3P5:2 :װD=5tj5:)jj5: w 5=5u-5:h>hpy p-vp- pOA :P-u.=H-t5>h`;h h> ;p-t&Ph>hp p-e;`Ou;lOtXP Ph ?hp薚 h`O Ph#?hps p- p-I >>=H-tQh@?h x=Ot2=p-~~V Kd9UH)Ã=H-t#f?~d?PSh?hp~ KxVw Ky=Ou=p-uOh?~"@h`K#h`K =5t5jh> [^_ÐU=5t$=Ou5xOh?h? xO?OOtO|O=5t5jh> ÉU=l-=p-=5th @hp9 jCvfEl-HE=5tl-HPjG(AEPhm55Z }"}0 PhJ@hp ÉUhdK袽 Ph[@h薗 =hKthhKv k@Phv@h_ =NtAhXNhNhN5Nh@hp, hNh@hp UWVSu5xOO OAEyMb)‰UAEy)‰Uyd%=`(&=  =N/=@ti&v== =tPVh@hpA w=L-Vh@h |=X-t3Vt @YVh@Cv=L-tVhAh輕 5|OVz ?$Chh=$Cu%=L-Vh@AhU jVh ?L}v=L-tVhiAh =\-t=`-t=\-u VY PVU }z0 PVhzAvOptppVX PVX EPV?U WVW =L-tVhAh\ =\-=`-t VX Op(PVX }y0 PVhA.OptppV8X PV?X EPVT WV!W (=L-tVhAh褓 =\-t=`-t V&X hhVn ‰?|iOptppRT P5?kT hh5?P EPVS WVJV Vx0 PVhAhpȒ 01e[^_ÉU=`Kt=`KtÍvUOhP hP ÍvU VSDžKK=`KuhBf=xKlthBJ=5uh>]R51;5L=,Cu L P5} 9 u wH 5PSUDž~Kuv H PSEDž|u r Ph:U ҃Hu w=F;5L}A=,Cu Lt SeF;5L|vF;5Lgh`KuH u=v4=`K=H-t5>5xOh@Bhݏ ~" PPEЃh`Kj 5[^ÉU=\-uJu u5? u.u0/ P5xO5|OhBhp3 ÐUE jRP5? uCu>t0 P5xO5|OhBhp܎ 0jvÉUU$CE $C=~/PRh ?5xOhChp茎 jvRh ?f U5xOh@ChpN jXUS] Su5?Ȇ ?]ÐUS] hgCA?]ÉUÍvU WVS:;:}h :P:61;pO} :pO DC9|=:u pO:5pO 1=5tV:PvV:P55 Ã=5uB:;pO},~(=H-thtCh pO:=5tu%~ipO 9t]=5t)ޅKDvt%=L-tpO PShCh莌 ؅} :+hChp] O<t5<t<t hC,hC 5xOhD5|OhDhp =P-u h4Dou jpO Sj5: =5tjSc&jؙRP552 1Ƀu ȅt/(q0A Ph=DhpQ jX=L-thVDh! =5u1p-@p-:PEPrtpO PWhDhh::PB h5::EP >5e[^_ÉUS1;pO}!: pOv DB9|:=5tpO P5:ppO P5:55[ ƒ2o0 PhDhp jvt,hhDRhEhp苉 jЅ} pO:=L-tPhEhH ]ÍvU=5|=5tW55Z U WVS]=D-S{ltJs=l=Su(=L-th7Eh袈 SS\=S_ShREPhZE xPh\EvV11󫋅CC C CCCC fC "fC"$&(C(C,,CHTC0XC8\C@`hdPP kuVu 1TClC(S,u uG=v@C %f=@u1=(Cu1C(S,uth_E軵 (C=(CtC(S,щ‰ȉC(S,,CHwy$EC C(C,~,CQv1;}DA;|0xu SC3hEE=StC$C&C5=H-t S[^_ÍvUVSu>upE=StEPhEhp膅 |t|hEhpb h=hpM 5=5:wT$FhE6hF*55h(F55h@FhaFhp΄ >H9:tP5:hFhp规 h=hp蒄 1҃>t+1;}! ,Cu<tB@;|:>:F5e[^ÉU WVSxO?OO|OvExlt'5URtUB;`OuًEH$DG1ۋU;}5ׁǤ<;t VCE;|5URVtUB;`Ou~E OUB|Of>@#>tjItO|O>xOF2xOF&hF# 5`KhF =5~55h Ghp蠂 5[^_ÍvU WVS]1=Su ;Nu3_ǃNuIu!5xO5|OWh`Ghp 1e[^_ÍvUE Puhp USM] KxvAQKy[ÍvUSU] Kxv BJJBBJKy[ÍvUS]M ht89e0|`st# lt4NwtETPCEvuRQ=vuRQM uC1Ҁ;u]UEPhZEEEU WVS}j/W\ tXƀ>tQv>/uCW+Ãu'jW0WaÃS K/F>ue[^_ÉU WVSuF thHV9N VPSY 6V@PjǰȈF0VDPSu[^_ÉUVS]1svF@t9uuh HSsVh0Hh7Hh@C @Ce[^UVSu] =\-u9SV_@ }(d0 PSVh@Hhp =L-tSVheHh~ e[^ÍvUVSu~thvHVV)Ã=\-uGhSu? }2=`-u)N@=d0V PShHhpe~ v=L-tShHhD~ e[^ÐUS]{thHS"{thHS Kc߃SgÃ=\-u5S> }%c0 PShHhp} v=L-tShHh} ]ÍvUS]{thHSrKc߃SÃ=\-u4SA }$b0 PShHhp} =L-tShIh| ]ÍvUlWVSu} =`-t=\-u WzA }uA=\-WVf? Tb0m PVWh I}=\-WV#A ÃEPV< u3}t-jV? uWV@ ÃuVj? }Ca0 PVWh`Ihp{ 1NvEPhI16v=L-t%VWI}uIPhIh{ e[^_ÐUS]=\-u=jhS? }&a0/ PShIhp>{ 1#=L-tShJh{ ]ÉUS]{thJSKc߃SRÃ=\-u4S: }$x`0 PSh@Jhpz =L-tShhJhz ]ÍvUS];tOs'St xt@u C;tOrۉ؋]US]v#S{t xt@uKwމ؋]ÍvUS]u h|Jhpy SEPhJhpy 0s$PhJhpy {t!sPhJhpyy {t!sPhJhpRy {t!sPhJhp+y { t!s PhJhpy J{uJPhKhpx shKhpx SPh&K]ÉUS]@G1K@G5KB@GCth6KRd C th?Kh@GI CthHKh@G. CthQKh@G CthVKh@G C@th\Kh@G AG]ÍvUVSuV1ۅttCdOrVheKhpw ؍e[^ÍvUVSuVh|Khp]w hp hOHyP vhOtG t/hOHyPs  uhO uǃytniyt1e[^UE Puhpy =P-u>hKu)hKu vjvÉUWS]߰Ph DKtSPf DKhd!j =@K| 1e[_ÍvUShL=5h]Sxu 5 Džxx@PjjS5@PG7 0tQhS55 ~0"L| u!LRP5DKh$Lj U VS=5h0L;L=d-t4LP' 5u.;L=d-t4LPhALj v`8 PO 5uhZL]j vj@5DKP Ãt/5DKVu j CDK v50hhL$ ÃulLh!Lh5SV505@PhDK,@K0}V5DKhuLv5DKhLhps pO E=~EE vE}~%jEPhh5@K4 |˃jEPhh5@K4 E jEPjj5@Kw4 }hLߡ EjEPjj5@KA4 } hL詡 e[^ÉU WVSu>t[Àu5vSH v44%u_t-tWhL"1 F>ue[^_ÐUVSuu VhMhS9/ 5 SVn[^U=5uhMhMC5ÍvU,WVSu h%Mj]S. Sh*M ƃ |819}0v)PEP5@K ÃU9|Ӊe[^_ÐU,WVSu Vh/Mj]SW. ߰HPS5@KF VEP5@K0 h4Me[^_ÍvU0WSuh/Mj]S- ߰HPS5@K e[_ÐUu u5@K Uh4MAÍvUdSu uh:MjP]Sp- ShBM]ÉUVS=5t12vhGMhJMz1TCFKvTe[^ÉUSE |3PuhQMhS, ShYMvÍvUWS] ߰HPS5@K ‰߰H9t9u e[_ÍvU,WVSjEP}Et}FuWhSSuh_M rTÃEP' }Fu 5Vv}AtA]ډ߰ΉЍ\9v K; uEPhM9`EPy' [^_ÉUjEP5@K~ tEÍvU WVS}u ~< u C0vCNhMWhM e[^_ÍvUuu uÍvU WVSu1R* TEEEEEfEA vPB0]EPaZ DžDžDžPRPjhSY Ã0uhSR n v* DžDžCQRjhQhT=jSЃ thbRS}l .tT5TPR3 5T uQPhR'  R P PBЃ CS@1[^_ÉU WVS}]=5uhT'5=5uJj5@P]_ 5tj5@P@_ 5uhRj| $R5Kv}uNWTP u+5<t }tT!v3/WEPD3PR De[^_UhE Pu~ UhRh ShCShpY j+ vUVSu] u#13T*3V t;u=T%e[^U WVS]u1;nu{ou T1؀8tv8,uF@8uP4 ǃuhSjx 11؉ @Fj,P4 ue[^_ÐUShThT Ãt6u ujC Ph-TSlX S 1]ÐUWVSh8ThT融 uU=8u1hTh:Tj* 1hZTj* 􋅈PR 1vDžTc=8#\8 S8 JhHTPh Ã;hHTP> t8uPhQTcvhHTP ǃt?uWhVT3vj PS覠 ƒt 8tShLT|փh Ã3hPCPO ƃhWPN ƃǃ PhcP X􋅈Pu h[^_ÐUWVShaThT= EuhThcTE5Tv~t8CPFP u߃PP u…u<W^S6h-TEP(U }tWShuTt E`EPh }u/hT uhThTjv' 1e[^_ÍvU WVS} u ƋTt|VCP u\tWP uA}t'PCPTuTPhTs hCPS uV- e[^_ÐUTTR TuUE uTPuhTjZ& Uuu uÍvU,WVS]u DžDžDžDž|Dž#vǃ< $HV5 2Dž5 Dž5 ZfDžt5 |P Sv5 |P/vPPh55 Z 3vhUVS29tPt| SS& |Dž tDž Džtt urPW uWhUjGn u (u ,u$fPhVǃtlhVtBhVth VjGm kPhVǃth VjGWn v|PPPX }ShBVjGm j US]SH t@Qڀ:t.=w%1tC;u؀;u R RhXSă XuShBVjBk vDžPDžTELvPtPP0 jj\PjXPGÉP u\TPh@XjAk vR舨 v44%@tCύv;cEPEPEPEPEPEPEPLPhiXS 0t\TPhXjAk 1ɋTuƄ]9fVA~TTDžTEHPP jj\PjXPFÉP0u\TPhXjAqj vRT v44%@tCύv;oEPEPEPEPEPEPEPHPhiXS 0t\TPhYjAi 1ɋTuƄ]92A~TTDžTEDvPPŶ jj\PjXPyEÉP0u\TPh@YjA=i vR v44%@tCύv;oEPEPEPEPEPEPEPDPhiXSz 0t\TPhYjAh 1ɋTu]92A~TTPP觵 XP ([^_ÐUVSu] Sj3 uShBVjNg 1ۉڀʀvR莑 443ڀʀvR> 443C~e[^ÍvUWVSu( Eujjrf u>nu~ou EEj=V"% t@] ;tdװЍxWRV" uы<t<=uÃ;t*U{ tUE;Cu [ +vC!v=H7uVh Zjf v1h ZV"ƃEPdz e[^_ÍvUSUM ˀ:tB:/uz/tBA:u)؃~ y/uA[ÉUtS] Su&t3EPSR uE%f=@t1Sh(Zj@e -0 PSh ǃtV菹 K|8uIx%Dt|Ȇ[^_UWVSuh Eujj` u>nu~ou EEj=Vb t@] ;tdװЍxWRV  uы<t<=uÃ;t*U{ tUE;Cu [ +vC!v=@9uVh]j` v1h]V8ƃEP e[^_ÍvUSUM ˀ:tB:/uz/tBA:u)؃~ y/uA[ÉUtS] SuR t3EPS uE%f=@t1Sh]j@` '0 PSh]j@_ v]ÍvUuu u)ÍvUVSEu ~a6h*^p 6^d9=d9t 3Ph8^p =^;uhA^1#h h`^Qp d9;t3v u;uvh^p Sv{ tC 8tPsh^ sh^]u3h  C4e[^ÐUVS]58u;4=u} u 8d9=d9t;Xt8t ;Xu8uSh^_ Ku#=thph^)]vph^]u458e[^U9^h9jÍvU9$^h9jÍvU9^h9jÍvUh h_Tn Uhh@_0n Uhh_ n U WVS1}uEU BBG}h_E PEPt(}h_E PURt}~$E 0h_m vE XHMP(uU 9Zt 9ZuBBE 8at_=@t__tH=tE p)‹E Pt"=4tE p2+‹E P1ҋE 9XuM9HtRE ppV`bE ;Xt p辨 e[^_ÉU<WVS}>h_E PEP襹u"E 0h`4l E ԤhTbj h`f =@>u=VE 0艼u=Į;t;vRh v44%uC;ù;uxtdvvR v44%t)vR肃 44CGu=tSo'Ã=4tS)Ã19u =uPSV_=@t_P?`=u>=Ht5h`h`tjju Jƃ5Q;uz=D=TE 40袺9=tE 4P&E =4tS'1ҋE ;u =uRSE 4_=@t_P_==Hh`h`tmv1 󫍅Pjh E 4[u u+E 4h+`(Y P] =7E 0<=t7$v=4tS&19u =uPS7_=@t_P]=u>=Ht5h`h`蓸tt ?PQF;uPjO [^_ÉUh9`ju u4ÉU =`t9`Rju uÐUWVS1Dž}uEU BB}h_E PEP t(}h_E PURt}~E 0h@`qf +vE HPPu1BvE H)=ĮX;t@vvR v44%uC;ù;E XtdvvR茑 v44%t)vR} 44CFuE PtH=tE p!‹E Pt"=4tE pj#‹E P}PE p }u;}E phf`XT 043vu,jE p踷tf9 | DžRW1ҋE 9Hu 9HtRuE pphp`g 9t P7 [^_ÉUVSj" x hj 轕 h9 =tm=Htd55Ԥh`)t5jh`Ӝv5jh`諜vUWVS}>hu`E PEP-u"E 0h`b E ԤhTbju h` :un=_PE 0@=ĮgGӁvR  44%t*ӁvRNz 44؋Fu=tV/ƃ=4tVƃj1;u =uPh=`PVhp`d =u>=Ht5h`h`ױtj5@u TRj蛦 [^_ÉU帢`}t`ÍvUS=̤t,5^=̤u`Ph`I` vh`!=@uHj=̤t5h`` haG!j讁5@0a8tR5L%Ph@a_ 5Phca_ 0hhh h hao_ 5DP5P5P58Pha_ 05nP5@_Phb^ 5=Ph@b^ 5ԮP5ĮPhbb^ =th hhbv^ hb=4thhhbD^ hb5P5<5uPhb] 5SPhc] 54Ph2c] =0~AhMc1ۃ;0}'v`PhUc] C;0|]ÐU WVS]} u>%buCh`w+ u<uh`w u7hZc\ &}t61PEPhrc\ e[^_Uhzchu u1ÉUhchu u ÐUhchu uÉUSE] u=%t3hclvh`s tkh`s uRj EPs跡 ƒ~E8tshc[ g<5PhdX[ =t5<hd9[ h-d}]ÉUh/dh8u uÉUh=Ht5hnfh`tjju GÃZEPj ]ÐU}hvfE PEP#t(}hfE PEPt}~ E 0hfS 0E phfAuE phfrAUWVSE] @C@Cf~3hfS 3f1t EfuEfCEƿft"CP肤uCEƿft;8|t6CPBtshf;u .jjh=`ssEPU hx E9CtsG E9Et EP0 e[^_U WV}hu`E PEPt"}@h_E PURu$E 0h gQ vUE DEEE Duft2E8|t*EPtuhftE ƿCg1tҀUԤhTbjŖ Eh`A uEwEajjEPE 4uf}tfPS =u>=Ht55E 0h`+t5G=t EH9fEPj U9Ut u4 e^_ÐUWVSjj jj讕 ǃ pÅZS C~jjv jjj hGg融 u DžMgj/P@ Ãuƅ-hCSPh E޺Ug1t tƅ+=tP+hru }~)j5hXgPW:8 jPP8 Wh[g > j ~VC9uPj Wj uh^g=  v[^_ÍvU\WVS1}hngE PEPEv$E 0hgM vE phg;}hgn‹E PEE phg];us}VhhgR hs hjO]ST ߰DE X EE p hg:Fthg)u}uE p hg:̤e[^_ÐUS88hgx:u&=uhh h)hJ:8]ÍvUShS tSh.hK vhBhw; ÐU}hIhE PEPt}~E 0hXhK SE phrh9u8=u,=8thh E phhE9ÍvU}hIhE PEPSt}~E 0hXhJ SE phh8u8=u,=8thh E phh8ÍvU}J u uh^eÍvU}iu[gP)S.P |9vPh[gL7 j8t[^_ÍvU}hBiE PEP;t(}hGiE PEPt}~ E 0hQiH E pphki6USUE 88piu|iPh68]ÐUSUE 88piuiP$68]ÐUSUE 88piuiP58]ÐU=̤tjj5jPi=̤tjjj vU=̤tXhih5=t5貫 ̤L=@u 0ÍvUUE ~0hiF *u@hiïPhg4Ujܥ=@u j>h=̤t jhjhU WVS}=hiE PEPlu!E 0hiE E pBEu+hihal Uvv}u h jEx u+hjhl 1h~t hj ƃjf Uz tM=̤uDh`Whk jfVjʊ vh6jhÃ~-)RRh7 E PEHPUBЃ=̤t  jfVj! e[^_ÐUh9jhĮu uÉUhFjhԮu uÉUVS]u u%h`jWjvh\ u  jvh \ e[^U WVSUE = tEU<t~];tav11Ҁ=tB:u;U}. $B<t:uG;U} FuFC;uU[^_ÐUS}u'4hlj4}hvjE PEP譏t}~$E 0h}j6B v4j 5 Ã=@tC; tj S Ãh5h%[ C; thSh[ ]ÉUWVSM1E1U@~<$t<\uRF:tX~0~>@95F:Ft(>ύD(L(A9tF:uE F:tE}t,9tA}t >tF}t9t >k}u9t EYY=E<[t' <$`<\X~SFHF>$F=w%1tfF>0uU:XBA:uH>ύ|+T+܉߉}E;BAE;8u>>,>]}}v>\uF>$u{F=w%1tVF>0uU:tSBA:uFv>ύ|(t/T(܉lj}];tvBAE;u >tFA>t>,t >]V>uhj@vEN}t& >\u~tFF>tɀ>]u>빉F<,E<]N7vF=w%v1tVF>0uU:tMBA:u@v>ύ|+t)T+܉߉}E;tBAE;8uAF>u=Yt YEh[^_ÉU1=8tjPhu uYÉUhjh@u u5ÉUhjhu uÉUhj}+u2=u&=8thjh kC+u DÉUSE] ~3hk< uGj EPsU щƒ|E8tsh*k<   uhHkRPhkZ< ]ÐUhke*ÍvU WVS=0uhk}hkE PEPYt}~E 0hk; =th ljE p0`PU 0huTl`ch`lRp0N4p0%v0Dp@l04l`tjOyWr vQ؈< u$0;lJ~HF`uvNyV v tuЃt2HyP̜  t뮉 uhlte[^_ÉU1=8tlPhu uÉUVS}hlE PEPt}~ E 0hl9 ;jE pԋÉփutVSE phlY9 e[^U}hlE PEP胆t}~E 0hl 9 LjE p,Et)EP+ P7 PE phm8 EÉUE pm}~ mP&ÐUS] h=`jSuntssh mT8 ]ÍvU WVS}hlE PEP者t}~#E 0hl 8 E PUP賉uhQmu ÃuWm߰@Pr ǃuh`mj{& vShmWv 588jjh9`E pWhp`:0Wds 58E U;Pt p?s e[^_ÍvUUE 02J ÉUWVS}HUzMy11ۋ8t[vUvR\b v44%@t;\CM;CF<uP5G}} }ǰHU;r װH9s< :u.}CװH9s :t;sF};wr9vSRQSN S5/|u bvX x vhj f hDjEp0~ UR&[^_ÉU WVS uE}ЍpE=EtFװH9w&VREP7 u3EPu;uEPu EPÃjEP8uÍe[^_ÐUWVS]j/S>% uƅ.ƅAv9uƅ/ƅ )VSSL P+ u ssosotHS9wbHPSP u2S6M uhoj! PPxsP Ã9P Pu P]à jPssÍ[^_ÐU,WVSuDžoDžDžoDžj/V<# uƅ.ƅ4K;/u9w)CSVVJ 3=Duh^PȎ =]tj5]xrq]Džk=ta;uPj/SY" t@v؃PUK uhpj vP5]qPjP~Ãqt h%pU0 vPh^x Dp1];ps{JH9w@HPSP uSPpF];rrPu PÃjPpÍ[^_ÐU WVSu@Nj_)ÃS7hH ƃ)lj̮ffh=Ef;̮u5f;u(Pخ4hb u E&5خ̮4hbG b=̮uEPRخ0gƃV װЍX9̮vC~3TvRY  44%t̮9̮̮V D/wr$`pvEPhb%U=̤th@p8vEPhb?%EPhb%e[^_ÍvUWVSDž0Dž,}.h qE PEP=zuE 0h+qavDž444;0}"j `PE p uʋ4;0u$E phAqi, h8Pt 4l;p0vRX v44%@tC;}̾;<$t<\CC=w%v1tZ1C=w%v1t|PΉKE9|nE tVs E |7{iuJDž,C0;U}9E 4Vqs E 0<ЍtF;t C;dخ0/dǃuhXq=uhlq t&=̤uh~q=8thخ05GЃ=tDt> y ;0|vhj[ 8Phr cEخE 4p;t C;,t00;E1[^_ÍvUWVSDž|DžX1DžTEPC duhqj  jhqdR ud`NjhqdP ud`dQhqj j/`P[ ƃt>u URhr Ft>u MQh@r j/V \t\\\t \8ub URhr } M QbB Xuhrj jhqXPj u X9jhqXQB tE PhrX``t `9uE PhrF/j/`R ƃt>td`9[u)j]Qb ÃtC`;:t#1 j:`P3 ÃtC=t \RVS`Qhs& tڀ:ud}1󫡌LEEtPEPR`P4 ËtTtWS{ P`Qh(s 0? P`Ph(sa t}tvStp pp| |u't@tuh/s =Ĥ<tt[t C;Buu<ss|PηuBt@tudj"jjj]WssF WhCs{ vtpp|P}}Ft@tt|Pj `RhTs vTQم DžTXuEPhhsU RMQhws$ VsXtsPhsh|SJ h PS|P@j ;hshs` [v|1󫍽|G|9s(jW|Pi ? tӀ? uƅ{j |P) ǃGjhsWC tWhs|1|G|9s-jW|Pai e? tӀ? uˀ uƅ{||vR$; v44cujhsW> tG?u?ttj W& pj pPW,h ==p8}vhh\Q3 l}\Phs> 9Džxh@Zt&xxPjCg hTj-g xؤܤ<ÉjAv hؤܤ| )hǃht'hQWlP0g 0uȃ=tu=ulH# y ;0|vhj#R <;5ܤ u;ؤvhF h|P|Pf h===ܤ=ؤ<;ܤ uF;ؤv> y ;0|#hj#Q  x hj mQ hE htht vjFt=8thtQxPjd |P2e lR e XtXQZ dPZ 1h@t)\Rhs `Qht |t|Pd XtXPdZ dRRZ TtTQw 8[^_ÍvUj$}ht h_D jh@TWULWVSEhWt!=̤t jj E@vhdj=c hj .c htb[ htO[ Dž mvDžDž1DžEU 4g7 uhtj vjhqPn u'RPjhqR(  t(PRo`j/S ƃhuS ta8/t\9t 8@uEU 4h uv@huPf t8/uDžtt8t8:t@t;tÃj:S. ǃt=G7v;[uj]S t Cj:@Pj:S ƃK;Bt3Ft->t(j/Ve t@ 1=t(RVWSPRh u hfS x Shfb =̤tjj!E]Et?t}E=t EPR`==̤t'=̤uAPRS2du#Sh`uE E@vjjEuEsEEPj"=DDž1=DtUt>thuV t*8thuP t Džt8>t3u/EuuEEPj|=Dt :uDž=8u#PusPhuo t*RVhuhS裦 EuEEu t.EuEPjEPj记 Q)ƒt E@RS E@Eu&E;E}j:EU 4N g=̤tt jj[^_U$S]jhqS tkjhqS tT;[u#j]St tx:%4vEPSj* tj:S u1]ÉUlWVS];[uSj]S tA߰ЃPCPhg/ ߰ƀg:v߰HPShg/ ߰ƀgg}1ELEEEEPEPu Vw ÃtMSw PVhu1 ub0{/ PVhu  ]{thshg. guSBs ssǃ }%[uփhu =Ĥtc<vRt B;Cuu<rrWpu([tWZ \huvssWEtv{tdj"jjj-VssE6 Vhu [j"jjj-Vss6 0Vhu WlZ huKsshT ubu E EPhWZ}huV <=u1EjEPjjW }h v  h$vWt ԯh&vWt  =ԯtuh(v 3=8t5h7v j~C=ԯt5ԯ\w =t5Bw GvEjEPhhW( }=t hIv  WX 1e[^_ÐUjq x hj -D h8 L=LtjhKÉU WVS}L=hhTv; u jWhZv褽 uhh`v 7jWhjvx uhhpv VW> x hj -C h7 =u!hvt 1vhjV Íu VW5 5hv. 547 H v%P5ƃ=Ltt jӃSj!V e[^_ÍvU,WVSDžDžDžDžhjU DžDž1CvԯHyP r ԯ~6ԯHyPq ԯSh2ԯHyPq ԯShhhv5 5q5 UGuF}C=8thvh05  =8=8~z5uq~l=t)tu=8u5hw  y ;0| thS? 5=w%1tDCУtjt%dv!=DždDž=w%1t^Dž t#)ts@-Džv~(u Džu-ut uE9sFԯHyPn ԯ =8=8~V5uM y ;0| tvhS> h~2 u6)ÁvSPh % ƃt'9t1t HPj)Q =t ui@=Lt"tt jЋ,v PjP 1[^_UEU UUBRjjPj wÐUjiLh w h0 jhCUWVS<EURwDžؤܤ=8t?}t9} tU :-tRhWw }tMQhbw =@tEPU RMQ.~ v4;tj5諙DžDžDž|DžDžx&vhB=Htj=Hu=L|5LO LtPjN |t|Rj oN gQjNN Qhj9N hj$N u nw1t  uDžE 8|jj M |h$v] CSPS u?ShpwQRjM |Qj tM PiDžvh$vU R uFM QhswPj M RjL  Dž*EPAPL |E%f=tJE Ph}w RjL Qj|L 􋅐P k pEЋUԣJtRRj=L Qj,L |t|Pj L h{? uwtuw4uj5P 1|-(|#j QRAPM }E Phsw"RPhwNt&􋕐RDžxw}t|EPURhwQjJ PjJ |t|Rj xJ o􋍐QrMQhpwtgPj2J Rj!J |t|Qj J 􋅐PxQ$jXjj I | 4KV1ؤܤ)~VSBPI ǃڃ==t =E;ܤ|E;ܤuE;ؤwfEv# y ;0|vhj#4 <EUډEUzh+) hPAPH ƃ==t ==ܤ=ؤ<;ܤ uG;ؤv? y ;0|#vhj#3  x hj 3 h)( }E Phsw sD kE# y ;0|hj#!3 h' <EUډEU=t;=t =})E;ܤE;ܤdE;ؤR@ @ JyB;B| Rj u2 ؤܤJyB;B| t  RV62 ؤܤOy􋅐Pub  0==t =E;ܤE;ܤuQE;ؤwEAv y ;0|#hj#q1  x hj A1 h% B @tM Qhsw@ @t.豵8 thwsؤܤjSt􋕐Rу􋅌Pc jL RjLD Qj;D |t|Pj D =ܤ=ؤjXRjC QjC |t|Pj C =Hu=L|5LC Lt􋕌Ra j7tt􋍐Q҃=ܤ u=ؤv jW X[^_ÉUj \Lhw hG# jh`<6UWVSE lDžhDždDž\<EUwؤܤEtpuw%EEtZ=8tQ}tKlt(}u l:-tlPhWw }tURhbw =@t&EtEPlREP 0vDž`DžXDžT1=Ԯu E%Eh`4=Htj=Hu=L|5L#A LXtXRj@ \t\Pjs@ tp:hXj=@ Xhj(@ \ }u&lƿnw8|jlRvoj/lPZ裰8t7薰8 t-lRhswQXPj? tj;ltxtlvxPƃt/}9lPhswXRj? \Pf=uhگ8 uUhlRa}:lPhswzXRj> \Pv=tsr8 uilRN#luM=t?lP$#lu#XRj2> \PvEu=4tLjjx;4;tj5WjUR>J t3XPj= \Rj= w h`1 Et3 t&RPhwz# }t@UREPhwSt@XRj= \P vURhpw h$vd] }lnwu$Džh}url8|ugjj S< Th&vl@PAh ul@PhpwPDž`FURlPu hulRhsw|d Dž`*EPhBP; |}uEE;hvX=ht5h1 u0 huhxhẸhE%f=tjyS585gfff)ƒu$th`y說y]>yS>5gfff)ƒuth`y6t-ySthyb޿y gfff)ƒuthyxPtPUEPEPEPRhyh׆ƃ 1UE% ‹E% ‹E% †0v޿y gfff)ƒuthzO-t+xPtPpPUEPEPEPRlPhPh&zhۅƃ0 hlp1UE% ‹E% ‹E% †0mxPtPpPUEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPRlPhPh`zhƃ`hlp14UE% ‹E% ‹E% †4UE% ‹E% ‹E% †QUE% ‹E% ‹E% †QUE% ‹E% ‹E% †Q v޿>yDžt gfff)ƒut hzgPxPfPePdPhzhSƃ uRdd:BuA:Bu<:Bu7,󥍅tPtP҉P!thz薥ftfx Іf.,Ph,5Lv$hu,=t f.=Lt5L* jj-PrvL}hu!=u3j|Pjh5Lu }h{>=-uG=%`j`Pjj5Lu }h@{=-uG=%`j`Pjj)5LSu }h@{C,Ph,5L5u} huqt5j|Pjh5Lt }h)yDž\\Ph,5Lv}hujj5Llt}h_{p==-u[=4uR=8uI9<u5EEEEE.fE@Eu,~u]~ujjjj-EPPV t +F%PEPShf{NFt t9VAPPBPBPBPFPhv{ }VAPPjBPBPB PB PB PB PB PBPBPBPBPBPBPBPBPFPjjh{M`u"=uDžX %Xt =-u9Dž|j|Pjj5LCr } h v313v5L% LXt 8[^_ÐU0VSuE=EPEP5LsÃ}+h{5LH% L1b5L*% L=-u1EjEPjjSFq }h v6V5L$@ e[^ÐU=ܤ u=ؤv j9ÉUj=LUWVS]Lhj# Et%=@rEi@#=@iEr@̤Ṳ=t#h5CP ƃCM  u 󥍻󥿀uԯ<U<ԯ@@DD4HH4HLLH@PP@TTĮXXĮ\\jh`P ƃpE`Phz$ jh qPy ƃEqPh D$ 4M4 hhP' ƃEPh# hhP ƃ EPh# EPj@! =LtLjUҍe[^_Ujl: x hj h ЯLjh`UWVSDžxEwuǹuw=t{tu=Dt=Юt94tjSj=t(h>y:t =u'hyth|-j=̤u&h5|jo94tjSihhL|u[hh j- xEPEPhwJ t"xPj jjjE@E E PtPhwujLjjl joxPjr jALEPE PhT|Z tjj4 Luw1t t=@u j%vuwu=@t j=Hu6Eu&E PtPhwe=Ht ju=@%PF=HEu{E PtPhwst[j=Ht jj=Яt xPj =Ht j=@%P=Hh|Sv ԯP@ j S *}hj|=Яt  j j =@t jj=Яt xPj X[^_ÉUVShEP蔦 uԯ@ jVÃ}hp| tj*h[^ÐUWVS}j/WEE1tj9t xt xPqiƃt/})Whsww1h|1Wh@| @|Hƀ@|.A|}0u{.uC1CKu7E}dtEC<9uE0Ejh@|hƃ}@|e[^_UWVS}=u0h|=Яt 0 vhhhhvSe jjS@P thj|1hh|5肤 5 hS) ԯP@ tGWу j PM*}hj|=Яt tBGبt#vhSGP  jTu=(u j6j)h[^_ÉU$S]{uu{uoSzufz u`9BuOEEEEEEBEBfECEjPRn EC]ÉU\WVSEU DžDžh}jwuȮ}d}@h }| à tSh}h@=@uh}h@D8L< خh#} Фu Ф*}j/1Ãu vCÃh0}V thA}Pz t ޿D}u ޿I} u LhR} 0t8u 0}=Lt$08uh`}Lh} Ãt޿}u 1ۃΨPv Ht8u &PB ̃B$}LL D}qeY ȮMĤ  5)88 h}PRp )H@Ԯ=Ĥ1󫡌LDžPPjP+/ ÃtRS~. PRh}蔽 u Ń0 Ph}o jb <8ÅtSaxuaPyt `9qP jr+hL%j; j:0y tN􋕼2,u7QPGPg vh7t j: hdj hj z ! ~BP)P*h؅t"hdj hj  S7Uj*jhaUj)=̤tv=t/j@P{\5.  =L|+j5LG\5L L ̤j=̤tB=t/j@P[5i.  ̤j~U~ÉUWS}Q=D x $hj u  ME< uu}h~fKySz+ EE} }uEP5Hǃt}ujjME<8 t=v!h~‰}uWS EWj5 $=خ0nÃu h~)u h { t=̤uh~vخ05CЃ=tC{t= y ;0|hjq {=p=Ht#hnP h hhh ujj2HErhdj hj e[_ÐUWVSuu1}E1EE EtHA8uv:tCBA8t:u );E~ E] );EuG u E v[^_ÉUWS خ@yÃS5خu݁=u̮7v=t+̮خ|He[_ÐUVS1ۋ5:!t:$uuttWe;u ̮+  -:! +v< t 2< u,B;uߡ̮+뼡tt  < 6,< $b<"t0<\uXB;uS̮+0B;uk̮+H AB;u!̮+;vtr<"u6B;!̮+vAB;u!̮+늉tA t*tt 1[^ÉU WVS}6Ã7=@t/Ph@{ E&>t=@t~ t6SMtLE9rȃSjSxSE E Srƃu Shou Sh v6j h Oe[^_ÍvU!PPPPhhp賒 j" U|WVSDžh Ãu߰Ѓ=v!j?, PSh輱1QShhSmO hS| @uw8tSh耰몉hP@ }ƅj.P}m 0Dž!t tDž h`URBj h`5$j j.5l ƃtLPVi u5)Ph`Rj u+`1j.URzl ƃ1PVi +]Sh`UR3j ` t vrCE 8u/h` U chjǬvh`E 0> O/U :t2΀ t-P@@Pp | ?\E8h` UhSjvP@@P | ?cE8Wh`] U:hj螫=@_v@HyP @t t̓ tȃt uhƁ5=00`a16Àu*vS  44%@u8FG/@HyPR v@u t8@HyP @V uɃH=0u/l`>v0Vp0v0Dp@l04l`tY@HyPe @ u ~iF`u`u"hoh`ht: t5$*hӫhJ5@ h h@c|h臫h z 5@e x[^_ÐUS@@ `?@HyP! @ Bvǃ tƒ,t`"/\u'@HyP  @C@HyP v@tx"uq\u'@HyP\  @C@HyP2 v@t t t t,u=`u1>vC6vL=Lt h`3 t҃;u ]UVS=̤t5h9v}hE PEPIEv#E 0hѸ =Lt @ vȮ}~E p& ƒ=Lt0=0t 08uh j^R50 RE p衡=Lt>E phJBn=8t50h` ̤ f$4BABfA`  BfABAȤ8f=tjjE pp58=u 8huetaEj hc Ãuj hc Ãt{.uKEhh肶 tEjhăhrb uc=@tЮ D փփ BfABAt`Qh P=@tЮ vDt(j hha u h v58e[^ÐU|WVSDžDž} u8PEPE PEP}1} t }=1Df@ E u$IPqau E mE hP4 u hwhSC ]E m } u{ ÅuaIP`ttSEPh{vMQhG hjOVD D}u] MM } hu h ƒup}uhEuh١ƒu=uhh藡ƒu-u8t/hhth軣=@ue̤1һԄB;0}Iτ<`uܡԄCfěخ05蚅x[^_ÉU WVSuЍXvhڄsuhY ƃ Ch)PPE uUЍ\~C< u;ȉخE ȍe[^_UWVSu}=uE=Du=L5L  L=Du7=u5v=Lh5ФhhS[? S? }Sh 肠1vP# 8t 8 8} t=@%P7C>t,jjP6ShE賳 J>uۋ Q)ƒt t} t=@%P8hLS< LSrE =Lu"uh`p`5Lhh| u5L Ljj h\ t[^_ÉUS]==u Sh h hhPϵ u1yvR( v44ntat#9pu3hoSh@ ÍvU@WS]=Dtg}1 EPjh 3u}u 3hmEP1!E0W EPe[_ÐU WVS=8=u 8uh萛upj h-Z ƒttBj EPRÉ֋E8tUvR v44%@u*} t=u h,n=8؉e[^_ÉUlWVS8E ME=uE8uh覚}1 ]ShhJ1߰ЍxEu&jh S&X u E u(tcEPEPEPEPEPEPVEPxJ u9EMIM}tE vEEEP= E}u%} u =t:EPhAi 'vMM} t=u hlE8}u M Ee[^_ÉU=Lu H>LEPhwt@j>tE;Lu jÐU<WVSDž}u>jh=jP<===5ؤ=ܤ5= SQRPRÅ}1ۃd~dShe+PP8  ~WٺQ)Ãhm)PhSh+PP7  1ۉ vC  u vvB^ u P^PQRh%+P*P,7  ))É؉B}B@Bv;= uV;5vN5=~Dž)‰)ȉB} B@Bۅۅ5h=ܤ=ؤ;=u ;5~*؃h>+P)+߭-ؤٽff f٭߽٭uC?~v;؃h1+P*P5 jhVSOt#PhK+P)#hP+P*P4 jhVS&MÃ<֙R)PhT+P*PD4  QPj3 }uhj j B}u E؋U;Br1 xwhj bЍx;}}BGǃ y ;0| ̓hj - F;u6E9]e[^_ÉUEPhht@&P4t E PUEEEEUEUjEPj3ÍvU===hh5!?jdjP 5h j 5hj5w hj5_hhh&j 5@0jh&h3j5! j5jj5P=uE=t5=t5U,WVSu1ۍ}EEEEPEPh6V uuB =tVSh8觞 %e[^_Uuu u6ÍvUS] }t3h] Wv Utu*Shj h? EPEu E1]ÐUWVSE`@@=@!Vh@ hI `Ed@A EӁvRl v44%@tF͐E0E@Wv"u E"C'u E'3ӁvR v44%@u.GFt$}t;EuE␀\uFut FEe[^_ÐUE8^u@€l 1v{{0/s []F;ui=u }thA hOivh99}lh`跚 h誚 h蚚 hU 4hE 4hm 1W11;ujhLU 4/Ãuh@hp(k {t2G1{ ~U DP1{ ~U DPCEs Jjh-8Cjh8 shhm/|F;u:;}%e[^_ÍvUhjh7ÍvUuhˈhseÍvUuhƈh|tEÍvUuhhu%ÍvUuhhuÍvU WVSu1hΈVxuhVcE Phs hf hV [=[tL;Ѝx7A~hԍ 3h׍ ;uhݍvjh[VЏÃS tE PVhhph t߁[[v|BA< v9tE PVh hpph KvE PVh`hpPh +=tjWEиhA 1e[^_ÐUSL=Lt&v{ts3hؖ ;u1]ÉU|U= ~,5 [jh5 !w} h葖 ÉU=@thP h? UEH| <$ < u  u =%u9$ < uh@ Nvh试 jqs2v uh芕 h{ jqsÉUEHu%4u5th@# Lh jr2vuh hߔ jrÉUEHu%4u6th@舔 Mhw j9r2vuhR hC j9rÉUSO=Ot7v{t&C8tP3h hݍ ;ũhݍד hhh 1]ÐUVSuO=OtCv{t2C8tPЗtɗP3hؗ hݍg ;ue[^ÐU WVS}E4hVh@ Vhhp!d 1E E 0E jhOVيÃS& ut{ t:C 8҉{t&sC 8tRh芒 {tjC!EpEe[^_ÐUjhlQu@ÉUE=tBt8tPvPPh  >t8tPBhhPFPh`译 ÐU WVSuFhE pLuhΈU r2t_lQ=lQts3h6 ;uhݍ j\ hhh'E pÃjhOU rĈÃuE phStU r{ tNE xuC 0vU zt h`dvC {t&sC 8tRh {jCЃvthΏ 1vSt E ph hp` 1{tU rCЃs 3hQU BǹtPƒvC C PP3h #Se[^_ÉU WVS} }hhw訅uhΈw葅lQ=lQts3h蒎 ;uhݍz j hhhV 1:vVh Vh@hp=_ 1E}v7VÃuyjhOVÃtS+u{ t5C {t&sC 8tRh蘍 {tkjCЃ\S˅,{tjCЃs 3hp!C C PP3h' m e[^_ÐU [jj"d<jj(; jj;ÉU= [tjj:jj"~;jj:ÍvU= [tjj:vjj";jj9ÉUUuh) hΟ 18} t@EU@E EjjEP IÉUjuÍvUjuiÍvUSh@蘋 R=Rt7v{t&C8tP3h hݍ[ ;u1]ÐUVSu }t hhjhRvÃu vhSOtvhhp[ A{ t&=uhA hΟ賊 {tsC1e[^ÍvU WVS}O=OtNv~ t=~t7F 8t h h*? vh0, >uhݍ lQ=lQtJ8 tB{u'C PiP3h6Љ vs 3hB趉 ;u5;}%E 4*ÃjhOE 4kƃ S赁uV襁tE 4hNu u E 4hi 1tC~ t=~t7F 8t h h* vh0Ј tN;tI8 tB{u'C P1P3h6蘈 vs 3hB~ G;}\le[^_ÍvU@VS]u ~FP~oPh# ~F'hߣ hj2]S ؃ 8thh~ e[^ÉU=l%lh衇 =ltPh@} h ÐU$SpgEPEP<-؃jjeEPEP- t"=tuE;EuE;Etc(jf]ÍvU$SfEPEP,ЉU$t tvhc识 hp Ãuvj/Swuv@}~jhAh~PSo jPSoh4 j^jEPEP+ t$=t}uE;EuE;Etb]ÐUWV=tJj5 h莅 5 +0[h}uE p tjhe^_Ujhhh|@j{Ujj2!ÉUST=Tt7v{t&C8tP3h hݍ蟄 ;ű]ÍvUjhTup|ÉUVSu }t hXvÃuvh6vS{|us C8EvhhpU 1e[^ÉUSU=Ut7v{t&C8tP3h hݍ觃 ;ű]ÍvUjhUux{ÉU WVS}u  hAvÃuvhvS{tvh@hpT 1bvC 9tB3{ uPs G9C }rRhhpS 1vv vCиe[^_ÐUVSut!vVs u u1e[^ÐUWVS;ts 趼 .j覻 áC;tXVICCV軚 C u 誚 C ؍e[^ÉUSuVÃtES;tCB{ts { ts S ]ÍvUut@ÉUut@ÉUVSuu VhVÃuVh@hp+P FsFjNIe[^ÍvUSt-vs s {t*Phh~ u֋]ÐUU }tU4@1v=Ut#Uxt9PtܡUUu1Uuu1v@ ÍvUWV=35hu~ }~E p _]t\h} ƩtPhɩ} ƩtPhک} >D= [tu h!h [} =thDB} ^tPhe} t/ƩtPhx h| hP]Ph| h^ e^_ÉUjhhhG ÉUUBt u B Bv1j.hPBP ÍvUWVS] Dž\DžXDžPDžLDžHDžDDž@Dž<=t(5h{ P }x@ժ@٪fCh۪{ h߰Ҹ)P߰?P\ H @M`;TM3Έh3q3uMHw3uM[m3uMt;D&Pu PLu;LMvTPh^}PtكD}1EZEEpPuVjDWÃuEpPVjWÃtZSPDPh9hpJ B00[ PDQh9hpdJ pCt5Sh9uht1e[^ÍvUWVSuU 1ۉEFVV‰V [^_ÐUUBH;Bs B@J)ȉBÐUUB;t1vÐUE@ÐUUBE ;B r+BBZZBÐUSUM t`zt+Z)É؅|9|Z)ÉB9}B;B r+BZ ZJ;Bu ;JrBB[ÍvUU;BuB;BrBB )ȅ}BÉUU;Br uB;Br BJ B )ȅ}BÉUUztB;uB;uB;BvBJJ)ȅ}BÉUUztB;u!B;r uB;BvJ JB;s J J)ȅ}BÉU WVS} utSEP9|EPSWEpR SEP )߃ ue[^_ÉU&,Ψ(5ÐUu u5,讥 Uu u5(覥 UÉUUXQ9u _91YQ9u= [t9ސ7:֐PQ9uth;뺐ZQ9u :막_Q9u 7듉8u/UQ9u K7sSQ9u 7\vÐUjht&P'ÐUWVhZj @QZ e^_UEHwx$ȲXQkYQcPQ[SQSUQK\QC]Q;QQ3_Q+ZQ#TQVQ^Q bQ1UWVPQZ^_ÐU1tjSjB/`jS]ÍvUS]`<t tu `t tJtA= [t7%=`t `$$T$tjSja."vu=`t `]ÐUS]<t tt 'w{$@jS%%h8gt@D [jjR jSp  Q zv1tjSDjN-LjS9"u3 [jj  jj v]US]<t tu u?t6"u @$tjSj,]ÉUWVS} t8} H(wU ([Rx,vE $[([E] v;|uEC;t;:uU PB EEƃE}U}|t}:u|C}uK))B} tPWE Piu U: vVEPW?t>}:E<|u CU|tE} t}} EZvUvR w  44%t)UvRU 44CEEU9Bu,ǰuB9rU^E8u6} tU U9sB9rE8u([Ee[^_ÐU WVSu}׋] 9s#WEP3u19rݸe[^_UWS=0[0[=4[t=4[([t54[ h2ÃtYEPjSuShi4[Bt(߰H(w([S[) $[([4[([4[``8u 4[```e[_ÐU|WVS)‰ЃPhj<]/ƒ$dvt;c8T~É߰׍whH9}MhhSjjhhh]S軆 0VShGPEjhu>;8EPEPOhhuujj hhh&uV }а׍_@hP9}!SVh:GPEvh@G ;t4 t:t t4"4d d&jw&o`;O=t2&=tI|+=t\v)PR)PRa)PRa)PR)PRj)PRc;Pt' t=4$)PRE ;8h8nƒtװH+vjj#hhRjj#hhhj2uV }׍_0hT9}%SVh>GPEPj>*h@D x[^_U} hC ^;[E<[h~*jh8[hjh:[j>A*vh@C ÐU}  hsC ÐU} hԵWC ^;[E<[h>~*jh8[h"jh:[j>)vhB ÐU}  h"B ÐUM} @9tuz@@C[}u C[h~,jh?[hpjhA[j>( h@CB j&"US4sCC C 4rjCtC C jCtC  vC jCtC  vC jZCtC b vC  j*Ct C  vC ,j Ct,C B vC 8j Ct8C  vC Dj CtDC  vC Pj jCtPC  vC \j :Ct\C  vC hj CthC  vC tjCttC  vC jCtC  vC jzCtC  vC jJCtC  vC jCtC b vC =H[u' j]ÐU=H[tj=H[u dqPh> ÉUH[tUEuH[ vH[t PÉUh5 ~Q}t#j hU[hjhW[!vj hL[hjhN[j>w$h= ÐUS@c4sr{ t_;u C vC C{tCPCP-ЉЉ%P 4rj]ÍvU WVSu} >~FjjVڊV:u؃Q9t~ufA$ 9uFFAWvA $9 F AFuA $<t A AAPAP%PE } ft je[^_ÍvUS4srv{t^S:tU h: ]ÉUS1ۺ4s.z}bztJ:t  4rӉ[ÉU WVS11E8} ujbY;] }NUt,t%u tW'EtCt UFC;] |tWjoe[^_ÍvU=4th54u h#t 4=4u.h8 D4J4DDDDD'DDDÐU9=Dt D@ÐU WVS]=4t;ufjjZ Sjj@Ãu߃jj+ SjjÃunSGƉ߰ЍPt'DD;wD;4)׃WR t 4u2h 7 D44D )щʉ)щ DSt DCD7…|'~=uD vDDDDCutDD1e[^_UWVEƿBt_ƿ8tLƿGt9ƿO t&ƿZtƿ^u v1^_ÉUS4D)Ã}u~rDDDDhm9~2S54hRCP4Pj> h5 =4t,54Eq D4]ÉUWVSE1EhFOE=Q$v0 u9u0=lu'= =` u OBu/FOE==` (vu3 u.FOE=f=`Y =u#=`u jh=l==` =u#=`u jh}=l==` "=u=`hjhJ$#hhhcj %vv=o=`bjhShhc9-ShhcSShhcS$ ShhcS u !d jShhcqSp jEvu+=tt=s'=s Shhh4==s(=s|hU~P}}t"EPhEE5hǃ5}tEPhr1}u}te[^_ÍvU=d[u1+d[`[jhjUWVSE1EuH}t"EPhEE5hǃFuOE==`[t(`[9d[E=d[d[.t PQ9u!`[jhjZQ9u!`[jhjμh9u!WVj豼`[}v9t GNM‰Ӄ t u|`[p=ht[h9uPt,u$%9t 9u FOE"WVj `[}`[= [8t|t9uq~-u$%9t v9u OFEB=H%Hj p8tRu`[j tv tv8t jh jhp`[=@u# jh! jhm jhV p`[Vu4jhjh jhhv}tEPh1}u}te[^_U WVS1ht2=pu$u= [tu th>1h t =[1Ƀ=Luhȃ=Ѓ}%PSVRWQOà ht ÃhtJ É؍e[^_ÉUI=0jjjj jjjj jj!jj" jj'jjG h8+tjj#T=[t 5[* ub(juju8ÉUÍvUjhgjhP jh6p`jH jhh5 ÍvUjhjh hhh =[tÍvUjh{jhd hhh~ Ujh+jh hhh. Uajhjh hhhÐU$Suh& 1cvEEEEEE]hU)Ӄ9|!SRhCPEPj>S h[]ÍvUjhjh hhhp=[t=xt jÉUjhojhX hhhrp=[t=xt jÉUjhjh hhhp=[t=xt jÉUjhojhX hhhrp=[t=xt jÉUjhjh hhhUjhjh hhhU$SEPEPEEEEˆE]uE]EC]US]tjjt jj]US]tjj)t jjE]Uhhh藿t j)h hhhmt jg vG[U WVShǃhÉރ ~}t vS5Ã~W=tS5j>Z9u(9~$)ރ}uV5rƃ~ShI|9ut 1)@e[^_ÍvU1u=dttt= [t(u.=Ht";~t @ÐUS]utP]UjÉUVSuSvvSK  44%t%vS 44Fue[^ÉUjEPuu uÐU WVS]=]t=]t5]衃 tQ޿Ϻt>hѺSm% ]tSh ]+g 2ShӺhp ] ]fe[^_ÍvUWVS} uEEEEPEPh5]k =tM~9s.P ;u*Ph5]$ C9rԃE=v ~ 9s!Ph5] C9rE =]uh hvh5] 5]$D 5]D e[^_ÉUSMU ]=<.u+w4[QhSQht4t$t1uvt[PQh$5] 'w4[h+u h. Sh45] vSRQh75]j =]u#h hI 5]B h5]% ]US1ۍv`<'wP4[h@7w`P4[h@`PShU tJ'w4[hjw4[hjShx'w4[how4[hQShFtD'w4[h&w4[h Sh <'wP4[h6wP4[hPShջV tJ'w4[hw4[hSh'w4[how4[hQShFtD'w4[h$&w4[h$ Sh2v Cb]ÐULWVSE}E=<u!9=h[{E 8o}E}  M "F $vh5] U Btt(E PGPh vh vM APA vh߼5]E  h E xu7h5] E PGPh 5] U zu hM APh5] 9 U Ph"5] F9|s h(5]u  hM At t<tt&0h<6hA*hEhRU BPh5] 9 M Ph"5] F9| hE5]  huU BPh"M AQ PAPAPh_5]J uU BPh"M AQ PAPAPh_5]  9 U Ph"5] F9| hk5]  hM A=t2=t)|=t,vhu"h{h h5]%  hE xuKh5] 9U Ph5] F9|M APh5] 9|U Ph5]u F9|Sh5]U QM <w4\hU Ph5] M D1$%t# tIvtt&:hĽ"hϽh۽ h5] U D2 tPM D1@tPU |2}Ph5]T M D1 tPh5]. U D2Ph5] M |1u|1uFG99U Ph"5] F9|h5]  h M AtPU Bt-PM At7PU BtAPM AtJPhPEPO }tEͺPh+5] U BtPh[5] 9M Phc5] F9|U BPh5]} 9XM Ph5]Q F9|/h=5]1 E xtexu hU BPh5] 9M Ph"5] F9| h[y h[=]uhkhvhq5]} 9XU S$FM <'w4[RhvM PRh}5] =]uh hhvh5] F9}@E <uF9t0M |1u&ÐM   CB9}< uC9t|tڃ)PE Pj9}h5]: ރvs=]uh h$hU Ph5] F9qh5] M Att E PGPh hU BPBPh5]s Vvh5]U M At& t&vthh h5] 92U ttLt't2@ǾξվM vRX8 v44%trE <"tit1"]JyB;B| Rj"-> 1ۋU  ]Jy B;B| t 2RQ= "M PP5] F9 ]IyA;A|"}Qj"= kE 8'w4[hM Ph5]F 9}%U Ph5] F9|݀}t1=]uh hh5] =]u h]1 e[^_ÐUWVShuVk h u/,à jjVj@P?Vuu uEEUvR4  44%t.UvRI! Ã44]UvR4  44%t.UvR  449t E9u}tFEG&>uE)?t +E1e[^_ÉU WVS}u1<811] ;t$3Wt|ԅuԉ];uމe[^_U}%UVSE EEE ^P" ƃVEPh ؃VC ؍e[^ÉUVSu! ƃEPV5pà VFC 1~Ee[^ÉUUE =0^t50^C 0^ÉUVSu] ~Ph FKe[^ÐUuu u ÍvUVS]1=`kt `kuASHC@;C4s 9t.vC4D9u C9u9Ct`k@uu 5`kut `k@1e[^ÍvUVSuM UFX$tKvt\ ǃ u%Ph(VOhj ǃ u!Ph.Vthj蒓hf+ ItSu qvthjhj7h + -t`k@`k@ C v1e[^ÍvUSE] @@$PG =tDwKt=w2t6Dnt/=t(6=,tw =t"=Xt =t X%1]ÍvUUtjh4jI 8vt@R8<u tV1ÍvU5`kt%ÍvUM =`kt `kv=`kt `kPEE@H)1ÉUVSMA9u 9A=`kt `k0=`kt`kXvjQHA@;A4s vA4DP5`ktjjjj5`k SV5`kj5`ke%e[^ÍvUVSEU @X$t`thj4whjiPjP/tW y ;0| hj A3 hjя1۾ y ;0|hj2 C~1۾ y ;0|hj 2 C~ y ;0| hj Y2 h& vw? v1e[^ÍvUj5`kn%ÐUSEU M]@@$trtt3v<%1[ÐU WVS]} uVCHP5`kt1sHVWh@jSze[^_ÉUE@@$t12} tj5dk2k5`kY%USE@X$@\}tGtijh_P辪uRu heh+% ,t"Phebh$ 1]ÉUVhhpM j? vSVhhp/ j? e[^ÐUp@$ ǀÉUp@$@Up@$ǀÉUp@$U WVS}u _$h`@ jh`N@ h,Pj=jh`@ hLPjujjh`? uTh`Pju7jh`? u!hPjj7th,jjkuHhLjjSu0h`jj;uhjj#thjVq1e[^_ÉU,WVS}u EE]EPL? EVSWJe[^_ÉUSEX$Pjj Pjj  PjjSjj]ÍvUEǀXܿǀ\ǀ`ǀdǀhǀlǀp$ǀttǀxǀ|Xǀ4ǀ$ǀHǀǀǀHǀǀXǀǀǀÉUS] uhhp tShhpg 02 PhhpB j; U,WVSu }UBX$Eu @t(@tFTF H tF#v}F vtWEPEPEPjUR t }tuuEPF u1%PRSN@>tjjS%{ tC xtjpSl1e[^ÍvUlWVSu} jSÃuhpEPSGs}ShwquEt}t'E %PSw}@t5Sh%E$%PSv}tShjVG\1e[^_ÉUWVS]}t E11EPhht@jutu}} tlthQ t@S8;4t-;!`tX@S8;NEU;VjjSW BCM;vVUM;uBQ)‰@v1PMq1W ECU;s%vVjjSW CM;rދUM;tVB@PjSWx 1ۋG }tlE144t/UvR44vUG@6t8VuE}tw$E1FPxFFe[^_USE1ۋ@@t_vBσwJ$$B2taF>:t>uF9sWRhhPW  URQZuDžt^@Pr ƃujjEPC;@PRV U r* M qE1[^_UWVS]CLCPEs tC @uvCLPS%(w{LuCLCPjj HP hS7 *dž t'CLPS'{LS BtBCLBCPHltd@S8<u dtSjCLEEPjjsLSZ! tCLCPXv}uCP;EvE}tCPCPPsLSrCPCTCLEUCPBjRj'S@e[^_ÍvU WVS}u uw_ GLCGPCKC{ s l\ths jWEs  C {}VWB09u CB4 CBWB09Cu B0 S{tsp Sd G Fxt5P@Ѓt%}uhsjWEvVW'VW= FX uV~Lt%vLn[thvLjWD~Pt%vPC[thvPjWD~HtvH ~TtvT ~LtvLp ~PtvP\ VP 1e[^_ÉULWVSu}FV trWP" uDžx DžUuRtIt@V8<u )t`U Et@V8<t @t2EPW=UuUtPWjvEuEtEPWTt DžftSEuM@XtE;BjV@v3EECCEC ECt F|@;EwE1e[^_ÍvUu h`ju,ÉU WVSuuF~?t8FX)v9t9{uEPE PS*uF9uӃ}u 1EPE PVe[^_ÍvUS] CC C,C0C(C$jjhhj C t1hju6KX]US] {tCP@C{tsU CC C,C0C(C$1]UMQBXt11z,tALB,APB01ALB,APB0jQÍvU VSu^{ wj C PsV)tuCSE jC,PC@Pg C(EMACEE@ SjPQsBЃ t C(C(C$1hhVe[^ÐU,WVSu}^CXt1IcX{,tjV#C,uDEPEPju Vn tH} tu V EE!EPEPju V* E;C vPC PsVրCCjE PC@Pe uuCPe C(EMACEEUP SjPQsBЃt C(C(C$1hhVye[^_U VSu^CXt1{,tjVC,{ wjC PsVttCCju C@Pd C(EMACEE@SjPQsBЃ tC(C(C$1hWhVe[^ÐUEEE;EvbPEPjURbEBE;CxvPCxPstMQanCtCtECxEUuUB X;tv;w@MQ]BvPEPE;w@MQBXPEPuPV0 uC;uu:F FUtmz$tg1ҋMA$8t B8u~@Rjhd]SPVͺЍt:F FU1ɋ]C @t6`EPhySÃuSVm u UB @t,EPhRNÃuSV/ u t,F FMA@XtEPhQEPh]SÃuSVջ uUB @t;t,F FEPhMQÃuSV莻 u ]t@S8<uGEt;t,F FEPhURCÃuSV$ u t:F FMEP]S}u,EPhSÃuSV迺 uvEPhEPÃU 1uPuM QSV~Ѝt0=EPhUR[ÃM QSV?Ѝt  F+UU]Mt\ЋM;A8vRE9s$;/tvC;]s;/u)ڋMA89w;]u]C8)K K.K.K.)މuEPIUBuSjRЃ 1}tMAt];Xtu UEP e[^_U,WVSu j/VjÃtY{uSh覶 t8uh荶 t&8t!PVhhS jjjjS u=_hSj@DžjRPP‹B Ѓu utFP‹BЃ=_t_Kh@SjEPk3_UBxht @hP@ЋUBPh1[^_ÉUExht @hP@ÍvUMU E$LPhiQuovPhQa[vPhQMGvPhQ93vPhQ%vPh Q v裵 vÉUWVS}] u=w%1C=w%1C=w%1tu{|uoEEESE1ɅtOtCyht=QhjEPEPqhB Ѕu$Extt@HUEDEt߰H؍e[^_UWVS}u >t;vR v44%tF>ù>u E zvE@v}t&1}tUBtM;Htu UvEPȰ 1E}u"UR誯 Ev1ۃ}tMYt Ut5EEE;Ev_PEPjURXt@ECvM;KxvQCxPstEPXtCtStUCxEUdp]}Ou D>w@MQBX PEPBC:t9rF>t9r9Ee[^_ÐU<WVSEEEEUMjjjj?EP  UjjjjRz  M jjjjQT  E`jjjj3P.  Udh蘰 tRhhS ߰HEjPURk tDž$ h# tRhhS* ߰HEjPUR tDž = t+  BBB HEjPUR{ tDž 4 =t$BBfHEjPUR tDž=$t"$$BBHEjPURtDžMh0hGhSi߰HEjPUR5tDž v=Qt"QQBBHEjPURtDž.y=`tǾ`󥍽HEjPUR_tDž&hhhS5߰HEjPURtDž'vhhhS߰HEjPURtDž+Zv=tǾfHEjPUR=tDž2vh tRhhS߰HEjPURtDž4=tǾ󥤍HEjPURftDž5=t+BBB HEjPURtDž6=t-BBB fHEjPURmtDž9&v=t$BBfHEjPURtDž<h"hhS߰HEjPURtDž>RvM t@Q8HEJѭu DžhhS"߰HEjPURtDž0MARQ`ЃXw DžLw Dž4E t@MQ8 UHh!hS<߰HEjPURtDžI1ۃ=-uvGtt-ttvjjjSMQ j6v[Ut0@ыQ8 v[PjjSEP v[Ut0@ыQ8<u_v[<tSj[Ut0@ыQ8[Pj SEP! 迧 vC?U :tgM 90t40S胰HEjPURSuE M 9u1/E h@jUR[^_ÉUu jh>vhh@jS&6jjjS >ǃltd@S8 dltd@S<; t= v;ht0ltd@S89 w9djjjjIS/ jjjjISH艃ltd@S8 dltd@S<; t9 v;ht,ltd@S89 w 4v9dv)HPjjjIS} HPjjjISg1e[^ÉUhju|1Uuu1UW}Шt1hju.}US]S襘 1]ÍvUUE8t  1ÐUS]@t􍃰PtP1]ÉUE 1ÍvUW}Шt1hjuB}UE8ujjjju1ÍvUS]CURS`Ѓt}wuuu S1]ÐUS]CURS`Ѓt#EP=wuuu SZ1]ÐUS]CURS`Ѓt}vuuu S 1]ÐUVSMu t@Q8H9s:H9r. t@Q8Hu1[^ÐU,WVSE} u&UB E hjӁvRnu  44%t.ӁvRa44vڋMA@E E t 8Pu} uMwÍ@MQBXvPEPPhjURpM YE8unEPUR>uσ}uQ,vssujMQ葤 uEE@\E 9u͋UB1M AtUE}uME@M0vssujUR .EMA\E 9uɋE@EPU2MQ -1jUEEPEPjuMQ 1}tEpt Ut=EEEC@;EvaPEPjUR+tEAvEC@;FxvPFxPvtMQ+DFtFtEFxEUu}t)Uz}tGtWuMQx }{tssV[ s}tUB}t }O) v})1EM}t1}t {%UBP1MAE 9uVtWuV +EPEPuURbMAX;EwEAXA`iE @ E+uu1}tUrtM;NtuKUUB;FxvPFxPvtMQZ*FtFtEFxEU0vUB;Ev PEPMQEP*EuuUrrV tMAWuPDž Ex+EPURuMQDuqUBX;Et5EBXB`*vssujMQ u:EE@\E 9u̓WVujUR負 u MA\11}tUBtM;Htu U EP蔀 ؍e[^_ÉU WVS}u Ehju ÃujjVEGGCC {C,CxCxC|uǃtE^ f}%t&SH)t&S )t"S(tMt|W} ujjShujjVO~W SV~u; SVjuSVqu E1Se[^_ÉU WVSuN t1>t6VB9u FB FBVB9Fu B VV)rVit u3~$t-^$;t3r} ;uv$\} ~xtFxPgt-} t} @t􍆰Pt| tPt| t| V?Vz| e[^_USUZKC 9t9tC9tavC9CtTK9u AC ABC9AuCQCCA9C uK CHKv1[ÍvU WVSu]ExLw4EPURum}uEt`jUR^PE t*u}tFU2:Fuy}tE0UujR E@UuPEPjjE>Fv:\u B9uBKBAKt9uB}tE)Uu}} Ut PEPEPEPSVEPbU@t U E1e[^_UwӋMAS< t%MvUB:Rw u )<~ N9w F)SWRk 9u9)u} tAPMQ Pk thjUR10} u ATtPEk [^_ÐU|WVSjj+EPHt vUt@ыQ84 EV"uhBuuhVjUR\Džjh Sh)Sr*ǃsjGPjjMQ.n v ?WhS*tpjheSuYj S[ƃtEWhSu*t)jhQS^uj Su%h@PjEP3vEPP8t!8u􋅜P艸BEPGPhPEPPh`"Dž W􋕘R.uhk@"􋍘Qw1x[^_ÐU WVSjj+EPt vUt@ыQ8 E||Rruh|QjEPU RDžDžDžtDžxDžDžpvjh S#S|PhhpRC jjpQIǃjWjjEP k trMvDž DžWhS trjheSfu[j SƃtGWhSt+jhQSuj SÃu hpRjMQEPPt'n8u􋅜PG/vPP| EPW@ext;UxtpQ9xu!jjEPљxv􍅠Pi9tu0jjUR蔙xQZ xt HtVZ SZ Et􋕄Rd vWd 􋍘Q~􋅘Psxu!hRjMQ tC~hjEP蟘9~h@jMQ{jtPE PURLt8xQY tPY 􋕄Rc /MAxPPHTuU JHX@1X[^_ÍvU WVSjjEPdtZ,1t&S>PE P+c |4)ƅuh PPc Ãu1hEPju艛[^_ÐUVS]uE HPSVb t'j Stj)@RPVc v1e[^ÍvUVSu VتÃuhujuEPV6؍e[^ÐUSEPhmthhmju螚-u hmhhS迩 SxÍvU WVS] }Et 9rn=s7u VOV VSW Åujjuƕt)PjRZ 7 1e[^_U VSMU uEPEPEPRQst}%Bv}t7;]s2U)U vBEM}t E8 t8 tЃ}uH1e[^ÉUS]j/S t@؋]ÐUVSuFP1U Ãujju赔tVu SmZ 1e[^ÍvU WVS} u]iSVWh4UN8u !v78"uE8u v1e[^_ÉU WVS} u]SVW _U8u 5v8"u&E8uU:u 1e[^_ÉU WVSE0~VtKss sVЃ;tCBSs T ST _luTtLJLJ# Wt@%PjV QWVUV t!ujvLVV<t4@V8<u 4t@t@V8<u t@FTSj:FxPV: FTujjjVWiu,FTt h*V誟V- jtjPV VxzuLJ,LJvBBLJVt TFTujjjVhu)FTtFTh.jVT|E01e[^_ÍvULWVSE@E܋UUM܋I|MăytA ]܉Au@t,ELP}W/uGPEtU@ Mċj3jȃQPjU u V}W9 EF1~%vUċB uMB /vS@  44%tuFNuEăx:u"vUJBB:tMăy"u4]Kt CC8 uuċF8 hFNVEăxtIvUċBvS?  44%t MAIuË]ă{uJtuu }t.EPb&U܋R|zMf}ytyuA8t ]ĀEPuV}WT}A~tDUċBvS?  44%u:u MAIuE]ă{C8|8 Ph>萿tsuCKz}ċ}EăxtCUċBvRb>  44%tMIAyuuċ^+]uhIj}W&U$M8EΊ:uAEE:t9lt9pt9+t9-t 9^t9#uk}ċG)ȉOG$8ljE@0bEMvR*44uS}W'UĉB uSu}ăt!GEH@xt UċB9tMċA+EP]SQuVH3&}ā u E@(/Uāz Xu MA(]ā{ u uF(}ĀKE@ UR( x`u#Mu@`YLCXdAPuĉFh}ĀEt@MQ8<u]tuĀN} }ĀEt2UċB @ u}t MċA 0hj]S܈vuċF @ }uEE}ċGG ht t t  |Eăx@8!uUBJJ}BBMăyv]ċCvR>9  44%tuNF~u}ăG8+wGOGEEȃUċBt tA[vwӋMAS<t#=uF:Rw.SV[u}ăvEOGG,vS_8  44%uE@EUJBzFMċA+]ȉ]؉Auā~ t~ t ~ un}ċ}vE@EUJBMăyBA\u*yv$x uEIAAuA 뭐 u}ā t  HEEăxvUċBvS>7  44%tEMIAyuuă~|!s~ t }`}ăSG8 GEH@x2UċB8 u"Māy 8ytC]ċCvRv6  44%tuNF~u}ċGvR56  44%u UċB8|u+}ă$8}G({ $G cUăztXBBJ]ă{t>uċF8\u~v FNv}ċG9uJEH@xtuEUăztB8 ȉM̋]ċ[]uă~}ċGt tAvwӋMAS<t#auF:RwRSVHXu@}ăv7G@E t|uCEUB EԋMIA] t|u ]ĀuN}G}EH@x,UċJAMJJ]ZBB)ʋE@)‰ЋuĉF~ huMt}?\uEHuUċw tV=MċA`: t/]C` tBEPuVBg}uCd}GLUĉBdMAL]ĉCduFP}ĉGhvE@`MċAlQpˉCdShuă~`t}ă`G`Exu Gl!vEălPURyfM tyluAd ]CduFpFh}ċG`G`ExLuX tOEPURe5}uGlGd&vMAL]ĉClCdvuFL}ĉGlGdUBPMĉApAh)]C`CdShuĉFlVp}ă`6Eāx @`UJLAHdJL@t8@]S8 ȋu8}ĉGlUBPGpGhEPRd<}tUM;QLv Gl9vWl]C\C @ E8u>!u(}ăG8!GOO}Eăx.vUċBvR0  44%tMIAyu]ă{uF$0}ăUvUċB<^t8<+t* <#t45v<-t )v]K\6uĀN}}O)EĀH}UJ)MĀI}]K)uNF~k}ăvUċB<.t,<+t2<-t<=t<<^t,}vMĀI| :v]ĀK|@.vuĀN}"v}ĀO|vE83>UĀJ|MIAyu#]ċC8+t8-t 8^t8#uj1uVȯ}ċG=w%v1UċBBQBJJ|EMċA=w%v1u ];+luċF8+t 8-X}ċG8-uO|UċB8+uJ|j EPMqEP }u ];0 uċF})lj)FEFE8auFlVpMĉAdQhEAdHAl E]ĉCXuĀN|v}wwWEP'EPEPEPURMQ w }d }% }tu]ST` EuĉFT1v}ăt+ %PwwWEP% 9UrrRMQ]CKuċFEE~}ċGt tA_vwӋMAS<t#AuF:Rw2SVOu }ăvOGGUBU8vS,  44%2MAM]KC{>E+EPuuV}W#~IUċBvS+  44%tMIAyu]ă{CEE{vuċFt tA[vwӋ}GS<t#=UB:Rw.SRLNuMăyvIAA]u}OGEqE+EPuEPUR"NMqqQ]S'Eu>NЉE~ou }$UB$;EvM9w@]SBXuP}WKPUċB 0hjMQx E];uă~tI}ċGGvS)  44%tEHu‹Uăzuh)MQHt!]ċC ph,juV@xav}ċG`lu2uyEu udjjUr MQ ]sluV\u7C|u jjjVEP}Wl\EUĉBlMăydu3uR]u u=jjuv }WEpdUR[ujjjMQU]uu@}}G`tNUBLlt ;Glu ~twMċQlu]SLCP؃PPRSFuFL}ădt ;Gdu 6t/EċPduMQLAPȃPPRQ]ċCCCCut/}GLEUGPBjRj'WPt6Et@,Uztu R#]Mf}Q]{t>t5uTu)u y uj}WU܋|ЃMĀ]ċC SuV@Ѓu+FTujjjVLu-FTt!}TVEGUt RyMy]ă{\} C\9ALwjh@jQtuFLЋ};G\s jjjVUċB\MALPQXuhj]S|tvuċF\}GLExxLUĀz|}fb|Mtfa|]C|%6uLuu@t@V8<u v}tE@tt&UBLEE@QPPMQR[{ }]tu؋}Ȁ|7tZgvE؋UȀ|wT]CS<t0=uV}؋MȊD9:Rw$PVGu]KCCuċF+E؉F}~WURP8 @MċAAAA]11ۋuF@|aUBPwH$LuDhjMQvu(hjuVhr v6 vEċEąu/'UhuvhjMQr5vh]sjuV2vjjj}W PjjEP UăzzMċAAtt>PwӋuFS<t#5}G:Rw&SWEuEăxv H@v t|uUăzvB MIl]ă{uE܃耋u9F|th@j}WqWe jEPlNthjURpEEMǁ]Ee[^_ÍvUWVSu] EC`{C2'$~ ClPVT{l%CdCpChC`15~tPC`t5t @t8FLCdFPChC`"vClSpCdShFLClFPCpC`C8;u9C`tt )t!3 vCdFLCh ClFLCpFPCKEPEPEPSVz E8Y}tqC`t)t Qt3IEUCdShC`3vEUClSpC`vClSpCdShEUClSp1C` tvtgFLCdFPChC`jvjjjV wjjjV gjjjV WYjjjV ?ClSpCdShFLClFPCpC`{`u!Cl;CdshjVmE1e[^_UWVS] EUMyu:CPhZtjjjEP UC8$ ME@PURQCMj EPsEPƒtRj]EMACU)‰)CECM{uhjEP_ljMQC@PEPaiCC{vCx/t)x?t#hjMQlECKCh8/u<hMALMMAPMAptpPEPssEPPMQ҃ uCU)‰)CECMEUBPMAzLu-QROt E8t UBLM{vaC@=w%v1t8C+6CvR  44%t CK{u1{C=w%v1uC8+t8-t 8^E8uUBLMBPA{CvR  44%tCKuʃ{TC=w%1uC8+t8-t 8^C=w%1uBC@=w%1uC8+uFvNKCC8-t8^uCK1j EPsEPƒuC}}}4);E(!~}~);Ert Rj\vt+uvuCM))CECaE8tEtA}؋U;v/hSU9sjjjMQ=U21e[^_ÐU WVSEPUvEp|9u'UTvL) F=~3FP^tFBVVE( FHFVL RQP, FLFCUBLFDCFP t1e[^_ÐU WVSExvCPtVKƉ91uAC@AB9quC<QQ' K<9uƃsH' ;tCBCSk' _|9sG|@1e[^_ÍvU WVS}1ۅt_t Ut.1EE@;EvMPEPjWs1E@;CxvPCxPstWMt_CtstCxEUE0Pu V+ hVjWui 1tGt;ptu U vVs& e[^_ÍvUS1ۃu u]t=xt=u؋]ÍvUSUE |!t1H1ۃPRt =؉؋]ÐUWVS=t0U:%M:uΉ׋M u ;u1[^_ÐUS]U MEt4rtt&jj}vhnh)b{uj1tPSgwb$4h`.EPSwHu;}t uhhjSc' v2hjSuc]U WVSU Bxu5jjEPѶhjUR/ct' U BtPTvR  44%u*U BtP|_thjEPUvU Bt;t9vR v44%C;uȋU BtxpEvRM  44%u;_uE1SvR  44%u{_u9}u^CNzjjE PtBpB0p0jjUR`u7UBT1+vhvh@jURaae[^_UVSuE @tFTtjs3VHth3jVNev1e[^ÍvUju u2Uju uUju uUWVSUE@E]{ujU B 0Smv] {dExLBwtOuHU zdt?jփlVӃdSjEP! !jVSUR  ] {S[vօt > tFKu9uuIEt)Ѓu:.u Ft`KS)PRWGjUR@ t"FKujhWGjEP@ uhstU rE XUEjPU􋂠Ѓt#j] C 0EPbvU4thRljh]SmPSl hSlSm E @}u5U t@ӋS8<uEtU<t4@ӋS8<uE4t@EE@E@QjPUR5]$ssWGjEP? E9u֋UzLujRAt ]CL1e[^_ÐU WVSE xxu&Uz(t B(xuhGjM'E thxxuJMQ(zHPrU RMQiE PUR<M QEPvjU B|%%PMQ*E xxU u6z$t0Z$;t3 ;uMq$ E@(jU Bx@P˱MA$ujjQ9\vEX$U rt&p0MQ#tŃxuUB$B(0Rt1ۋM3UB(pRjM@tH  M A}t$RjPEP-tUB(M1e[^_ÍvUVS]u EPSst juS.uHFt0u ƒt F}$%PjRuOt jusu1jVS‹EP$P(EEC1e[^ÐU WVS]u C(;C$uhajSEZt3S(zHPrVSWupVS9ijF|%%PS.'uCC(pS t- F}t$RjPS7uC(1e[^_ÍvUVS]u {$uhjSlYjjF|%%PS&uGC$C(0SV t/ F}t$RjPS u1ve[^UWVSu~$uhjVXEEE^$;v;HM;^(uUF8H9ErUEh}tEhV1fE;^(uP3;^(uPhVeF Tu+jjjVl/u FTu ;5hVe1e[^_ÐU WVS] tCxj@PEujjEPWut4u4}HPEPEPqt:1=[t'vp0EPCtփxuEe[^_ÍvUVSEu C$jPf CFtC$Fx1e[^ÐU WVSE}uVP. S$CVW0U S$CS$CpC$CU BtC$Bx1e[^_ÉUWVS}1ۅt_t Ut:EE}w[hEPuWݿE9{xwhCxPstW豿tuCtCtECxEUEuEPEPEPuuuE PW0t91҅tWtE;Btu Uvu v}tX]u9s5vR@ v44%tC9r9tuuE PW51҅tWtE;Btu U u- 1e[^_ÍvUWVS}1ۅt_t Ut6EE}wahEPuWIt(EC{xw&hCxPstW!u yCtCtECxEUE EP]EjEPEPEPSuuE PW0jj4Wpzijj5WXzQ|tt@W8tE];tcvvRt v44%u2vRF  44%uC;uEXuxt&NCPEPބt~vR v44%uCvR  44%uPEPbuCNutt0]EuSF;*uEPE PW 2EPEPEPWF tuuE PW<Ã1҅tWtE;Btu U u% ؍e[^_ÍvUWVS}EEUvS  44%tEOu̅UuEME t tAKvwӋMAS<t#-UB:RwSR\%u vEO+vS  44%u EEOeMQEP1MQ$AMHMA}tgvE t>tGF>wMAS<t+*EP:RwPUR$uFFCMuMA$oUBM AtB$Ax1e[^_ÍvU,WVS]E 0U$EEE}kU<# Zu9 ]1}1ۃ}tMYtE;CtuLUU;CxvPCxPstMQ@CtCtECxUU+vM;vPQEPURE]M)ECMGMIyQ+ U0%;]v{ t{ uKOM9UE MA @uQL-thrEPjURG1jjMQEPURo t]t6vRPv44%tCOu΅uuhjMQB%e[^_ÉUWVSu @F|t^Q@t*u$Ef|jjPUMӁvR 44%t.ӁvR44vڋMA@EEt 8Pu}uIjwÍ@MQBXPEPPURShj-ǃGlu8EPVF#t }uGlGdSE0EPGlPGdPWV/!UVL tFPFPPRV脨 vEFPuhDVK1e[^_ÉU WVS] UB@Xt)C}u#B @8/thjR=vCxt thvh ubvWPoƒtztB8uhjMQ>=hRCt  vPWu 1+v{xCt:/xu :.xv!8.ux.ux/xUHt@@ыQ8 E@vF>t>:uF9sjQRh+hWO WVu/hW] h1WjEP5@V>xhORjMQ @[^_ÐU WVS}8u!E PW(t  v8U Btp~4vRpv44%@tNC̅]~7vvR,v44%@uNC̀;t;0vRv44%@tC;ũEPuh"jW:SU RW@Ѝe[^_ÉUWVSuh"E }ЍX1t~t Ut/EE;]vVSEPjVףt"E=v;_xv"SGxPwtV赣u GtWtUGxEUCPEPURnEE8tPU RVQh"EPLu1tFtU;Ptu U EP1e[^_ÉU|WVSuEU ZxHPVRUR7E 9Xxuhv"URCU 9BxtjVEPbU Bt0EPVOtVjEPz8fE%f=@uVh"Vh"hWK EPWNtWjUR!8 Dž"!j/V詮t ЍX7PjFǃujjUR7G4G_ SVPhEGWEP ujRWEP.uOBtBxxGWURtjWEP1Wsx[^_ÍvUlWVS} h"wh"hSLJ EPS,M uЃFPG,ujjEP63vjjP hÃ|Vw,S 9t0h"PjEPu:S S G,1ҋG,8tv8:uxtB@8ujBPXG(tnÃh"w,vh"j,fu1ZwQG,jj‰W(t G,1,tw,G,[^_U$SDžBRzp|Pdp}h"jEP/#XU Bt;vh"jMQ4t xtptxt pvjPLjs=L js-Ls bEPU rh"hSCG0jSh#h#h#f h#SjMQ7jHPM Q$ h#pU B Bh#M A1U,WVSE~uh #jP2vEE96urj jBEÃXUZ j,jEHMAUZ9Y uQ MAUPEMAAEPuUR9ǃMI ME@LEURPUEy}M ЉUE^trv MGPuhB#s s  EPWSEP_t(}tUR WMQl]u}uhH#jEPp11IGGU B|%%t,PwMQE@EPwUR96u%M1q9vuN vUPMEw9vu~x>wWUR) }t/MQMA BEPALB MQMAPBUBMHBUP MAUP}tMQ}t EPe[^_U WVSu ]JvRv44%tFύv> VvR 44%Ea#=a#t'a#:tvEE8t:uU:uQha#>w@MQBXvPEPDPh#jUR /vNM~tAEvR 44%t EU:uNjM9uhB"EP51U:"zzu}RvR 44%t2MQvR44 vEPMA@t8Put@PUxv}ЍxG#PjFÃujjUR-tBCCC SSCB OKCWURPHCD8K1e[^_ÉU<WVS8j V=_tVE ph#jUR- M qhV4PPh#VPuvE phVj V^uCvU BHyrvM A5 u+1\vtS t Kvt+AװHvRF!h#P>uzmϰЍXPPPRM QEP u# u Dž1ۃD0PjqǃG(Gt+PW/BGRRP]GOt#WBW _$CPPRUMA G9QuyUB 8My EBU RMQ1ZjjEP)AU B@ t eM qh"jEP-jU RMQ[^_ÐUlWVSuE x(?trUR7h"hS< EPS?u4U?HEU ;B%U?u[^_ÍvUuuÉU WVS}u tQ>tLVÃuVh#W6fs3h$W6s h$W5Ah$$W5=t!s3jh6$W5 ;u1e[^_ÉUS]u7PjS]ÉUVSu] Uu9~Yv@t9uuRh`$jV'{tsK{ ts 7jEPs;tCBS{,ts,{(ts(S1e[^ÉU WVSu} {th$WVt1e[^_ÉU WVS}xuh$W64+XtssVh$W4 Fu1e[^_ÍvUWVS]} u~ u(vS u wj@vFEWEE@jjv$v PPSBm twjS2u ǃUSLCPCPPRS:1e[^_U WVS]߰Ѝp=t#vV7SVu ?u1e[^_ÉUVSu] CHys  Ct >uЃujSVl>CHys >uC9u CHysj  bC9N1e[^ÐUVSu] ~ujC 0V,ejClPCdP1C|tCQPV5 ujClPCdPVuCdFLEPVuFL;EvEFL1e[^ÐU WVS]U BtctV btstktBtx0*%HSBtx wm02%Hu\SgBtxwE0>%Hu4S9?Btxw0F%Hu SGj B pS軭e[^_ÉUVSuF@u! uhK%jV"!vF@tyvC=w%v1uJC9CtjSVFTjjjVuFTuF@toC=w%v1tBC9CtjSVZFTuAjjjVGu FTu"uF thi%SV 1e[^ÐU WVS%U Btx%PEu7M ywA@MQBXU BPMQdPh%EP.U z_wNtw;w@MQBXvPEPPUR.MATuLjjjQ%uUBTu*Csh%MQl.?E 9Ye[^_ÐU WVS}U Bxt tA_ t{}jWRÃ1ENU Bt0WÃ1EU Bt0W v?vE t VSPWgZU B|%%PWu2E%U B}t PjSWu1ve[^_ÍvUVS]uEPSs`t juS2u6}uEE @}$%PjVuet\juubevUCBE@Ep EP C @fBUCLBLUCPBPvjS‹EP$P(EC1e[^ÍvUS]E {uj@ 0Sݨ?tEPSt @dEuh'&Sa+1]ÉU WVSuU ~ujB 0VkBxt}up^ Btr0V褈ǃu`{|sVs{c?KFjV rVЃ vjvLVz$1e[^_U0VSEMQMQ9ujj4EPCt FEEEUBE} tRX} h&uEPW}h&jMQWh&uEuh&jEP,{?ƃtvh&jUR }tuqExtpZ}tMQuv}tu/Expv}tju3j]s3js3 }tuExtpuu j/Epth@MQ8 UhP聑u.Mpth@Q8Uh@jMQh&PEpth@MQ8 UhP% h&Mpth@Q8 UhPjMQcj/}tuuyE Hwy} uu\jEPEPURh&MQ- tEEUB\} M9u EUEMvUBHXEUÃt tBh&jMQEu uESuh&u u jd.jjjURMQPh&EP4P>.u9} u URMQ,t?E6jEPEPURh&MQ}, tEEUB\jjh&SMQD tE}uH} uBjEPURjMQ ujEPURMQht E"E8v0URuM UB`X1ۃj1} uM%PEPVURCu}t؍e[^U WVS]u jjuw,SI u@EPVS u+CTujjjSuCTtF @th&jSV1e[^_ÉUU B}PRuÐUju uUu^EujjP avU@uojPjjRb tE뻃jEPEPEP)PVMQIb uEǀUBLEUMAPBjRj'QMhjjƃujjEPOFtFBVvV 7EPURaEEdEPEPjWMQ EEEEEjEPjuEP蒍ƒ t t}%}EPRURi^@;]tG9C uC ZjjgÃujjMQ;{ {EЉF@CU9Vt1uuJ|UWVSjjh'EPEPo v!uh'URMA@|xt Q}Eh'ƃt1jjHPVh'UR h'ƃt2jjHPVh'UR h'Cƃ>h'Vh'h@S:! jjSEPMQ2 ttrtOkh'Vh'h@S  jjSEPEP u+SURv@PMQMUB@|xt R>|MEt@MQ8<uEjjh'@PUR4 r tMjjh'@PMQ u\@;Eu D;EtFh'EP"@;Eu D;Et"h'UR9t vMA@|xt Q${1([^_ÍvUWVSu dPjjjjj6lS HPVEPS1SEP OE xlU BdMALzdZl]9v"vEPURPu)M9}w}uW+EPMQW]S7t<1}tUBtM;HtuU.]Sv1}tUBtM;Htu U ]SUBh@M QdYl)ӉЋMAh1e[^_ÉU WVSuE @}tU Bxtt:DjWV|W ]*uD*PjVU Bt3v;#C=w%1Sv=w%1tBۍv:u{j WE PtBpB0pSjjVQ0t  vNt,E PtBpB0pSWVv1{;wFS%vV:RwPV1 ttD u?;w@VBXPVwPh*jVB*vjWE PtBpB0pSjjVPe[^_ÐUVSu] C}tPCtr0VRu1h*Ct0jVe[^US]M {ujA 0S=7vQtxujAdPPSvh +jSP]ÉUlWVS] Cxt t*E+'vCtEPEP!svC}u*EPEPRuh+EPj(vhhEPN2ǃh+W_Ãu}<0Wjh+SEP VC @jh+SEPUurC @uljh+SEPUuTC @uNSEP.u:C @u4St ;0.vh+EPjEP13;0Sd;0h+EPjEPe[^_ÐULWVSuE~ujU B 0VU BdRhẺUЋU BlRpEĉUȍ}1EEE];]w }䐃WjjSVE u:C;]vMU BTE܍UBjEPRjEPV: t Ev]+]]ԉ^LFPEP荪Ee[^_ÉUtJC4Ev4vEPHE4F4 uEG>u}t EP e[^_ÍvUSM4t"A4S4RjQǃ41]ÉUS]M {ujA 0S{GvCLEUCPBjRAdP1A|tAQPjSK,uECLECP1v]ÉUVSuE @|%؃SV訾uSVOztt1e[^ÉUWVSu} FEGxt trEovGt@E;!uFCHEEdt\@V8<u .\t#j G E vKv~u,jVߢjjPV-}}WxUjEPSWV hU;Wxuj G pJGxHE{ts莰GtU0̎Cujj}t' t_GtU0h.VXAv tGtU0h.V&h.V~Vut-jVUЃtjG KjGtU0EPjGdPWV @UVLtFPFPPRVZX1vF @EEPSWV Gx~ tvvOtQEF @%f=u[rA0VXÃtF p跮F XF `?F H VjF pVЃ0URV/jGt0Vwh.EPxÃtEPCPth.URjV뱍vE%f=t&f=t S7h.jV{|jCPjjV uEPh /jVGjEPGdPSURV4tGdFL}tFL EGdFLЍh[^_ÉU,WVS]ESUUEEB/0MAQ9uYCTjjjSu CTup}u$uPWSUh1uEp,VjSq UUFEEPEPSsDUB @Ruw}tUE}u_EPE PSǃUREPWh`/jS0}t*1tCt;xtu UvW۫1%h.U RjSEP }ujjSUhЉe[^_Uu_ÐUVS]E Vxxt @t1PEPS迤tt EC1e[^ÉUMU B|% t t t%1 j B pQt PrXQKÐUWVSuFEX9uh/jVvEEErC xHMUF8H9ErUEh0}tEh0VC pVwEE9t3FTu`jjjVٿbFTRFTu-jjjV覿u FTuh0V1e[^_ÍvUS]E uh`0jS(xxtPSduSu1]ÉUVSujj4V@UhÃujjVf-C CCCC\Pj8uh0vc`cdCTPhht@ju h0SvCTPC\PCPCPCP` u h0""t tLKvh0jV{ts{;s+vjh0h0jh0h0 jh0h0jhat s stjs jsjs s<pth@V8hj/S3\u@jh0PS5Th0SjV jV'uFT 1e[^UWVShS;pDžxxFUlB VjjSlA@P t.u)h0jEPh0jURp)¸)ЃPpQlptu&h0jURmvh1Wvp;p;wMAS-vEP:RwPURv1t uFtPMQM+)PWtjEP {C;p]9vp)SWV2މp9pDžxx@PjjPlB@P t.t%Wh0jMQQp)ÉptPEPAu#SpRtjMQ tEP SPURX[^_ÐUh1jW4}1ۅt_tE;CtuAUEE;CxvPCxPstWIt;CtStU؋CxE쀋U-EE;Ev PEPEPWIuoE؃uuEEP`.EEPURuW tE}t,1tGtU;Ptu UEP蜠E܍e[^_ÐUWVS]{DžthEP4DžxDž|_G9tTupt7@ t9P~ @t;puxPjjEPt@P tth0jSL^1]_G9uvt,@tS&uG9uX[^_UWVS|PEP}1ۃ}tUZt UtKDž\DžxxwphxPjMQ8GL\F{xw#hCxPstEPGCtSt\CxxU\Dž`MhhVhput!u5URDž`h1jMQƋ\9;wMAS-vEP:RwPUR蠰v1t u4)dQW||jEPB l{C9s9)dtPRWMQt tDžllFh]S1hB VjjShA@Pm0u-dPW\R*\d>dQWEPt vdRW||jMQ uD|UBLdtdIJP E@PjURU`1}tMAt\;Ptu U\Q轛`H[^_U WVS}u{ ts 膛FPwC ujjW{ tVu s (sC 1We[^_ÉUWVSE} uX9rPH tMtA9u)t;vAKt49tt+t'GNt :utGA8uNKt ut1}tE0[^_ÍvUVSutpVk{tsw{tscjjh"13V( s &Sdž1e[^ÉUUJQA9tt T 9u怡TÐUWVSh/1'Et@EE31=313U_81=81 _p_jjh_ ƃu8 _tEPPh_6hh_8 h_jjh_ à tYU2E }th_URФ}tEPjSd}tURhgtS=16V蓢G?EE8e[^_ÍvUMU zxtB prtQ4tjQ1ÐUVSujj4V1t pth@V8 vhPh1hSFjjVЃ 􋆬4PjSu V/à VjF pVЀ؍[^UVSuEXjj4Pbt UtXjRЃt#jE @ 0MQ!`vjjEP\ЋU}th1MQ t!VEPh1UR MQe5t t(vh1jEPvj/Upth@ыQ8 UhP)Ku.Mpth@Q8Uh@jMQh1PEpth@MQ8 UhPB h1Mpth@Q8 UhPjMQ j9jjURPMQe[^UWVSu ]v8ujEPV|tЋE}t C; t; tEPSEPƉЍX1}}1PEP`P1v1PV؃vPh1jUR } 1}tUBt;ptuUVߓEE}C; t; tEPSEP,ƉЍXEP1v1PV؃vPh2jUR0}tA1}tUBt;ptu U!Vh1jEP1e[^_ÉUM1Ҹ<29u@#vBvQh25j(h  ÉUju uUju uULWVS}ujU B 0W[t@W8<u" uh5jWTjE lPE dPjWqv uM AtEE/t@W8U ]EE8>t̀8 E  O$ȉ,,DB$LH8u@B$B;8r 8HB,B;8r 8IJ,FL0FPjV7 jjh(7VPV&jjEPVj  Er EPV蓙vj$P,PE PVc d$P,PVUBhjt<~tvvPtH@V8<iHZPtH@V8<u HutlPtH@V8<u MHtD7PtH@V8<u Hu AGMuErvU1ۅt^t Ut-EE;MvTQEPjVt E;;Kxv"QCxPstVu CtCtECxEUU :EE]<[z<*p<.hv<\t<~|v}MG<t6<~t8,v88 99BfCBCPtH@V8<uHtx~vPtH@V8<H\PtH@V8<u ,Ht#Sq=v~4vPtH@V8<u Hu\CCGM@EU )ËU1e[^_ÍvUWVSUEM91ۅtZt Ut0EE?;EvXPEPjR1t#E??;Cxv#PCxPstRu CtCtECxEUU ut&|;/t|;?uOt|;$u OE Et ;/t;?uCO;^u^CFOt?;\u{/t{?uCOvPh 9t\FCFOuÃ}t$FEM )ƋU21e[^_UWVSM1ҋE E]]tE8 uBEMuE]E +B@ҍ\Z]1ۅtYt Ut2EEU;UvZREPjQt%EAvE;Cxv#PCxPstQvu CtStUCxEUM M]^G9󥤋]EEtPU: u߾9󥤃*vUPh-9 t\CMCEMu߾9󥤃$CUE )ӋM1e[^_ÐU WVS}jh<9WE P#ƃVià ujjEP胨*VSWE P#Sh=9jEPc Sie[^_ÍvU,WVSEEUUM ME]ЉE싃HEvF&t \tBUPtH@ӋS8<uyEHb}MAڃO$L9FUPtH@ӋS8<mEHY1F]<u |5]|u | M|)U UlEvUB:RwPR/{}}t$w}t#v}tj}tkvEӁvRW 44%ӁvRCf44VEӁvR9W 44%t6ӁvR膵44 vOjvE@;Evc=sE}uMQfEPURgEujjMQ~}JEEEUBUEE\vFEvFEvFEvFEvFEsvFˀwӋMAS"UB:RwPR!y1t M;uuPdvUPafMujjQ@EuǀMM E}}t$w}t#v}tj}tkvEӁvRT 44%ӁvR*Af44VEӁvReT 44%t6ӁvR貲44 v{gvE@;Evc=sE}uUR:cMQEPdEujjUR誢}vMMME@EEm~MU E]MU 1e[^_UWVSudPjjjjj:lS]* } HPE PEPS*SV?u1H[^_UUE PRÐU,WVSuU Bx{tsbU Bt0)ACujjVZt@V8 vtJCEǰH9v/E&{uh:jV[evt@V8<u 4t+U %PsVlEu (sVE EE9uxj jEǃxEx j,jEUBUzE9x uP vUBUPUEPP~ FLEVPUEt}E uEU B|%%t'PEpVvPUrVh9u%EX9[uC vUPEUUZ9[uS vUPEpUBp$Bp V }t)EPF BEPFLB EPFPB!vUBxBUP UBUP1>}tEP_}tUR_EPV e[^_U WVS}9ujjW yC0C9uh;jWVE @|%%PVWt +sCtVSWHwsv$v W 1e[^_ÍvU WVS}9ujjWo xCpC9uh@;jWcUE @|%%PVWDt +sCtVSWvsv$v W 1e[^_ÍvUVS]u ~uvSOFtNF;C u1GjuSiu+j jvS&Qu1e[^UVS]u ~uvSxOFtwEPSsu`juSQRtjEpu7Z+F;C t4ujPuzPtJjuUu#jUCBE@UFB EP C @fBFpjSC‹EP$P(EEEC1e[^ÍvUWVSE96ujjP%MvU Bxt t 6u U BtEj EPEPf‹E8uD9t J9u URh;jEP谚]}Ѝx9tQ;t>C@@Ej/uuEv@WPURyt ]9u9uh;EPjURY4;u 1*^vU B|%%PEPURVe[^_ÉUM9t%E @|%%PBpQjjQU WVSuU XC;F uC FLCFPTjuVfu-SC BSCBF Hj jsVMt 5vSVHu;] u98u PV,1e[^_ÉUWVSEE9ujjURMy8"wh<jQ苘EE0<v^!;^uURh<MQ h<EP軥{u SU C@E}ҍJvMDPjjh#<EPURjjh0<MQS 9^uh9<EP:;^uY~tSMQ8BvE~ЍHB9vvQ@<9^u;<PhF<URܤ hM<MQȤF9E6UBTu+jjjRnuMATu ;u1e[^_ÍvUWVSEEE U29EPVE P$^mvEPSU R9^u UEBEUUE@ BUB9BuEB EP EEUP F9uE8UGB9?u E WEEG6;u7EXt?EPSU RouTEUG BW EEG u‹Ext-pV5GujjU R脕1e[^_ÉU WVSjUÃt,ߋu E p4CtE1jjue[^_U WVS} tw!VJUÃujjuΔ1vVWSZCCC CtCCE1e[^_ÉU WVSu ,~t~-~ tF$|8WTÃujjuA0WVSY~tC(C~ t FC@C E1e[^_ÉUSE] ;t CBCB Ss(USU1]U WVSE] KC9t?ƍv91uAC AB9quCQQTK9uƃ;t(9;u CG CB9{uSST1e[^_ÉUUE Mtr t!/vh`<h<jRܒh<QjR;WvÉUWVSEESUREXuu u>t1vRC 44%+}jRÃujjURvGPhRCujjEP{uStF1e[^_ÉUVSuPV9uvPVFCu{t sR1e[^ÉUWVSu} U=w%1t.WYEuV u EPjfE]ChjRWSSV tHj(W)t)hjRWSSV tEPjV<1u džUVLFPFPPRV1e[^_U WVS} u];vvR@v44%@uC;ù;wC;jvR@v44%@tC;ù;+; vR`@v44%@uC;ù;C;vR@v44%@tC;ù;E;vR?v44%@uC;ù;tO?t;t*E8tS~ 1e[^_ÉUWVS} Ӎ{C Pjzƃ FFF FF~SU RPSE P<}t<Ph<hS'0h<SB^YװЀ| uװDR u鍅PPPPҋЍD,PjLÃC(CP*ZHCC@C PYVF C 9Vu^F ^ RhP}P_F9Fu,h<U RjuMVlMH뺋FF1[^_ÍvU WVSEE} ӍsC PjǃGGG GGwSU RPDQ1EXt/U RWSEPtKvcuҍG9Gujh<U RjEPZtCUZt9Ct,Cu&‹C h=sjEPKuȃW/L GG1e[^_ÉUWVSjjE p.E}wU B EPMQ|Uu'jjEPjjujPt u&!U B MQUFvtEЉEPtRMQxEPxRMQCx xEU9s8 tvEM9MsE8 uE9EeE8 Y]CxUx12vtt #|p߰HEFh=EPKÃuu(}t"tuЍXEPURMQŘEEPE pUR謘à Suh=jMQ蘈 }t11҃}tEPtE;Btu UuI}1}tUBt;Xtu UuSIcv|QEPjEPEPpRM QEP# EED0Pj?ǃG(G}tuuPkMWE/EEUBGRpRP@MEEGG@G _$SRVPMUMA G 9Quy UB 8My euЋtP蚟th0=jURMQaRth7=jEPˆ1X[^_ÉUlWVS]E;/uVStqj/U rǃtXSE ph==hS˙/ VS諜u!U BUǰHU[^_ÍvU WVS} u)89sGC< u>vVSEPuމ)89sC< u9ue[^_ÍvU WVS}] u9s5VSW5utv9s C< u9r1e[^_ÍvUSEU ]: t: }B;@B8t9s : t: uӀ8u19s: t: tv[UlWVS}EE 9t*9u{ wU R0 C@vj jjEP/ÃU S9RuZU XE UBL@CRUTt*dSCt%@SjjEpLP薔 kWURSEPlEjjEPUR#[4EH w$=EEPEPD`C@;C vPC PsUR2CEe$=ER t{tSC|\3tSSB9SuJC|.u@E 9u CU CBE 9CuU SS.+vj jjEP-ƃSBVt^}u3VučEPjEP uC VsSjURْ EWEPVURE U BC9u U BE XC;CEC;CE1;ss9CvR2v44%tF;sr;su;CCUC@ hj M88{.}t}tpvC@9CEECvPEPjUR~'EssuSFCEEEC@9CEjEPU|CC1C;CdSEP_ DvjURU|WEPSUR} @t>UvR0 44%t} t }KSE CEve[^_ÍvU WVS]} u@tuh>^t?t@S8<uvtwh>twwh >h*e[^_ÐU WVSEt@MQ8 EUt@ыQ8< E11ɋU ;rs)BEU< u1)FAE ;HrN1)119w1)G1)9v)ˍD;U ;B v%PЃ PrMQuMU B;M AAtM QA AOutE P@ U BKu1e[^_UVSuFLEUFPBjRj'V{uQ^{X| KXC4C4t$rFuIEPV(kuC4/vEPVgt"C4 vWAvEFLEFP1e[^ÍvUS]h>S萊h>S肊 h ?Sqh`?Sc h?SR1]ÍvU,WVSU BxdBtEvR>- 44%tBEUvRƒv44M E=tAE0=Ht;t"U2;Ju;t }t\C uV}t4MvRƒ 44ME0ph?UR袈Issh?MQ興tu ssh?EPGu?kC tbE[vRv44EEE]PUpMt vFAuu3sVj h?UR裇 ;tDMATu5jjjQqQ>UBT+ S>v1e[^_ÉUVSuU Bx3Btxtj B pVBBt~a[t]uBt@9uH~u3 t@V8<uvtpp HxuFTu2jjjVrO{FTk W<v1e[^ÍvUWVSuU] 1!E <@<~ V`MNdEFlFpFh}tN}Fx^tt[^_ÐUWVSUM u}ZxBt 1yBxJxBt[^_ÍvU WVSu EE{,U;S0r)@;C0vPC0Ps,EPt^C,}{,NyVe^u)F u虲8u&菲f 돍vt u}u vEU1 GEYe[^_UM} uMA0@9A,tDy(t>Q(zt5A,A0Bzt 8u+A(HPhg@jQu1UVS]sjSЃt sjjS\ t@S8 vC4`tX@S8XC81e[^UUE M $xCPh@jh@PjRRyrPh@RPh AJu h`AuI{>uCM;t7vvR v44%tC;űU zxt;uEPj߰HPSU RVU Bx~ tv2vE HtQ:F @%f=u[rA0VJÃtF p{/F XF `?F H VjF pVЃ$WV<jSV|URWE lPE dPV-e[^_UWVS}EMURU0 M}tE UEEE+E};uvMAQ9upUBTjjjRfDuUBT}$u1}uPEPURUhEEPEPjVEPK Wuju艳;EE OxوvWj # uEFE;uWuQEPGP$7u"E%f=uGPRuWUu13vUB@Xuh:Eu jRoWLU}$ujjEPUhЃ}tUE UE؍h[^_ÐUMU yujB 0Q"vjBlPBdP1B|tBQPQÍvUWVS}u ujF 0W'F|t^X(ltd@W8 vdKEEFdEF|%%@t~t' tRM==B1E9Ev U)‰@FdFdFd!v9]v E)@FdFdEEK9]v E)؉Fd vFd]^lGLEUGPBjRj'WgEK9]v U)ډVd vFdEHFlVWphEWKwUUVdVlVWp chEWwE@FdEHFl%vtEEEFdEHFl}t&EPWMFl;EvEFlVW@p}tUWL1e[^_ÉUh@FjuhÐUhFjuphÐUVSu] EPC PCP3VF t }th#GjV&h@v{ ts shtCCCCSC1e[^US] Ct$vC PEPj3uF t CwvEC{ ts P輖tCCHCCCC0C H9Cu CCCSC v{+v1]ÐUVSu] {ujSvLRIISVu{u/SvRv44%u1e[^ÐUVSu] SV~t@{t{t܃{u,SvR9 44%u1e[^ÐUS] {C$4G;t~C PCPj 3uD tv{ ts stCCXCC HCSC?v{u;u C(CvKCSC v)v1]ÐUVSu] SV t@{t{t܃{u,SvR 44%u1e[^ÐU,WVSE@E @1tPU}@t}*u(Mf|jjQEEUUvR] 44%t.UvR 44vUMA@vt 8SuuIj}wE@MQBXEPEP5PURRMEs C9tNCu9>tjjhGjUR7 ujvvjMQ7 uv9uE @1t-phGj]SvjPSjUR7\1e[^_UUM AwN$GR8QR,QR* QR&QR&vÉUVS]U BwZ$GvSVRS:RS*RS6RS W&vЍe[^ÍvUVSu] SVDt1K@{,t C,@ u C t}u|}uVWdEHC8EC1tSM9Mv E9u9MtJuE)HC@CuGEtEPV,u!U RV0u }u1v Ve[^_ÍvUVS]u jEPjsLS4tCLCPCP;Er}tEH1CPCLFDCPFHf0N0 1e[^ÍvUVSu^{uVu5EPVSu juV% tu7oUC@BE@UC@ B EP F @fBELPua9ExLu@LvEEF1e[^ÉUS]EPEPjsLST3 t{LujjS@}t*jjuujSHu!CC1h"ajSS]ÉU WVS]} CxuSguSCPC;Bu1FsC@@CEPSL8uwwujS4sse[^_U WVSu^jVbǃtDCPVSu/jjWsuC@`X1sAe[^_UWVSE x#u@+U z+t&z-t jB(pMQhE @1t#x}jURՐM IMEEPEPEPE p4UR0 t }h됋M I8|;MQvE|vR 44%@t||;Er|;UM ;Q8tEPPjP1u+|E|<0|Xt |xDžx|E=w%1u EPha)E||XutapNxap;vE|<0u]vXDžxG=w%1E<8t}<9tw|apvt`E|<+t<-uKDžx |G papE=w%1tLiDžx |lapE=w%1"hajUROx xtvxE=w%1tE<8t <9E<Džx lapsvE=w%B1>E=w%1u&EPhau /vG;}+|1ۃ}tEXt Ut?DžtEE2;EvcPEPjUR3t@E2;CxvPCxPstMQuCtCttCxEU;}u/V|EPtR轜tt |Ex j jPEP萹UE x-uڃ}~~+E9}}}+E9Uup;pau lapupPjdEP`ƃxRjPEP腸M y+uE;Es EEU9Us M)MxuuVpPjdEP!`ƃ |RutQWVEPt|S= +|lE)PEPS|E+|+l‰UutRM q4EPt/à PURNtt51}tMAtt;Ptu UtQ ؍X[^_UUE tr9tt-vhajRlKhbjRXKÉU WVS}hj豠ƃtRE džudžHt^HO DujjWJvHDD~HH|t:|HP|E P膵|u'1e[^_ÉUVSu0t0\ DtDB |t|( t S dž1e[^ÐUSME ]2t? &t zItcqXtP@Q8PPS-St@Q8 vPQE0Q1]ÐUVS]u EPjjv4S' u}t EHv1CPSt+@u S/VSe[^UWVSu} jWV]džW4VLEPEPEPRV&0t}uMEv}tFP@9EtFPFPSG1tGPjjuujWVL9e[^_UVS]u CPCPPv4StASt+@u S.VSe[^ÐUWVS}u jVW5LJV4WLEPEPEPRWy%0t}u7E}uSF1tFPjjuujVW:8e[^_ÉUju uUju uUWVS]u j VSmǃ{Lu4EPS*}uEE1EbCPSt+@u S -}u:jusLS(u_EPEPjsLS$ uBSLBJjusLjS& u EPEPjCLsLS]$ t ,vSLJWF1tFPRjuujVS6e[^_ÍvU,WVS}u f0N0 V4;VKss4V|‰S@{,tMC,@ tD;S8u?Vjt{,t"C,@ t{8uVkOvC@C8;C@s{,t)C,@ t K@C4S8v{,t C,@ tK8C)t? (t(‰< E< M A4EUEPEPtE9uG E;EuOtHEPURփ}tʃ}t}uօthcjMQo7EU BF,@ t5~8u,uF4PEPbN4N0vN8~4sEPEPjWUR QF1t^ۃ}tuuat EKE~8tGEPEPjOWEPl }t}}tuuatKEE8 u K뎉E8.u}zU|:bMv:Auz u}tB:AuKtO:u1}&uu` KtEv~M9t6U:Bu"y u}t UA:Bu Ku~<5v9ũEPEPjOWUR uF<F@~8uf0N0@N4N0N8FEPEP:uK G4;EdG8;EX}ujtKEPEPvuÃ}UvR@v44%o}u.KEPEP{\K[vETwL$gBt<5u 1u1)u KuEPEPtVEPEP菮}G4;EuG8;EujEPpDvEG#1E.t  !t*?tMuNj]EEVEP/}uL})t܀}]tր}"tЀ}'tʃ}u.UvR 44%tVEP-^G4;EG8;EVEPk,}t}u.UvRW 44%u}E܉]EEv1ۃ}tFUvR 44%u})t}]t }"t}'uVEP訬um}EGvE PURWMQÃs9vu^XC8}GLCGPC}tNE* tUJ)@C(E+BHC }+{{ E) tEpSUR*&E(t1} t+SjjM Q}W CC!vE(tC$CC vCC$E*@tKSE CCC$E(t$SC CC jsEPԡDžDžE+@Ut@ыQ8v}tEP8+FMt|@Q8 }| vDžDžHDžDž(0TtE*%(DžE+tDž(e*Dž Dž$E+t ƅ;ƅ;DžDž DžLE*t Dž@ Dž@CUBLCBPjRpM A1 }䉽4@j4PUR+LMu~DžLE,\;A4s Q4)‰EԋMA4E܋,LJ\LJXLJTEPQFjEP蘄 4BH wR$HjvMEP}WjjEP|9D 4RMQm) u?E+u94 u-,DDž(e*M+7v 711E)ttUTtL@׋W8<uOELtCUTtL@׋W8 UL4G 9uE*tvEt@}W8<uPEtCUt@׋W8 U4G 9uutC;C$u C8uLPSEP4BtL~DjMQhthij}WDžDžE*B),;Hv/PHPDMQCqL,D+Nj,D4E+t*+,D4tDž4x 44B  t up@E*t@ u&4AwDž KC(2 uDž 4 Dž ~J4B =w$%1u"Dž SMQ%4GH $tjE)tbE*t jsEP%UtjjhjjR C;C$C8(u{E+uu0TtfHPDPE(%P4 PS}W( Dt$E*aD)Jv(t Dž(@tE*t@PSURE(t { tKK CC4CC0CjsMQ蹙VC,{({ E+CsvR<v44%t FC,uƃvRv44%FC,OCsE t@MQ8<uBEt6t2vRhv44%tFOuDž9B PRVEP\ƃUxMA|F9QxuqxUB|0Mq|~ ~(C@FE($uTVuEPjQM 1҃}tMQtE;Btu U1vuVsSj}W .Dž$FFtuxu ptFxp ;F vPF PvEPk FxtpPXFFPvPxtpFtFxF(pF Dž~(uB~ u u}tEE1)EEEFs}}u 9]11;]w 1)G1);EvU)ʉUM +A9tO)ӃQ)‰PV)Pf>M )Y)Yqr  Fsmr  FmsEe[^_ÐU WVS}U Euu;uFvEPEPjRW tv@E]}t5vRv44%tCMu+]tRF;F vPF PvWwXtF~tvFPPQ=^Suv<=^1e[^_ÍvU WVS} uM^9uAuhjjEP&xS4S{(u{ uC C C !9>u FG FB9~uVVjC@PEPu1e[^_ÉUWVSEt@MQ8< EUt@ыQ8 EE11U ;ZseM A< u 1)BU B<w@MQ]BvU BPMQپCE ;Xru}t1uE)EME1u)UE}tU B$B9BuEM A;A$v*QE H@(U B;B$vR| t| t11M ;YshvU B< u 1)BM A<w@MQ]BvU BPMQCE ;Xr;urE16vE1)E1);EvU)ډӃ}t E؋M AE }tuvjVU RMQ MuE tujVE PUR Ku1e[^_U WVSDž EU zuDžJuvDž] sN{vRΛ 44%uU ;rt;r$tN벉M Q)֋A@;A v"Pȃ PR]S*T4} GE p21*jjjjjjS1r S]S@PWPEP t9]E tt) }GWd]װH9[֋@ NEP0^uE%f=@u  UBRdMPS}WiE@E9Xs @1;s?:u$]F;s:t{EtLt+CGt!u׃tU )BB(M y(t.CGE H(@x(uӃM Q)֋A;A v"Pȃ PR}WPU BM qyyy tq PP5rCBs僽EPE0E%f=@M y(ukQ)֋A@;A v%Pȃ PR]SOu^} GE px tp R@P4M A v] K(} G/Dž 1[^_ÍvUv?w@MQ]BvPEPжG?u;uvuKEE%k@EEUtEEEM;A8EPUMPEPANj] vK~!Wh kURMTtڃ}t,1}tUBt;xtu U WKMTlYvEP8J1uE9E vE 1uEt@EEE]1;uEPMUPMQVǃWhkEPE }t.1}tUBt;xtu UWwMT];] s3hkE+EPhkEPZUTugF;uIhkMQETu=E܋U9U hkMQiETuUR MT}t E1e[^_U WVS} UB5WE< uEPEPwRMQp GWE<w@MQ]BvGUPEPE9]EG;G v&PG PwURnKu GM)ى˃ t w GUBREDP+0__(Ewƀ> u؉Erbv FsTWE<w@MQBXGUPEP]r BFsWE$jwURue[^_ÉUVSuE XvKSVuu^LuFLFP@e[^ÍvU WVS] SC MSJC1v;StC;S$t>HJG8upt/jjV'8uvSCM `SCM S)S){CL{(ts(CCRPp.{ ts CCC(RPN.1e[^_UWVS}u Et~(EN(~(2FEE8 u4VE EPEPvvWnVE 8U:w@W]Bv]PW̰EEbN(VE< uEPEPvRWm AvVE<w@W]BFUPWTEE;Es E)EEF;F vPF PvWG"FE])ÃF F(PVE@PUDP,^^(VE< uTre BsXVE<w@WBXFUPW訯MEVBr ABsE}t ~(}t0F+EFt%F F(EPVEEPUR+}tdF@;F v"PF PvWFu RvFF~ t0~ uNVD vF F(PFFP@P|+NV] F1e[^_ÐUWVS]} u{4u E #~wG4W8GDWH VF|\u|\FVDP|tt@S8 vtP t~t VF|\t G4W8GDWHVN:D u$t| \tG4W8GDWHM!WFE􋃜SMtG4W8EU@vGDWHEUHV:/uPjFHPBPGDPEPSB"PjFHPF@PGDPEPSN% u7GDCLGHCPE CujSFUt xM Su㋃FM;t(jjS1uCjS1e[^_U WVS}E EtEPSWEsssWbuz}tjsW#ou_sdvEtEPSW vEssVjW׺ u}tjsWnt FGx9u1e[^_ÐU}t}uրw EGSW蚪Ph kjWe1E9uF뙐E;EuNuE;EruE;Er͋EGLEGPjWRu j@\tT@W8TPjWDe[^_U WVS] sN{EvR贈v44%u";st;s$uENOE뱐OUJEB$EK )J C(B(E)CUtEC(S D)CC vEC(C )CC C(vRv44%tKK;st ;s$tON뾉M1e[^_ÐU WVS]}{(E 1Mx9us vB,BƋ9u9sU);{(v{(jEPjU pEP8 u(CCUWRPߛC())CC({ e[^_ÐUh@kjuÉUWVSE X4p8@1trxm}uOM AHV7;ErEP))NjE PHT71BM AHRVuuSMQ t WtC1tBEPEPjSEP: oujjMQ vKE XD1e[^_ÍvUWVS}u ^4EPEPjSWԳ u<}t?F0u ;^ 44%t[~,t9F,@ t0}t*u%=N=~,N9~,P,EPEPOhO}tOt]vSEPf}L}u.UvRs 44%tu*~,t$F,@ t=Nt =PSxSEPg}OO1ۃ}u4UvR~ 44%u}_tvEPEPe}M}UvRp~v44%uzu>UvR=~ 44%n}_u@cvUvR} 44%u }_(u<~,t6F,@ t-=Nt=PuyEPEPetbv}u,UvR} 44%tEPEPeu@}t OJ~,t F,@ u'E;F4uE;F8uF4PEP7JEFjuVXjjCDPVsjsD~jvDuF1tMFf1E܃8uPVW E܃~u3 t@W8<uvtEppU܉V(:.tD} uPwÍ@WBXPWGP$} <;G,uF(ON1 M A1 uhp F1tE H1FU BF1t FM Au 몋E܋@EF1t }u]Uu F1Mt=jEPjW s} 0Et EEFN1>[t>]t >ZjEPjW #} Et U]8tb}uM܋AGE8~u0 t@W8<u txpUHjP|>zjEPjW ~} ;Et MEFF=w%1tZFPFPWN1jEPjW } Et EEF}tFU8t?M@u4wÍ@WBXPW藄PhqEةt1jEPjWuu} t6Et UEFMA*Wu>}t1r}t'h+qjWGWd1e[^_ÍvUlWVS]C0% u2}uEPSEPjEP tz}u M eEtEEEC1tCEMc1K1:Eu~K0 UBLC4C8UMQLJS+ȍЉЉUC8+dMH U BB BBTLt:t DžP~<DžP$PwP@MQ]BPSEP9wPPwP@MQBXvPSEP!wPURlXЃ]SllЃ|xSl Tu'Dž\] C Dž`CHtsE @ \M Q`p]t @S8<u! E ud9T,MI8d]U ;M yA;A:AtY\A`RB\Dž`\U J `ZpEt @MQ8<u#v] ud9TTUR8dCDžXDž\Dž`Mt @Q8<u|] l\;tpPp u~@uuMt@Q8 ]Et'4@Uz8X14Ӊ)ZX]1)APwP@MQ]4BvPSEPsXT9Xs\\;t][8dT9X\U J X+T)Ɖ``Zp\;t#pPp @uyEt@MQ8 ]Et'4@UZ84X14X]1)APwP@MQ]4BvPSEPyrXd9Xr)XMI8dOt\\;tXt.\E P X)Ή``Xpv\\E P @}t#M ];CLu\9CPr d;CPsDžhHUJP+\Ah}]8DžDDžX\;ttvpPp @Mt@Q8 ]Et'4@UZ84X14X]1)+`XNPwP@MQ]4BvPSEPqp+`X1ɋd9XrouX))ƉE XXX5] SX+d)ƉCd9Xv DžD\] Ct\hh]u DU] +؍ЉЉU]tX)EXH]Ut@ӋS8<u*vEtUuTu]H-HtK]v;8r#)PSEPlXЉ߃ Gsv>;8r&])PSMQlXЉ߃Pw"P@MQBX`"vPSEPMn`r BGs\Dž`\;td9XPw$P@MQ]B] CvPPURmM A] CCtHC<t_XUB5>;8r#])PSRlXЉ߃]S0r BGsd9XsURllЃU9v!)PR]SlXЃ|xMQl1[^_ÐU,WVSuFE?@PV~EEPEPVU苂pЋ ;}t @V8<u  t{ v{;t}u3V~tzj+ЍЉЉPVU苂3hgrj W PWVU苂XЃ;'uuVU苂1e[^_UWVSuE{~ w tOW?`\*`ǃdjtPEpPlPVpЃ EPu VXEjF@;F4rF4HPVЃ uEPVXЃhPEPVpЃ VlЃhF@;F4rF4HPVЃ Tv`D`\u3`u*jF@;F4rF4HPVЃVlЃ pl\`jEPtM))ʉ)ЍxM)щЃ=GEUtxdu ǃdhF@;F4rF4HPVЃjdrPdVXЃ hF@;F4rF4HPVЃjVЍe[^_ÐUS]SjC@;C4rC4HPSЃCjSЋ]ÉUWVSuFEt1EurPE urPhrV茣Vw EPEPVUpЃjF@;F4rF4HPVU􋂐Ѓ VUlЃ} t@} ЍXًF89vÉكQU RVUXЃv1ۃ}t?}ЍH~8G9vC)QURVUXЃuuVU􋂐ЃjVU􋂘Ѝe[^_ÍvU,WVS]}E@EUUEu UTt2EtUTPdЃ ETUu3tBjR EPP9} ujjURU\ЃSWhr+} ujjEPU\Ѓh?EUBjREuWSU RP vEPEPEPUpЃ} uWSjEP`$|; uOUz4uEPjRd vEEEP8JUE샸Xt]UXE;EvjhrPEP/jhrUPEPjhrjUR U E쉐PޅhvRCv44%tFOu΅.E싐X:;EE)Ѝ09v4vR8Cv44%uK9w9uEU+X<]SvRB 44%tKύv7EËE))u)~|.uK)PVU REPtjhrjURrUBTu,jjjRhuUBTu uuuEPUЃjEPUЍe[^_UWVSE@xUtMh}EPj URh+Mpu EpvtXpЋM;A8v A8)ЉptXNMy4\uljA@;A4sH UB4PMQxЃMQxlЃ MQt\Tt\M;A@ut\Tt\tjjURyjMA@;A4rUB4HPMQxЋt\TUBTjjjRfuLMAT7tXUB@;B4rMA4HPEPxЃ} ujjMQx\Ѓ}M`EdpJl\d u wÍ@MQ]4BSEP3`ƍ>;`r1+\P\RMQxXЋ\wÍ@MQBXSEP_ƒr BGsdl2U9v!)PRURxXЃ} ujjEPx\ЃMQxlЋtǁXpE)EhSEMHhu(tXP|PURxpЍH[^_U,WVS]} CEXt*jhrPSdžXdžPt$CjSЃt,ju\wHugCTu[jjjSpcu CTu<%t PWS PWS?tC9t@t jjSU\Ё\vWE\;C4s S4)‰EC4Edž\džXdžTEPSdž\džXdžT1e[^_Ut! @V8<v E  UVLM;sFP;EEPEPEPRVr[ t}=vFPU;E؋+~PG;E91ۃrGEMM؃ wEč@V]BEPVKNÃsK}wEč@V]uDjVWjS=1s8tAuuȍe[^_UEPE PjuSO }t} u}t E1v8t0@S8E 0Ut @S8E v Mu uE1t@S8<u tE}M}UEBU un}uht@S8E Mt"@Es8u܉M14 1E)/v}wE؍@S]BEPSgAUUEǃ}u;{8r} u1E1s8)U+{8M}vM MMUEBU uo}uit@S8E Mt"@Es8u܉M14 1E)/v}wE؍@S]BEPSg@UUEǃ}u;{8r} u1E1s8)U+{8}}t}u C5E}t u+uM1Ee[^_ÉUUM }t"EPjjQRLu$}tEHzTtrTQR v1UMY;s8<}F}t } u1+s8mu؃mMUAM ur}ult@S8E }t&@EC8E܋E؋M}14 E1E).}wE@S]BEPS3=;ur%U+UU;uuEH9vOKvEBvE؃}u)M;K8r!} uE1s8) v{8)}؃mEHe[^_UWVS} ]Eut u$ujURNu uGM;8U;8tr t?n.vMQt]ujjSrV}uEC]ÐUWVS]} s{4uSlnEPEPSpЃrPStЃjC@;C4rC4HPSЃ SЃuuSЃ s1e[^_ÉULWVS]}u8uit @S8<u uxu-Gv;ujSԄЉUȋCD;C@M;K@s}苰SumrfvEPEPSwu}u1t @S8<u' u}t}umsujjS1 jjE PS0vEtEPSStE}y8u>t @S8<uQ v uCxt1S7PCvjSMQW+wFvjSEP=ƃC;]s;uve[^_ÍvUWVS]u CE{4wjhujSIWjjS迾{4}t vj@Pߞ‹ujjSEIu CL@@CD;C@ЉUC8F8E}uVEPSnu7U)‰ЍЉЉ@9s uE}toC4)F4CHFH{4F4CHCFE9Cu UrC0sV4C@)Ѝ@PRRܖ5~4C4)C4CHFH^E9u Ep p3{4tC4HC@~4tF4HF@}tj}tF4)C  G 49 v 49=u  ]STSc @uSP=}EPj$EP1vWw 44%u_uEPW8G~WvEPbEP`=uAwPv 0  ^uB=uAwPPwv 0  E vE[(E,_=,_]40_=t t u 1uvWӃt VWG~݋Eԋ,_װ H װH)‰УuAw*PQu U  EԸ,_Uԃ<\u?t6=uAwPt 0  =uAwRt U  -=uAwOPvt 8  ]u \u?t6=uAwRt 8  =uAwPs U  E܋EܴfE܉EEڴfE1]EE޴fEރEPEPEPEPSV}=vVpv44%t&SvV]44NvV 44%t0SvVi< 44PFuԃ]5}]SSP=vV\v44%]SSV vVv44%t*EPvVz:44*EPvV0;v44PEP2%Ce[^_ÐUS]P;P|6|ȋP҉PP;P}PRp ¡P HP @w$y ,@,,;B~B]ÉU=(v`=(T=(tH=(t<=(t0=(t$=(t=(t =(u5(A=(u@;(j`=(thXyo(hÐUVSu@ D=|= ~== }4FP@#FPÃC)ƉPDe[^ÍvU WVS}u 19}!v;@ 4C9|e[^_ÉU WVSZ=( pơx)=$}h k= uhR; }UVW2h ) C; |.vVW h h C;$|T(5(9((e[^_ÉUvh ~=(t=( t =(}US]=( u=(t h vh =( tċ]ÍvUSEU ] =uheyl (C,j'=(thyy~lC PUh H { t h2C ]ÉUWVSu} 1;^}T؉ىTC;^|FG[^_ÐUWVSUM 1E;x}.;sGE;x};r];{};u L1Ӊ΋E@;x}!ULtGӉ΋E;x|[^_ÍvUWVSuEEFEU;BM ;A];E Mϋ];v]ߋT~TC]hUM ]؋};s^TىT7v^U}TىTG}N] }D DG}FEU;B}@M] ;KG}$^U}TىTG}FE;x|֋UM ;Q}-v^} }TىTG}FE ;x|[^_ÐUVSUM u1;^}:;tC;^}-;u;^}!N;^}DT ىTC;^|[^ÐU,WVSE}ЉU}ȉME}] ;{}Kv]D1EC]9|EE};G(_$UM; uf} G;DuZD 9EuPD 9EuF1U<FM ;q} UB$T8D;Du;tًM ;q1EE};G(sUB(‹M;A,|1|A,9}]C,}G,Pw$hG$UB$M}<U BP ‹MA$TA$P} W UB$ML B$UT MA$DA$DA$D1;wP]]}<}EEvU ]C <T}t @u vt}t ux}t @u t}t uYuP}t | v t}t u1u(}t | )v t!}t u t }G$MT}_$M| uDU G D 0vM ]C <uC$UDC$DF} ;wE@(Ee[^_ÐUWVSU BP-E1M ;y}EGU ;z|1 EEM A <<<UTEUuMQUTRPEM<tOU}M A w6$y&EU} G0};|}/אUЃMQVSUEE H0U;T|ԿGM;y}We[^_ÉU\WVSE UB4BPE؉EMAPEԉE uFPlE̋FẺEFPNEЉǃ FP7EȋFEȉEFPEE E;F}UċMBUċu;V|UBPEjMquF0E E;FUB Mċ$yvuuEE7UBEMMu1;_EEURMA0PEPEPJU މMME;|^|&vUM܋UBH މMU;}݃ދM܋PދMA04EދMA0M ЃUB0PMQC;_AuF Uā< >MA/uFEEEGu1;_UUMQUB0PEPMAHEމUUM;|^|&vEU܋ ɉ UBH މMU;}݃ދM܋PދMA04EދMA0M ЃUB0PMQC;_Au~t UBB MAEEu~t GG:vGuƋ_KxvMًTމTKyGEGG1u~t=~%/MAAMGG1u~u~tUBU{MA UEuā<%EEEEU2M1BAEj/‹MA0EċuċE;pgEUċM;Q]uF }ā<~<t <~nSUB0MčPuVSeN0U }ċD;B}BP4‹F0UB0MčPSEċuċ};w\EEEċU;B}-]S}ċu<7WVsEċ}ċE;x|փUREP1E;u}3M]v}ċD%T09tEċE;C|֋UB,B(jMA$jVEPQ uVa}WU EPFUR: MQ+uV ue[^_ÐU(WVSDž=DžddvdPi44d%u d_uhdQdd~hPPCDžd] S$ӋEEd;tx\vU Dd ؋\u F <w\W4V8M A <\SPdu V$}| t|# u\PP] S$u| t@u7u/Dž(( ! G(v苍] S$u| tu8u1Dž((!G(v拍E P$]| t u8u/Dž((C~EUz8u R11] EH@UE4CtP?e[^_ÐUujQÍvU WVSu Ѝx];tWVS3u C;u1e[^_UEt PUVSut%1ۃ>t4}C<ue[^ÐU WVS]E P$E uSEU 1;t vE P4uvG<u1v<t,4U RuF4O9uPSDÅt"E DU R1e[^_ÉU WVS]t} tjPƃu1~;tq1PE 5{tC:AuB<t: t9v׃PAP2utWSVoƃtC;ue[^_ÉU WVS]t} u1:1FE <t(װHPRS ÃuΉ؍e[^_U WVS}t} tj=ƃu1VEE8tpv1U :tTE 4UE4uÃtSVƃS' StGU <uEEU<ue[^_ÐUSUZJB 2]ÐUU؋B 8t"Mqr]؉CUԋB 8u M؋A]sEpU؉BB 8tC 8tPr M؉A m]؋C f|utq~VzFVkN VFN VF@BAjv 6d tEEU;B}tMj 莹ËU}PmC URPnMATCYTuE]E;XY]44` tQtE t 6EUM;Q~VԹe[^_UUM :t9u B:u1ÉU,WVSLEPU=_}99E+EU+U9~@U19}.E+EU)‰UM}UF;u|U)U6}+}}19} MEU<<F;u|EEU9U~ }9h_+PLP[^_ÐUS]_PL@hzxH;-uDC7;+uDC$=HtD vD؋]ÍvUt>=u]E"}u]EE vEE;tJ@)PR3$u؉+@;H9u]UUE}tR}uL=_t_M 41hzhpI@װЍD@Bv}UU_>Myt F5d$=_tT_U Dx-uM12h@zhpH*E0_U DP2hzhpH@߰ҍT@UB #MyE9_}_U d_l=_t_M t1hzhpNH@߰ҍT@UB _?M9:9:/@װЍD@}tMU Ex,UB v}t1_M x-t @PEP=_tU_U x-u5@2h{hpXG+5@_M P1h {hp+G@@{__?.v@@PEPK¡@8u_t:uY=_t<=HtPU 2hA{hpFPM 1h[{hpFã_?:Wz;EEEE@8uVE9_u@=_tPU 2h{hp Fã_?M9::_U d_5d5@F>t>=u]E"}u]M؉M vEE؃;tJ@)PR3t u؉+@;H9u]U؉UE}tZ}uT=_t_M 41h{hpE@װЍD@_?}RU܉U؀>tcMytF5d=_tE0U 2h|hpD@װЍD@?UzM9 _}_U d_`=_t_M t1hzhpD@װЍD@?U:: :@װЍD@}tM؋U ExtP@ 1vUB @Wz:z:u@8uedd@8uMM9 _u7=_tPE 0h{hpCã_?U::u:_M d_@Íe[^_ÐUjjjuu uÐUjuuuu uÍvUjuuuu umÍvUS]E t'P+PS5h}hp4BS5h}hpB]ÍvUu ujfUS]Stujh~v]ÍvUSE] tSPe vS跫tujh~e]ÍvUU:t< vB:u5dt‹E 1ÐUVSE] (J9wA;tR3ɬ vRt15(օt ()É1e[^ÍvUWVS]u=(t8%(~15(Ut ()lj=(u蝮(E= sE UU15(хt ()EEE U9r6%(~;u!A9rh Pujh~=Dt+h~S@ujh~$FPSWt %0h~=uF %f=@u1=DuF %f=} t,0u]EP)PSЉƒt9u;}vE8Gt;Uu=Pt9sEPWSue[^_ÉUWVSu] pEURSV+ctl=ucMA %f=@uQ=Dt5@讨 VtL0SEPSx|111ۃURju18u =t05nvE=Hu =Lt =Hu:  $)P1}uP5 natE}t=Hu 1ELT )$9vM8KtK9vE8Cu5$)9s>SRQǃ=t SVt=t =PX1ɉ; `}C; v;;tEA EvJ;UvE8Bu; `}; v;u;t )ӡ  $))x|=Xt REPSu18u =t05{v =t $)‰9}tH$M$5$ )Pǃ=t5$E))LLЅEtt5hC~Kbe[^_ÐU WVS}u1[~vjWƃ8tޅuN=uEE PWt0W^XE PWSF=tuك=u7 t u-ĉE PWuU B %f=@tSW덍v=E PWV0Ã} v=ht9=Tt:P5h,~`Shl~`؍)9lu P5h,~`=Dt5@螣.t*VϦt;8t.0W؍e[^_UWVS] EtJB;CutqӃUDPEPlEURPPUE/ VEEP1ރEPUR!E >uT=puHT}tEPښUR˚Eh[^_ÐUS]t25h~hpf/5hhpN/}5h@)^5h^ h ^h] h]h] h@]h] S?vUS]=ht%S5htjh@h]ÐU WVS}1a=atKv4W躺uaaFva<u1e[^_ÍvU WVS]u 1vvRĈv44%@tCύv;ugv}tE4G/vRtv44%@uCF<\u ;t FC;uF_ve[^_U WVS}}P3EjREPU: ËU PƋE U2VEPUR4ue[^_ÉU,WVSE t+j/PLtj/5L@8zuDEEEp `dEEh_jE PEPh`P $@MTBЉUUv=dhd5dijhZ=dKh`5d-jh=dt/EP5djhvEh?h3h'E5d\qLhWv5du.5du5dujhË=dӃU\sVMQE5dEPؠE u zdƿދth~P^vu05d*}t E@9vSUR]E}EC9EuSMQ:EF u!VE@)‰PjEEPxt V$;}ME|  AMzpixYLl5LlXLvtPtlDp5d|u He5d|u HA5du Hjh j~jh_h@|u u>ƒ =d}Ed=`}E`=hu h=t^h5hh zUhmU h@]UhPU h@Uj›=t j}t}u 5PGvM?v_;U}%E U_װHE jJ5hJuh76uURMQС_U)‰Ѓ~ =pt}t T_;E}WE_U h޿ދ1t 1҅tR!E__;E|hjEhZu 0h1~^=uEP%U WVShHÃhxh`U jjS"C, ߉ދC S)‰Ѓ }j S.F y9y uI(AA Q!ЉA Q)ЉEq)Љ9U~q A A{0tgC0@C0@C0@ C0@C0@C0@C4C8ǃ<ED S1e[^_ÐUWVSEEP0UMM Mm]]}Љ}EDtMMDE M]]ExEEEtTU:W tDMЍUE<]:_ sE?E@Et]:_ uÅ uC S)‰Ѓ}jQi{ q9q uI(AA Q!ЉA Q)ЋY)׉9~Y A AtyGuC S)‰Ѓ }j Q C q9q uI(AA Q!ЉA Q)ЉEY)Љ9U~Y A Awu `GG@GUPG@ G@GJAHG@]_ G MEU<u M8]Ux}E‹Mx u:u]ЉЃ<0uH M@ MsUMЋ x t̃}WE]<u UH u"EM<*]@ UM@ tCV)‰9C~C[uv \G0p t(VF;B~BFF;F~FFv u1ɍA~PG0p'Dt)1ɍ<vA~)v1ɍ<2A~ꋗDt$1ɍw<1A~v1ɍ_<A~1[^_UWVSEx4u E ;}u"UR<PM QEvp<<UJM@EM 9EE EEG)E;MvA0A0хt`A0A0A0хt>A0A0A0хtA0A0;MvIA;Eu79ȃUC9)؋U)ڊ:t9tM4U UUA0E)9fEEA0uEA;Eu99(ȃU:uC9)؋U)ڊ:t9~)UE)9~1e[^_ÉU,WVSUEE;P4>M<ME;uw9t>vMƊU<t;urFNU<ue^M>v}tK E܊ K B:H sv@t:H utP:t]Uz;] w}uE)971UUE+EM;A8~ EA8EEE)FU<uu^Mtc;}tK E܊ K B:H sv@t$:H utP:t ;]w]Uz;] w}KuE)9m}tU U EBUBMAE[^_ÐUVSuU E]~,u2Du)PRV…ttSF4C SPRVSe[^US]1PRS脀]ÍvUVSuM U]uu^EF JVf(F(t Qv$ 6FЃFÅuaЍCFF FCf(f(e[^ÉU WVSuM U}]uu~EF JV^$N(F(t QS 6FЃFÅuaЍCFF FCf(f(e[^_ÐUWVSuFEFV )‰U] \d;}F(t Sv$SFЃDžuaЉ~EG;FF@~1MIx FDIyE$URv$F Gv1;M}WFA;M|E9FuF(uUBGF(uRF ЍGFEF f(e[^_UEU v@t9s9r%ÐU WVS]} S&rC(t Rs$RC ЃK(t9s9:r΅t{ {CStπve[^_U WVS]} S&rC(t Rs$RC ЃK(t9s9:r΅t{ {CSt_ve[^_UE1ɋPt)RuÍvUhphqXFhpj F 5a0UWVS] uujE( uS{EuEPUUEx.ux ‹B%=.ttU+U})19 u89v49v9tSUR|ƒt[+EEUEPEPg @EURENEURuEEPUR{1e[^_ÉUju=UVS=xte1۾vSj 44%t&vSmW44؈3C~1=xtP @ujhe[^ÐUWS=2tK;t?D{HPs5@tjP#v[utFv;u7{HPs5@kt jP[u5@ct jPe[_ÐU WVSh pP5xh { h E PURft jPE=tu =lE 2PWxEM=lt=tt}f}ЍXE؃U RMQPW}] =tt}߸̏f=lt U}߰Ѝ\jhSURjhM QuVe[^_U WVS5hu(hpP5xh&vhpP5xhz h E PURHet jP=tu =lE 2PvEM=ltfA=tt}f}ЍXE؃U RMQP{] =tt}߸f=ltUfD}߰Ѝ\jhSURjhM QuVLe[^_U,WVSpEUU Uu9v=@EPE)PV5@Yƃ|E)PEPV6EuEE;uvU8VtvN;uvE8FuUE;D*EPjjRVh[ u EUsEEPjjURVh!ƋE E)PEPV+6EuUU;uvE8FtN;uvU8Vu}|%<hE)PjPVh UDà 88)߃=lu=t-vE)9=tt5TvRrd 44%uQ|_tJE)90vR.d 44%u <0_~- <@hSD;PVh Eǃ FU)9t7C%<h)PSRVh %Cá8)߃ uFE9ET1EUU9s@Ue[^_ÐU WVS}+E 48v9s: tM 9vC9s; u)PR5@t jP9sC9r5@t jPe[^_UWVSpEuU 29*ЉEvEPE)PV5@ƃ}=lt-;uv U8V7;EU8=t;]v3SvRb 44%uh{_tb;EshvRav44%u<_u4EPOWV5@Ë}tfF;u1:]] 7)PEPRX2BuڋEN;uv~ ue[^_ÉUMU vABuAÍvUVSu]u 1ɋU AJ9r9tȃ[^ÉUWVSEEEuUPU@E }}t@CE9s2E8uEPSVTu)]1u}}tQ t EH<0 uE}t8}t,EH0E8uEPSVuM}u}u[EE@PURpÃuEPp1av]EuVPctUUEUt*1}tEEPUR%ƃE}}EPUR"]ހ>E8tCF;t~U8u;tr{tl1ҊE8CuUE8CuEŠE8CuEŠE8CtE8CtE8CtUtCCFCF;o}HE} tUE Ee[^_ÉU WVS=4b4bhhu_j.hƃtGVװPRh'QD7 RD1PVH=uE D0E|:u{Xhj3P~`=)E)9wJӀ<3W<3.u8Chj3P~؀<0u )ʋE)9%FE)Pj.V-ƃt15hFPuǡ|0e[^_ÐUWVShutSIƅsjSމH j TS+DžXDžTPPSjV' u PxuuVj"jjtװHPRPppQ tPhhpujj h"ǃtPWuukju]SHju EPH jVEPHEPH j,SWu,tEURPWzWju8[^_Ív$FreeBSD: src/lib/msun/i387/s_ilogb.S,v 1.7.2.1 2000/07/10 09:16:28 obrien Exp $v uė 8b%8bUE]EÍvUEU щA uNu~AvH҅5v ~&HɅv~ U=bu?EEUB jjEPhbjRu bbÍvUU:t2v:%uB tpuJ:$uz%1Fr8$N* Q)Ѝ( Mb)‰)Ѝ) F;u=bt EMvMAMtUEEUfEE\F9~FIu`u`> gfff)Љ)‰})t<3WEPDj}=ЋUTUE)~!]EvMAMF>tFEE;&P5]}t65bEP,s=bЋUTUMe[^_ÐU WVS]} uStVWS WVSe[^_ÐU WVSEPju }+iHy8t0Pq8|B%uiPB84i@t ii@xLt@Lbi@4t 4biBxtAxt;j*BpUt@P1҅t i@ fPDiBtFt=j*Bt@Pg1҅t i@ fPFi@(t (u8iPt't(i@ǀi@,t ,uli@t[tRt u@i@t u&iP,i@ǀiP fzBu$fzt@ttBfBBiP@t"t~uZ)iBx8tCx8t=j*Bp8gt@Pұv1҅t i@ fPHiBtFt=j*B t@Pw1҅t i@ fPJ}t=thhEPQ@Ee[^_ÉU WVS}=it\5i1F9}J+~F")‰Љ)‹F vjPWu F CV9|1e[^_ÐU WVS}=itli1C9}Z&~C$)‰Љ)C"‹CjPWuC fɡpktQ.pkPJy B;B| t RQ(pkxi@DtDpkB9x|jUR9\M];upkGt 3pkh@uti@xu j=EPURpkxtOpkMt]x);VSQEPURz tf^pkh@uti@xu j"=SMQpkxtOpkutxjEP9}SURMQ]SuVvu}UM;ut tNO9~;]|pkh@uti@xu jU<EPURpkxtDNpkMtUxSRQMQEP' 9\UUM9}MCEܡpkh@uti@xu j;URMQpkxtMpkEtM܉xM)١i@t9~i@x|t6t-pk UЉ)U97Yi@tpk)9 /v?B$MQCP]SuVEP )PUDP9KMءpkh@uti@xu jd:EPURpkxtSLpkMtE؉xMC)i@t 9=i@xTtpk)9v?BMQCP]SuVEP tg]Cpkh@uti@xu jo9SURpkxtaKpkMtxj]S-pkU09ht R 9)Ppk@;E~ +EuU ]PRQp1e[^_U WVSi@xu xuxtpklt40u+hDT jjhPZi@xui@xtQpkU09ht R*8i@p~pkǀxǀtiBxpkǀxǀth@u tBxu j7jjpkxtIpkǀtǀxU09ht RU7i@p}i@xpkǀxǀtU09ht R6pk1fxUh@uti@xu j6jWpkxtHpktǀxi@p}GpkB9zpkU09ht R96pk1fxh@uti@xu j5jWpkxtGpktǀx1fxpkBH9tu!BH9xuEP<v]i@xt }~u0ۃ`pk09ht RJ5ɡpktQ0pkPJy B;B| t RQpkxi@DtDm{pkP9x|Fpk@9GpkB9kpkh@uti@xu j]4jjpkxtPFpkǀtǀxpk1fx~Ev1fz~*dk@(M Fpk@9|GpkB9|e[^_ÉU WVS}u iBhDT VVBXP?zi@xt ~u0ۃ`pk09ht R@3ɡpktQ.pkPJy B;B| t RQpkxi@DtDeyN@Avi@x|&p|&yvi@xt ~u0ۃ`pk09ht R@2ɡpktQ.pkPJy B;B| t RQpkxi@DtDexi@tCxNi@ x vi@wi@xt ~u0ۃ`pk09ht R1ɡpktQ1vpkPJy B;B| t RQpkxi@DtDAwi@twNe[^_ÉUVSuiBt'hDT VVBTPv$19}i@pTvC9|e[^ÉUuvuU WVS] uM}xiB99Mpkh@u tBxu jp/jEPpkxtaApkUtǀxU09ht R /hDT ji@>}iBxX9Mpkh@u tBxu j.jSpkxt@pktǀxU09ht Rg.hDT ji@pXiB99Mpkh@u tBxu j-jEPpkxt?pkUtǀxU09ht R-hDT EPjPi@iB9Mpkh@u tBxu j8-jSpkxt,?pktǀxU09ht R,hDT URjRi@NQP}siB99Mpkh@u tBxu jd,jEPpkxtU>pkUtǀxU09ht R,1;}hDT ji@rG;}|iBxX9Mpkh@u tBxu j+jSpkxt=pktǀxU09ht RI+1;}}7vhDT ji@pXqG;}|vpkl0i@x1;}])pkh@uti@xu j*jSpkxt<pktǀx1fxpkBH9tu!BH9xuEPv]i@xt ~u0ۃ`pk09ht R)ɡpktQ1vpkPJy B;B| t RQpkxi@DtDppkP9x|8Fpk@9G;}l1e[^_ÉU WVS]uM}iB9u 9pkh@u tBxu j(jE Ppkxt:pkU tǀxU09ht Rp(hDT ji@O}iB9pkh@u tBxu j'jE Ppkxt9pkU tǀxU09ht R'hDT ji@viB9u 9pkh@u tBxu j<'jE Ppkxt-9pkU tǀxU09ht R&hDT EPjPi@iB9pkh@u tBxu j}&jU Rpkxtn8pkU tǀxU09ht R-&hDT EPjPi@JPliB9u 9pkh@u tBxu j%jU Rpkxt7pkU tǀxU09ht RT%1;}hDT ji@kG;}|iB9pkh@u tBxu j$jE Ppkxt6pkU tǀxU09ht R$1;}}7vhDT ji@kG;}| pkl0i@x1;}] pkh@uti@xu j#jSpkxt5pktǀx1fxpkBH9tu!BH9xuEPv]i@xt ~u0ۃ`pk09ht R'#ɡpktQ1vpkPJy B;B| t RQ pkxi@DtDIipkP9x|pFpk@9G;}l1e[^_ÉU WVSu] }i@uxXti@uu *vpkh@uti@xu j!jSpkxt3pktǀxU09ht R!u$iBxXthDT jBpX6viBt.hDT VjVBEPg-v19}$hDT ji@pXgC9|ޡpkh@uti@xu j jWpkxt2pktǀxU09ht R u.iBthDT jBgkiBt*hDT VjVBDPf/19}'hDT ji@fC9|1e[^_ÐU WVSu `k i@xt ȋ@% ‰U}RVjEPU RMQǃ i@x I}u ui@tRpkE9tt H9tu8iBt&thDT jBehDT jURM Qi@p ]CPet%hDT ji@hevpkǀxǀtEPURM QRQEPǃ hDT jVji@p BPdpkǀxǀtu5pkFtURE+E@PM QEPǃi@xux 9uy9uiBxtx]+]pkh@u tBxu jjSpkxtu/pktǀxj v1;]u)ޡpkh@uti@xu jjVpkxt.pktǀxjj ]C;]|\vURVjMQE PEP_ǃ i@x 2} tTpkM 9tt H9tu8iBt&thDT jBbhDT jEPU Ri@p t@Pbt$hDT ji@bpkǀxǀtMQEPU RPREPWǃ hDT jVji@p ?Pbpkǀxǀtu9pkFt"MQE PUMDPPǃi@xux } 1yE 4pkh@uti@xu jjVpkxt,pktǀxjj CE9{t>UREPE PMQ5dk*d EPU RMQ1ve[^_ÍvUpkǀhhk@pklu"i@tU`i@t `i@t`i@t_i@t_i@t_iP\t3`t*@xt \i@`Ph_ÉUÍvUpkht jpkltt0ukƀ0hDT jjj:pkƀ0jpkBHPxtF*pkPJtǀx jj ÍvU\WVS=pkt+pkdujc9u{UuVjV jV]SVj+` jSǃu'VjVH jVj_ ]SjS ujSjEPj_E]ȍEP^E uVSjU_jdPc jVj5_d'TjEPj>_e[^_ÉU VSu=F]EPEEjSV^ lkty=pkt=pkxt2@@P\tpkƀpkǀDT S =pktpkǀd|uj=Ulktƀx|uÐU$S]EPjS]u(}t u}uju S]1]ÐUSE=uhh=tjhjb]h? Sj+   Sj Sj4  Sju ]ÉU WVSEpkpkpipkB dkB$hkB(`k$d,dbD؍e[^_ÐUS]t!3s S]US]lk=lkt=9lku|lk(v||t9|u狃||s Js$J s(Js,H s0: t P(t(6ttsg{t0{t*sBt^8 usS;pku<dkhk`kddpk]ÐU1ÐU1ÐUÉUÍvUÍvUS]EjEPSƒ}u]v|i@ HЙE E8t8;tEE8t8;uE8;uEE]ÐU WVSu]E fEhj诙pkpklk|lkjVPpkiPfXfXUfPǀtǀxǀ|ǀǀǀfǀ\ǀdpǀph pk %Ƃ0pkƀ1pkǀ4ǀ8h3t?h3lƒpk4PR*ƒ pk8PRpkǀHǀL ǀP ǀT ǀX, ǀ\4 ǀ`ǀhǀlǀpi@ fx~F¡pko@с<i@ f@i@ǀH=pkDbpkƀGpkƀFpkǀtǀǀjjEPPmGhkjjEPPKGdk_pk hkJ$dkB ǂd Adk@1b=bx}ۡb8};jpk@)PuVSFbHVQ@=jjEPSFbJEPQBСpkfXpkf)Xbb Gb8t 6bjjEPpk@iPF‰`ktpkP(J K1e[^_ÍvUUu13=bs bU P@b 1ÐUUu1vu }PU=pku ,pkǀdP\JU WVSpd+td+ld+hd+d+d+d+d+d-d|xd+|d~d_@d+Dd:Xd'\d#dopc<lc>xcvtc^`d#dd#c#d-d-d<d>d*d!dfi@ltlQi@Htw1ۋHЍx9sZ ibvAH}u8d9uEdt t vtE PEPWR)}cd@t3iBt!E PjBM%d=diBtE PjB=pktpkEt:t2iBt E PjBM=pktpkDt4t,iBtE PjBLd}u }d9*}tEdi@ uU RjEPEPEPEPEPEPEPEPEPi@ )0PKd}u }d9u*}tt Edt t~tE PEPWR '_v@t2iBt E PjB#K=pktpkEt:t2iBt E PjBJ=pktpkDt:t2iBt E PjBJt:iBt(E PjBKJE0 d}tKu}tAd9u#}ttEdtttE PEPWR%@t&iBxdtE PjBpdIt&iBxhtE PjBphI t&iBxltE PjBplbIt&iBxxtE PjBpx4It,iBtE PjBIt,iBtE PjBHt,iBtE PjBHt,iBtE PjBdHt,iBtE PjB0Ht,iBtE PjBGt,iB tE PjB Gt,iBtE PjBGt,iBtE PjB`G t,iBtE PjB,G@t)iBtE PjBF}tM =pktpkUh Ed1e[^_ÉUhDT uNU1ҡi@xdt@i@xhti@xlt i@xxti@ti@ti@ti@ti@tpkltÐU VSEu u @BZEÀ;);${<j>Sc;>@EHˉ=w%1tЉEE\;*u uEI;.uCC;>t==w%1tЉEE]EC;>`]pku @ pkۀE]C;E}fUf fUm]Eme[^ÍvUSu uk@BtpkIșȋ]ÉUiBx t$pk@HPjBp !PCÐUi@xptppCpkǂxǂtptpǂpP=ÍvUS pki~_Й pk ǀji@p4¡pkji@p0¡pk ji@pH¡pkji@p8¡pk ji@pD¡pkji@p,¡pk ji@pL_¡pkji@p|=¡pk  ji@¡pkǀiBt#jB¡pk pkiPB(uB<jjjpk P¡pkjji@PP¡pk jji@P¡pkjji@P¡pk jji@NP¡pkjji@p P¡pk jji@PK¡pkji@p¡pk ji@p¡pkji@4_¡pk ji@pT:¡pkji@¡pk jji@P¡pkjji@P¡pk jji@Pv¡pkjjj i@^PA¡pk jjj.P¡pkjji@p P¡pk jji@Pápk;~ڡpk9~ЉiBtExpt?Bpp6Xt$i@ǀi@ǀ]ÐUjpk@HPjjpkpt j7i@t<j ><U\WVS] EDžDžUREP9]Dž@BiBt:MQB@P}Wb tpk9]ME)؉iBt`pk9}MSBPEP}WP tpki@x,pk;EPMQbpki@1@,ǰHË;BkKdQWu7+]iBtZpk9}GSBPEP]SP tpki@xLpk;EPEPpki@1@LǰHË;Bs*K~(QWu־@B@BUEBEBEM9MDž@BiBx tG]SBp )PEP}W$P; tpkE9EU)‰iBt`pk9}MSBPEP}W蛿P貿 tpki@xD1hPPc~g;}YuPuGpk@$P(MI]%=w%1tƅ1;}c pkA$P(][U0;hvF;}.pkC$H(URU0;htƅtp1;};MI4pk@$@(Uڋ0C;|Ӌ)pkpki@@DǰH;s+N~(RQ臽uֻ@B;PEP]S-PDmb}+}iBtZpk9}GWBPEP]S蹼Pм tpki@x8hPS/pki@1X8ډװH;s0v~"SPuӾ@B;}-PEPUR»Pٻt@Bu@B [^_ÐU,WVS}u;}u 9u u1pkP9|әM֋ pkA9E ] CؙA9C)‰)iBthDT jB4+ xhj -K} ~liBxthDT jBp3< y ;0|vhj E +pk@H9~ǡpk@H9E~EDžDž@BV]SpkPhPEP腹P0 tPpk} ~'@9})yډ+E yЃ~} tNjV]SE PWhEPPaƒ @Bt;}Džtgi@xtYjVURjWhEP軸Pƒ @Bt%pk;}Dži@x0tZjV]SjjhEPSPƒ @Bt%pk;}Dži@xHtcjVEPjpk@HPhEPP)ƒ @Bt%pk;}Dž} ~ pk1ۋiB8tzxut~pBx8tgjVURpk@HPGPhEPGPƒ @Bt'pk;}DžthPEPŶH $PvjV]SE PWEP i@p]S%jVURjWvi@p0]SjVEPjji@pH]SͶjVURjpk@HP} ~i@pEP?i@p8]S%jVEPpk@HPGPS0@BthDT jP.1[^_U=pktpk4vÐU=pktpk8v1UEȠUS]M iBt%QjSB P@.4QjSPi@ P .]ÐUS]M iBt%QjSB P-4QjSPi@_ P-]ÐUi@t +i@u1vi@-ÍvUWVS<t)hDT 5PhDT FPt i@ fxpk iA @,djA @P>n¡pk(t|ơpk( fi@ fx|Fpki@ @$dǂl@P¡pk u i@EhxtE1;d=pkiEdUv# [uTfT [ ؅}C$)‰Ѝ@UUDfDuFxt [fDBdN [f<tf [f|tfD [f|tfDC;]*1e[^_Uft7vf}|E;d}f|;d}f}~M% MpkU(f%tukF $]]EEE|DžxDžt1E%A>vXwD$AuGA}tE Ex1TGEK}u:@=w%1tTPЁ'~EGA?ta}t%1DžtDžx|%AA}ttxt;x}xU]l $h%@;v P, 1҃=~ Dt@=$ӋUD;v PmSWd=~& Du@t@װЍX;v PSh"vd=~& Du@t@ $pl]װЍP9~ڡD;v PplRpQP=װЍDFσtE܃<t$=TƀDzESF<w;1҃=~ Dt@<1҃=~ Dt@@F<w<F=ƀD@FF1 \BF< v= ƀD@1҃=~ Dt@1Ƀ=~ Dt@1҃=~ Dt@1Ƀ=~ Dt@)щmv1҃=~ Dt@1Ƀ=~ Dt@1҃=~ Dt@1Ƀ=~ Dt@ȅtә11҃=~ Dt@1Ƀ=~ Dt@ȅt љF1?11҃=~ Dt@ta.11҃=~ Dt@u,1҃=~ Dt@t=ƀD@d1҃=~ Dt@1Ƀ=~ Dt@!+1҃=~ Dt@1Ƀ=~ Dt@ 1҃=~ Dt@1Ƀ=~ Dt@1{1҃=~ Dt@1Ƀ=~ Dt@9v1҃=~ Dt@1Ƀ=~ Dt@9v1҃=~ Dt@1Ƀ=~ Dt@9`1҃=~ Dt@,1҃=~ Dt@҃=ƀD@}uE}E1҃=~ Dt@ulF1 v>tnF>th>%uF>?u@v>;u~?H؀>euӅu1F1 v>t2F>t,>%uF>?u@v>;u߅~H؀>t F> =ujjxUu1vH[^_ÐUS]{t SG{t S=]UWVS} ]}E@8Et{U9Z0u 9z4|f|b}tMATS}tMA@980}t UBT8W}tMA@9 ~kEPUZ0z41]/MI(Mv]E@(EUMً]GF}tMA@9||1e[^_ÐUUE uB1ÐUWVSEx8ǃ8G8EEGuoW(UMI4\2|FG4@MQ( ET0G0fytA9~fYfytA9}fQEG9E~88q[^_UWVS}Ex8P8URE]CEUB4]{(@ f||[E@]C(4DS0)L)х}1ۋUB9~f~tF9~f^f~tF9}fNE]C9Eqe[^_ÐUS] CC0PC4Ps8[8t{8u֋]ÐU WVS}t'UB PBPB@PB@Pƃu 1 vMAfFfAfFAfFAfFA fF AHfFHA $fF AFAFAFAFAFA F A$F$AFAFF0F4F8A,fF,A.fF.Q M1FuPV(MA(MQ44GV(MA(DfDV(A(DfDGF9~e[^_ÉUVSupkt1҅9qupktvQOF u01Fu(V([<t4"CF9~ڃv( V;5dku dk;5`ku `k;5hkuhkʋ @e[^ÐU WVSu]|u|q}|k} |e}upk@)E} upk@)؉E U ڋ pkA9*UA9jSVE PEPƃ u1}V{1;]}hjE POF([ F(<tĉ[ E 9s   F(9rC;]|e[^_ÍvUWVSM]}}} |{|wUU }G@9eG@9Y} uE@E EH)E u UJC)}G tVUB PBEPQM Qƅu1Wv}~4^0UBFBF1;} }-]v ][(URU^(EG;} |܋MN8e[^_UUB M)PBM)Puu RÉUE19uȉÐUWVS}u$EWt\M QtIjj MEt3jLjLÃtj WLC(uS躸1ivfCfHfCM IfKEfCMfK pkBfCHfs CC }uB9u B9E KCCCCCC C$CCC0C4C8fC,HfC.fCfC@fCDfCBfCF19}"u NC(IfDC(ftA9|}uGUU pkA9u3K }uA9u }uK EpkR9uK pktMYt؍e[^_ÉU=itui@(Pt1U=ituji@(P覽t v1Ui,P}t "i@0t@ǀ1ÉUiXP5u i`\1ÐU=it]iXP0=pkt9=`kt`kx t jZpkx u jp1vÐU=itI=pkt-japkx tjpNi,PÐUh5ÍvUhQÍvUVSu] h-uqV蕟pkӉP tVii ~ pkxu-SƒtpkPS%PRV9e[^ÉU WVS}E t55pktui@x t_F1v[^_ÉUVSuU tpkt FG[^ÍvUS]C=w# pkC1v[UUE t<u B$ B$1ÐUUE uB1ÐUUtE B$ÉUUE uB PÍvUSM ˋpkÉt%i@t#ui@tu1]ÉUVS]pkpw_9u t' t9evu]i@xPt/pP?i@x@tp@(i@x4u 5vi@p4pkpte[^ÍvUUpkP1ÉU WVSu] u1<C 9u,13VusVte[^_ÐUpkp,uÐUSEÄt i@dt du+i@`t`tpkx4upk@41]ÉU1҃=itEi@uux|t%ti@xTu tÐU1҃=it6i@u ti@xXu tUVS1۸d=dtKdv<2w'Pi2@4pk,PCd<ue[^ÉU WVS]EfEu >=if;tj;[{t8Cu ;빐j jCCtÉ`j jCÉ߃uGi_j jdCÃu%it9;S-u#CFuEfC e[^_ÍvUS]i@xtwS ciPغh )i~viPiЃK=iDT u 1]ÉU=pkt pk@P衘ÍvUM=pktVpkt4MjEP=pkt pk@@PEv=pkt pk@Jy B;B| t  vRQz1ÉUhDT juÉU WVS]}tu =iuEwEi@;Xt;uEEiBxuJB fx t@=pktpku)iP¡i@ @ 9|E1=w%1=w%1ttPCѐ4;.uOC=w%1t t0C=w%1uۀ;*uu C=i;;$tP]C;S&uj$׃j<׃ g1ɉ=w%1tLPCѐ ;.uOC=w%1t LC=w%1u۰;*uM C;*t;/t~1}u }ut!gfff)P;t Cyv~*}u}tgfff)P^iDT 1e[^_ÉU,WVSu} EfEUfUNEE)9|9E)EvF([URMQ4U44K;]}])9}9)E1Fu$[EvF(MM BF9~C;]|΅]E)99E)EvF([URMQ4U4蠭C;]~])9~6)E1Fu![ F(}HfCEP1e[^_ÍvUpkf^u pkf\uefǀ\f^u fǀ^pkf^pk^f;\u fǂ^pk^f`Jvpkf\u fǀ\pkf\pk\f;^u fǂ^pk\8U1UMU t A9}A(Rf|%ÉUSEt*1@u"X(HRf|t  B9~1[ÉU WVSuM ]}t| |F9~kʍ9}`F9XىMN(Ru fD fD^(R t FfD fD B;U}F9~1[^_US];dkuC^+vS'u{t hk@^C]ÍvUWVS}t E@ t UR fUMYhkQPQPQ(E` PfUfEfXHf]Mf;Hhkf;XE@R(<E@MQ(Efxty@EE9E~EURfUu‰;ELUދ;t,fu fwfwf;w}fw f;w~fwfEFM;M~MfAfAfEfEUEf;PhkMf;J)Ext @hk@Uzu"hkRMffQHfQ fQfPhkMAB1e[^_ÍvUMMb)‰U)Ѝ))ȉ)эEPjP|1ÐUSEiit6fii@t i؋]ÉUS]t*SQS;iu i1]ÉUS];@u D>|.19u Aw9u닂D[ÐUSE|/19u Aw9u닚[USiXP败ÃSfi=it i؋]U WVS]3{C @tf;s}c C @u f;sf;{~ bvS_Eƍ@S(fztf9z~fzCfBNj C9w U9vS1e[^_ÐUE@ÐUEM P u@t0 %v@0t0 Љt0  ЉÉUWVSuE @u#ۃSuEx^M V uFt0 "F0t0 Љt0  Љ@V(fzu fZfZB9}fZB9~fZ CF9~BN @ff;F.~$F.fFfF~jVfFDvf^8vFEE t*  E=ii)E~u F.9Et F9EE 0 EF;Ev}ӉV uFt0 #F0t0 Љt0  Љ@V(fzu fZfZvB9}fZB9~fZri@(P~tYX EPhht@i@(PY} ) 8u  8tʃ;E>E;~>(i@ fx~f8~@i@ ;~> PiP fBiP fi@ fx| @i ie[^ÍvUEPEPj=pktpkdtuudÐUVSu] j/Vt1tSPV$tSV7uE1f{tvC<}BC9|1f{ tC]vRzq 44%uh^t Sփu Sz1PEPSr=jt,jjt‹ƒujDk[^_ÉU\WVSEDž1j1jt|9vj31tQFu'01Ph/hpRG ~ 31PhIhp- u~. xxpphpj u,~1DžLk jDž;B(010‹IL,D4ƅRF[j tPR4;t-hQ30tƅu}1 EPPP!udh}Ãuh[ߍu C(Rƅu>HkRhMcZI;H(StQ 1vjNz(Dž;J(}+0Ix(A;H(|؃RQ>fx(t4Ã0B(H@4Q1TH(uӃRQ Txtp|z tr |ytq|  j1ҋfxt#A<uBA9|1ҋfxt(vA f }t}tN}ttvEF"EVUN"M^$F$ȉEFEV"F$‰U^&N"F&MF Eq^"F$F&19sCF4U R*u#F"V$9wF"9ȉMG9rEv1}E9sfE PF4ƇuE|?}+UU}t}t )}t!E,E'EvG9r}4}t_ }t}fF"fFFPv(\F^K;]VDK;]w~fF$fFFPv [F ^K;]vRV DZfZK;]w ?uv8!=8!tb5j7較uAhw"Ãt.}u ww7hn> ?u5jÃuq=jtAEP5jUR:Ãt&=@kv5jh =u#}5jh"=}M9Ku=:=ju&=j%P!Pjh:A}uF==ju/=j%Ph!Pjh=!à t}u{u E_v}Ct"t "t @HOW5jPh`<h} }t~}}Ct, t*t3S]C SMA fPvS]CSMAK]S jfJ5j=ju!CEPV5j9%ƃV3S]C \w7h ;Fw7h;2}uhq;,=ju:PEt AEP=U29P:0} =jumEj+M1RtE71ۋE;X(},j+[E,4"uECU;Z(|փEPMQ}v]SH EP21e[^_ÍvUMU u tu 9$uGyuAǍv:$uGzuBǍv9u :u1:u ABKv)‰UUtE EUEEPu6ÐUWUt#װuPu u}ÉU<WVSE UBu((t(0‹MA]Cu%,t,0‹CUBxu[B fxD~6@DPhӺhۺS^Sb0‹MAP hӺC0‹]CPUBx8B fxH~7@HPh׺hۺS0^S/‹MAP8 Lv]Cx%uh׺/‹CP8#EP4t4t 4B8MQz,0t0t 0B,i]Cx)t[C fxF~6@FPhպhۺSk]S2/‹MAP, hպ/‹]CP,EP@x&0t0t 0B,nUBx)tbB fxF~:@FPhպhۺS\S.‹MA !vhպk.‹]CUBxBx)uVB fxF~<@FPhպhۺSI\S.‹MA +hպvUBx xt~tutlh VS2MApS2 UBS2V_-‹MA}]Cxtyxtsx,tmx,tgh VS1UBpSE2 t3MAp,S,2tV,‹]CUBx+tx'u MA@]CubC fxJ~:@JPhٺhۺSZSf,‹MA !vhٺC,‹]CEP fzu@x*ufBUBxuh+‹MAP]Cx*C fxt!fxt@Ph3UBtPhٺt'MA2Ph@a3 9]CuhٺH+‹MA]C f@UB8_8Rji8Wƅt ymMA8v)Dž8t)װH9u׃SVRuŋzuVShZ2Ay3h1Ãhpƃ tuh2vSMA<u3h1FMQ<tP4C4vV]C4"1P0ph |1 fvS]C:t':$uzuvAB:uP+)V]C Fj,Vc*t4EP4u% t 4UBǀ MAxAuh׺(‹]CUB<uh׺c(‹MA<]Cuhպ6(‹CUB@t @ MADt D]CHt HUBLt LMAPt P]CTt TUBXt XuhMA\t \uP]C`t `u8UBdt du MAhhthVS+UBHS , MALjjSZUBHjkSC MA@jlS)UBDjmS MAhjnSUB`jqS MAPjtSUBTjuS MAXjvSUB\jwS MAdjxSetbV%‹]CHh`-tŐEP4-pu"j8 9zuB9u C<u냍ve[^_UVS]1Ɋ`t$<|t `Awt<|u`[^ÉUWVSMtnv9tf] AC;t:t19t0vU:t:tB:t :uu1A9uӅt ;u Au1[^_ÉUWS&=juzh OÃtd߰Ѓ =wJ߰Ѓ PzLjuh%y*Sh35jOj1e[_ÍvUW}twM?t 7 MtwL tw LtwLtwLt wL1 }UEjjÉUlWVSE=t+h@(O t  ǐc ƃ t t t\uG t t tƃ=:u :u ƃ.u)=ju Evƃ.t t tvV<;v44%ub.u =juTPh@u:VF$Ph@h`^' P{v=i=jjjHkjj<,uj,\u t t tƉCƃ t5uh'v:u:,tj:=juHj:UhhPh@;&v=juvK; t; t;,tCj|heÃuЍ3h%j|hƃ t>uh%uЍ9s]vR8v44%@;/Ph+茹C9rj/vVs8 44%u=ju _u;uCƃuC:t='#,t=3@t2y9t h8%j1nvO9tV Phh$ j&v1ƉvVZ7 44%t D/GNv]jEPS0Qǃ9]uhh#E8u 9tha#j=jrvhSz9th#jj) VPh" }uÉ؍e[^_ÉUWVSuEEE_^}%É߃uh'N#w)vW5 44%uWPh5#" ?u'F=@khN!}s\[É߃u!h'"P GЃEEÉ߃uh'Y"CЃv3w%1tSh<=<u h!H<<ÐU WVS]<)֋} );@v5@PR?<uh!v<E PSJ߰ЍDe[^_ÍvU= ~h! $ U= u%=$uh!c&$  $4ÍvUVSM<\t <^tiwvA<3Q<0}<%I<$}EuA\[v=w%1t5ЍAF̊vY vӁvR- 44%tZ,tU'tP\tK:tFh!588hP8'vh!58 8cv8fÍf0hQm8 vyfӍЍffэЍf(80 hP8f˺ ȉf1fЋ80hR8}hP8e[^UVSu] =0tu u95$ubh!h"58-8 h"58 8sv=$tv5$rDvh!"5880hP8s=,t h$"58v8=(th,"58M8e[^ÐU WVS}]  $(,048Eu5"}Y=w%12]v=w%1u;*t ;.C͐;%C}8%hPCNO$#8%hP0=0Wh6"Hv(=(aWhJ"$v,=,=Wh^"vhr"vj54hu"58q8 j54h"j54h"fj54h"58 8 S Ãh"588 SÃh"588 <;=t;+t;-t;*t ;/+{pt {c{;=tj54{pu6jC4P4;$t 4FCP<ƃ$D$h""h"h" h"588Ev=0t/=4u$$=4u$ v4$vj54Swà h"Ej54SKà h"Fj54|h"vSÃj54Q h"588=j54h"^;3t#;2j54h"4j54h"j54h"5818 v4 4h"588ov8%hP8KWPP Ph"%8ChR8;}h"58R8]v=w%1u ;*t;.u(8hR8C뮉h#5888hP<e[^_ÉUS1ۍEPEPhkuuTE=w%1t1E=w%1t E:Eu؋]ÉU`VSu] wavS"v44%t6:t\u\hVƈhB؃9uS PEP> Sh$EP5EPVrƉe[^ÍvUVS] uh$uFSP VPe[^UK;/K=w%v1uڀ;.tՀ;*tЀ;\u#~^t~,uFh>$uO~.t>*t >/t>>uFǍvN>%u"~%uh$EPl>%u}hIEPEPh$Vu!j;VƃuuEPEPEPh$V襒tTEPEPh$V芒uj;V觠ƃuuEP7EPEPh$VQu-j;Vnƃuu}W>E؃ vVtƃh%EPQEPh%VtEPh %V̑uPj+Vt>ph"}WE؃}tEEuEPvjh"V̞uh-%jh$"V褞u!E}h0%EPljh,"VluE}wh3%4FN7$D%%hEP%h}WE؃=w%1tFhEP뻃Ph6%w>d1h"vh<%EPjh"ZF>1u E>2u/}us}umh?%EPJEEMv>2~E1bvhr"}WE؃%vhEPE؃E>tF>t ;u1}u<e[^_ÐUS]fC,fC'fC fC"fC$fC&{uj,+C{ ujN+C {uhxw+C1f{tvCBC9|1f{tvC fPBC9|1f{ tCBC 9|`]ÉU WVShjÃtߋuEPS؍e[^_ÍvUWSU`װ׍;=wR`P7=``e[_ÉU WVSu-`|1f~ tF~N <u #Fu C9r۸e[^_ÉUVS]u Et uC CS$)S")K C&)C"S$)Ή[^ÉU WVSuEPu V(ǃ^"F$F&\9}vVDA9|EPWVKǃ}t; }t |}tRs^K9}VD A9|fN"fNNv^K9}V DJfJA9|fN$fN$^ K9}VDA9|fN&fN 1e[^_ÉU WVSuEPVÃURVE~"F$F&|8 ;]s(vF4E P<|C;]rۃPvFO9vvVDI9wFU EPSVÃ}t[ }t}fF"fFFPvFNI9VD I9wfF$fFFPv F NI9vYV DJfJI9wDURSVB5fF&fF F PvFN VDI9w؍e[^_ÍvUWVS}G"EG$EG&EE]9O4G +EW&)؋W<j4E P5ƒ|@jVWujVWtzjVW‹GajG4E Pƒ|DjVWujVWltjVW]‹G fPC;]e[^_ÉU,WVSu} F"EF$EF&EW"G$G&‰U}uM9MuJF"f;G"u@G$9F$u81EC;]}G4F49tE}EEPgEf~&tG"W$t WVf&tF"V$t VWG"PwF"PvEPE G$PG"WPF$PF"VP]EPE G&PW"GG$PF&PV"FF$PUMP[ËEE؃ 9Et3SEPURMQVG ~tvGEFEE9Et?ESURMQEPW ]Sw? GSURPZe[^_ÉU WVS}u ]CPCCPC C PC1f{t EP] CAUB9|1ɋ]f{t"EP ] C HfJAUB9|1ɋ]f{ tEP] CAUB 9|] K"C$C&t)SUBSM qP? ]Ce[^_ÉUWVSu] 1dkHA~9tGI[^_ÐUVSM1۾ i@xt`k@%ƃ dkPB~v9tCJ[^ÍvULWVSEEpk1fxXkƒ8AF9 dkQ(1IA~vIpk4[^_ÉUWVS]} pk&U)؅}H)R pkRP苙u)9)؉E dkQ(v1IA~IpkN2~S[cE>FS(EC(C(C,S:E4vE>e[^_UUB(;B$u1)J(A;B$ry tvH;B$r8 uR()‰HÍvUS]S<C,]ÐU WVS]} t C<C,;C0r ${<un{4t80$C( $0$jSjSC(C(C8ScD v{4tJ1;s<}$v0$C( $F;s<|ߋ0$s]ÉUÉUuU1ÐUS]Eǃ C,u/hs$C$S,)‰C<Sd<uESPS`2}u1]ÉUUǂ B,B<)ȉ|R%ǂÍvU WVSuEdž@dž F,}džSvu/hv$}F$V,)‰ jjЃtX1ۅV>;cjjЃtX1G;~-vGjjЃtX1ۅt>V$F,)PRS7YuF$V,)‰Ѐ<tSV=tE}tVG%e[^_ÍvU WVSuEdž@dž F,jjЃtX1ۅVE=nvV$F,)PRS=XuF$V,)‰Ѐ<tSV<t}jjЃtXv1G;}u}uV<u EV %e[^_ÐUS]S=S(: uJ;S$r%: u K<{<~'vJ;S$r: uK<{<{<~ )vJ;S$r: uBI~ ;S,s: uS(]ÐUS]SS(;S,s#: u K<{<~%B;S,s: uK<{<{<~ vBI~ ;S,s: uS(]ÐUVS]C$C$C,C(jSC( C(C(:C(C( C(S- VS 0C$C$C,C(VS$t[^ÐUWSh#Ã1E @C ECuCCpSEJ ShS SSk S_9S: S&SECǃ1e[_ÍvUS]t|SySdJ SgS SS S9S S-&SE 3S]ÐUS]SmS]ÍvU\WVSu} M E$_1V%11VyT!1VE9tNf1AEt]vB AuG$_E_EPRVE_EPRV\E_EPRV]jE_EPRVK_RE_EPRV?m:vQA1PRVR A1PVZ e[^_ÍvUE$ÐU WVS}E uC7uQh_ƒt;h_Rh_hS5؃ h_P ƃuEbV 퐋| uRW9 ÃtÃPV裘ƒuV 1[^_U0VSu]S]jS EPSjx6EPEPVT tuuVyUjEPj>6e[^ÍvUUE ÍvUEu1US]C(;C,u2;C$ujh`SiM4Z0SQsu hvvuE8uhvsk1uPWEPVqe[^_ÐUVS]M u< u5;\u X<u;Xu\<t VS e[^ÉUEU :uh wpjtRP1UVS]u u>t1"jVS(VhLwssje[^U WVS] }u:u@{ t&WEPt 15[ эvC{tC{t[믐e[^_ÐU WVSu} :t<~tF[{tC:u{uPCsG?~ tv lF Ftt,"t#u~tvvEF}t  }t *t!UFGE0菲F3Cv~ uPNF UREPWv 1e[^_ÐU WVS}M 1:t,ڃ{tCRztoB:uzt`֋^A9u t*/v{ tFQC Pu1{ u+uCCFCSv1e[^_ÉUS]tk{ ts C sCtt+!t#u{tsvS]ÉUS]j@@@ @]ÐU WVS}u ]U>uRSW1xv:uZPRƒ{ tF[ B붐~u>D"DsCPW1{t [se[^_ÍvU WVSu} ]~>C"DhwvpfhwvZf~uuPSƒ u.D"DwGPV5vBPw V@t SwV*1e[^_UVSu] MEtmt t.XuSwuwRP1Pvt :t8;Bu2S5|qvSevhwS5|qv4e[^ÉU WVS}] uu;^C;@vvVӿ 44%t";^Cu ;?v$ @^u;\C;^\u;\C;\ tQvVZ 44%t.vV1v44%@u%;\C0;C$0;C$0;؍e[^_U WVSU}] ?t] C:u^C@Cvր>vR萾v44%t^C>u ?$ @>^t>\u\Cv> tYvR' 44%t2vR 44%@u$\C$0C$0C$0CF> ?t tGCE e[^_ÉU WVS]hXh\ǃdqǃhsǃlr hDxƉthlRƉx [ǃ|[S1e[^_ÐUS]XǃX\ǃ\ǃdǃhǃl tǃtxǃx]UVSE\vS 44%t3C~ɍe[^ÉU WVS}\X1ۀ>/tC<3/u~01ۀ8/tC</u~puƈ]E3t8 t1"t($Ej3PW PEPWvC~E0e[^_ÉUWVS]\XElMhǃp`S1҃M 2:M B~SjSN S Be[^_ÐUWVSu\XEddžp`VJ1҃:E"B~VEVEEE jj(VPEPV:jVM VWAe[^_ÍvUWVUE ƿwu R"%ƿwt Ro1e^_ÉUVSu];t{uXhwPSct9t?E v9At 9u#1Phwv"^ SVV[^U WVS}u M]Ȉf؈f<1"u;9hwPPPhww]t:ti19BuW9tc2hwPPKPhwPP,Phxw]? :uOv2hwPPPhww\[^_ÍvUVSuhxv\11ۃ\:tCPQRVكC~؍CPQ\Vch2xv_\11ۃ X:tCPQRV2كC~؍CPQXVhLxv\ hwV>hfxv[ hwV=e[^ÉU,WVS}Dž}u v\DžDžDžMQv:-B$ yvXvDžDžzDžnWWKt;s3hzxwZ ;uBPU2hxwZFM#E<uW|u3U4FPyÃuM1hxEFtXtSW;v{u<uSW"E<u3tSW;vSRWt$wvgM4PvuE0hxvt'RQWPSWU:%vPRWPSWE4WMuU42hywXt'QPW8PSW9kv{t2RQWPSW`1SQW v?v1[^_ÍvU WVSu}|} t }tu Pxx[Ptςt|xt:tu߀>t F>uN9us~ tu;t C;uK9s{ t]E8u ?;uv 9vNK:tFuC]u]܉u]؋U:tjE;}s^vU:uNu;MsE9sFA;Ms ;us:tE+E܉)9}҉)9~]܉M؋UUuC;]r?tiEuU9sZE:uL;Ms;}s:uvAC;Ms ;]s:tE+E)9}҉+E9~ }܉]؉uMF;urE+E UUEEU)E+E)‰UԋE+E؉EЋE+E)EЋUBPuE}~EEEUU܉U؃}~ EEUUU+UE)9} EEUUE@PuE}}UUUEE܉E؃}} UUEEU+UE)9~ UUEEE+EUUUEE܉E؋U)E+E)‰UԋE+E؉EЋE+E)EЃuURME9Et9}}+E EԋU;BH+EPRE9EtcURWEPURWEpHE+E PU REP0])+]SUԍ4:VEPuSVEEP])SWURQSWEPc}u+u VURCE9EtP]SURBSEpHVU RP0])SWEPSWUR ;E)PWEPE+E U+U)PURN E}E+E EPEPU9Ut2EPEPE+EPUREP26E+EPUREPE+E U+U)PUR 9}u+u])9}+EPEPU9Uth)]ԅ~3SWEPURWEpHE+E PU REP0])+]SUԍ4:VEP\SVEEv])SWUR9SWEPK }|qE+EPUR3E9Et<}~UREPUR"E+E+EPEEPEPE+EPUREPe[^_ÐUVSMU u1 BAC9s:u9s  AC9r[^UWVSEPHU@$EvEF u1 ut}vFuovSӞ 44%tF;u~>6vS蛞 44%u ;u~+uG;u|1GEEU;B(HWURVEP :'e[^_ÉUVSu] S&VFFFF;FH|$FF j &j &e[^ÐUVSuF(X t;F,tV3vS蓝 44%t&t @?j^V/vvSC 44%tSVMvj\V0PV 0PV؃0PV %e[^ÉUMAA1;QL}AB;QL|ǁ ÐUVSuFPtKjV1ۃ; %vSVvHV. C; ~ރjV_' VMj $ j $e[^ÍvUS]h1ǃǃƃǃ1]ÍvUS]ǃ]ÐUWVS}] SWtAjSuVfu&jjjWVd ؃V>1ۉ؍e[^_UEu vUWS]CD<1pu`;X%C(+C$=~ ǃ|+s$He[_ÉU,WVS]C(EtUEEU} C,D;C0 u3t:.*EEC, C,tut S,FC,>uS,tC,p9sS,FC,9rC,SEPS tjSF%XE`'wr$zvE S,EC, EdvETv41E<t= <t<vEvSOvF9C(DC(h js,Pƃ,C( S,C(C(C,9s(s C(8 t~SEC(C,S<TvPhz$9vEthtSEE C,K,C,;C$v8 uC,}HE]N;v>[t>]uE}[}tg;} ub=t?uIt ǃ ǃS-<u SuC,C$vC(uH@C(.*C(;C$r!;C,wW@PSE<uVSDu jS覻 jSAE}t(uC,vC$C(W@PS0}uASE9tS<US(t?t:WSE<u=t?u }:uE}t }uZ}uTEtU쉓E9t Su<u /vUS(}u Sk}u }Ee[^_U WVS}ƅ.ƅ*G$G$G,G(E jWG( G(G(G(} u/v?WPW&p uG$G$G,G(8.8*hPSS.@*hSP(.* 2.F*FhP踀E GDG$G,G(} ujW諸<t&jW=<uWy8t&WWG, G,G,W[^_ÍvU WVSu} }u/^(;^$rKvWSu K;^$s/v^(1*^(vWSuC;t;^0re[^_ÍvUMU QDA$A,t t+vjQ9%jQ}%ÐUVS]u S(MIt9uJ;S$v9us;S$r u9t:9u}tBS(@uS)1C(S@e[^UVS]u S(MIt9uB;S,s9us;S,r ;9u}tJS(@uS1C(S輧e[^U0VSu]SVS蓬 EPSj9t tDR5t%j5tڴ <u5tI$v5t.5t(1Ƀ=tt#;5tttvA<t;4ut4V֩jEPjr Vje[^ÐU0VSu]S jS肫 jStjSi jS[jSP jSBjS7 jS)EPSj j$m1҃t=ttB€:t 1BA:u苅B9rMyT󥋅UBX=~h~r-.MQUBXBTP貤UBX@BX[^_ÍvUVS]sHSC`@HCH>@FS e[^ÍvU WVSuHF@P!1ۃ;^}@PC;^|FExF@Pܖ1ۃ;^}@PĖC;^|FEx e[^_U WVS}wGt+>tv3r;uV^w G t'>t3:;uV&e[^_ÉU WVS}E ;G;GL+w~R~%W\z|tB|8th{ VVVr|r19}j NC9|GW\tP8tE؃zhtBh8u.h{ PPPG\r/P@vG\xht4@h8t,1ۉ9}"ލvh{ jG\phC9|E Ge[^_ÐU WVS}E ;GGH@9E } uj [Gvu +wFv*W\zt!B8th{ E PPPr~3W\t'8th{ VVVvGPtEG%U 9t09}u j 9|E %GWE )POGRWڃ~;O\t/8t$h{ RRR-PbGPt؋U M 9 &;E ~j G^1ۉ9}ރj C9|E Ge[^_U WVS}u ]~ GH@9PF GKue[^_ÉUVSu] FP;^HV\zxtBBx8t:ztB8u'h{ SSSF\px,PvV\z tB 8th{ jr F\xt*@8t"rh{ jF\psV\z$tB$8th{ jr$pe[^ÐU WVS}u ]\GPR;_HIW\tS8tHz4tB48u5h{ SSSG\+PSVWAW\z8tB88twz(tqB(8tih{ jr8_PF KuW\z<tB<8th{ jru~Uzd1Vrd(ǃuhEpuVh Ur$h`Mq#UB`@PB`@@ MQ`BBt=tjSEPU;uh~+‹MA`h~|+‹MA`P h~a+‹MA`P hm~I+‹MA`P h~+‹MA`Ph~+‹MA`Pt =tt*V3+PSEP ;u܋UB`x@PMA`x@EP`BMALBAHQPPEPV URjPj MQy1[^_ÍvUWVS]} uC`@C`@EPhht@s tEfxt@f}tEEPhht@s ytEfxt@f}tE1ɋS`B;uB;tȍe[^_ÐUS]M UC`~P v@PC`H@SS*]ÐUE@h@@@ @d|@@@@ @$@(@,@0@4@8 @<@@@D$@H @L@P@T%@X @\UWVSu^hsCEPhdvVds CEPhhvVO st<>u%EUt DPS]SͰ>Ov<>"uISWEP,EU| u D>EUt DPS]SxE} e[^_U5`vuQÍvU5`vqÉU WVS}hwhw G`pphwGP@tPhwGPtPh"wtt_\=ttR;t$8thwP3;5P6vh=w >uwj O1[^_U WVSExxp@Et;t18&Usu/UBPtOP5vMq[uxuUB`x tOR봋u}u EhpuMпtuUB`p5vr'MuUB`pljt;t4M13ţu-tuV\;uPE0@ t :uPM1h31;tLv;%u>CMw$ԁvG$tPhEpC;utn t vEU:t(8t!Ph Mqh{ jVEE8t8u!Rh`Ur:1ۃM1ƒEu>t(8t! Ph Eph{ jRSRP(vtWhMqOEu>t8uh`EpuU2SÃEM9t8uuLh`7E0ƒEM9t.8t'uPh uv(vh{ RRSPP)1[^_U WVS]EPs l 󥍃l lPp4t%=%}RPPERE 0:t9:t} E}~ERE 0:t :t} E}~ҋ! ! ! ! 9PP 1e[^_ÉUWVEǀƀxlv-󥍸 `wfPe^_ÉUÍvUS]Su Sل]UEU H HJHJHJHJHJHJHJ HJ HJ HJ HJ HJHJHJHJH"JH J@!BUUE JHJHJHJHJHJHJH JH JH JH JH JHJHJHJHJHJ"HJ @B!U,WVS]9EUEfEEfE\M䋻XpulE싓hUvdMEEw=wEEUMEBUEE:Eu } MQEPSUM M EPQSѤUup0M }t=EPWS衤UM :EPWS膤Up@0: E E86e[^_ÉUWVS]Hw1Ps V%=%P􍳘V ;t!V V !;tt(;t ! ;xt(;t ! ;lt(;t ! ;pt(;t ! ptǃCPRPP1ɃR: uR A1:t1ɾRE U9#u}9}:9t#t A~ȃjS99PP1Ƀ RE Uv#u }9:t#t UA~ƒul Pjs ~tǃ1e[^_ÍvUS]u1.lPjs H~tǃ1]ÉU WVS]u1 󥋃! ! ! !  Pjs |}tǃ1e[^_ÍvUS]t1.Pjs ,}tǃ1]ÉUC $lC 4C (SCC C c${ wcC $K$C K$뼉{ C $C$tc$0SwC UCU1C Vvc${ wVC $P3t*S 5C\CC  C SC SB9CrCC)ƃVPblj+Kt!1;S} C  B;S|KKs{SB9CB CPs !C ve[^_UW={u^1@a@z~A@Z~0@9~_{_ÉUE{{ÍvUS]:] u12E hh8…u E )‰Ћ]ÉUlWVSE UUЉEԋMIMEEEEhw_E(E Eu]s cccCC{u=;tj 3`j _UM9f(]C u6u؉uċE9E''(vEEE}t EUЊEErU%$vE@9Et#MuQu]S(%u‹M)@;FӋu~'FF=vFUr2_Mx'9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]'$u9utEuPVu'($U‹M)@];CӋu~&FF=vFUr2^M|&9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT] +#MME:#}uu %#EEvEEE}t EMЊE}*tf]u}+tX}?tRzv}\mu9uEEE}t EMЊE}+t }?0]]E}+t E€}?t ‹u9uN}$U‹M)ȃ];CvӋu~$FF=vFUr2\M$9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR}tE@]EP}tuF.9t v.uo}tiE9Esa}tEME}t]C 9t 3v u+u@u E+E؃PEPj #EE+E؃PURj#EM‹])ÉӋu~:#FF=vFUr2P[M #9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]S+EPuV}tP"EE}!U‹M)ȃ];CӋu~2"FF=vFUr2HZM"9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]SjuVj!]؃!vE؉EȋU‹M)@];CvӋu~>!FF=vFUr2TYM!9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]Eu9uU‹M)ȃ"];CvӋu~V FF=vFUr2lXM( 9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ";AR]؉]ȋu‰)@;FӋu~FF=vFUr2WM\9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;ATME؋E8^uE8^uE]]܋u‹M)@;FvӋu~FF=vFUr2VMp9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT] C]؉1{u]tu؀NE9Eu EEE}t EUЊEEtT}\uNM9MBEEE}t E]ЊEEЊMu2wv}]u E@9EI}t}-uHE8]}-u6E;Er Ex[t"E;ErEx[ux^tE8]uE8-uAx]t;u9E萃EPURMQ]SEPH Ez}[pE8:du9aEEE9EUvM9M<EEE}tE]ЊE}:t&}]t u9ut}tEM E뫍vEU}:E8]пXE^EdEjEpEvE|EEEE߹EE^߹|pXtvtctPt=vt*jtdE9EEU9U1ې}t,vSA 44%}t.vS@ 44%}t.vS@ 44%}t.vSg@ 44%}t&w%1T}t.vS@ 44% }t.vS? 44%}t.vS? 44%}t.vSk? 44% }t*vS7? 44%@uT}t*vS? 44%u$}t8w$%1tكM CEr]tEHM}uEu؀N NECvEEЊMM v]؀{tC|uuNt F|tUB‰UAM v] lvuf}E%=E9Eu WEEEEكUa$pU LMAEE;Eu-EPu$NE]ۉ]EUMċu+ EM}t E+@DDEUu؋]+3t EUMLUME+D‹])É؃u;FӋEx"P҉Pv @vMq14Mu9tBE)؋ЉE؃}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)Ѓ;CXuFEFFuEEEU؉UEM }urA}]‹u)ƉvӋExP҉Pv @vMq1 Lu9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)@;CPuFu؃EЍDPEPj Z}uUq-MEU] 4Ήuă|t LIM vEEU] t Ήuȋ|E9LȊU(ʈ‹])É؃u;FvӋExrP҉Pv @vMq1Ju@9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)Ѓ;CNuFFE(ЈEM]‹u)ƉvӋExzP҉Pv @vMq1IuH9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)Ѓ;CNuV+EăPEPj&Eu؃}t+EPURj M؉M]‰)ƉӋExfP҉Pv @vMq1xHu49tBE)؋ЉE؃}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)Ѓ;CXEEu؉uCE %= E;Eu U9U ]MIu9uuE pvEEE}tEUЊEE=w%v1t.}}EuEDPЉEE9Et대},uvu9utbEEE}tEUЊEE=w%v1t}1ۍE\P뙍v} ]}|UM9]Huu7}\E9E!EEE}tEUЊEv}}t] }u!u  E؉EȅU‹M)ȃ];CӋu~ FF=vFUr2EMh 9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]S+EPuVj I ]؃vvE ~EU‹M)Eu;F׋Ex P҉Pv @vMq1Du` 9tLE)ЉE؋E)ЉEă}t E)ЉE}t E)UEȃ}t E)ME̋uE)E;FNEPUR~ +Eȃ v+EȃPMQjZ E uVEPjURj; u؃ 0KSE)PVj VS+EPMQj u؃0vM]96 ȊEE}tEuЊ0E䐋EkU9U_Ex\?M{>M؉Mȋ]‰)ƉvӋEx P҉Pv @vMq1Bu 9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)@;CPuFu {VE؉EȋU‹M)@];CӋu~ FF=vFUr2AM 9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]S{nu‹M)@;FvӋu~FF=vFUr2AM9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]s{u‹M)@;FvӋu~FF=vFUr2(@M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]{u‹M)@;FvӋu~2FF=vFUr2H?M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]{u‹M)@;FvӋu~RFF=vFUr2h>M$9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]{u‹M)@;FvӋu~rFF=vFUr2=MD9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT] {u‹M)@;FvӋu~FF=vFUr2<Md9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT] u@,EЈEE;EPuuu-U؉UȋM‹])ÉӋu~FF=vFUr2;MT9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]CEC]ZU}t EMЊE}]D;Eur;tmE8*te8^t`ut8\ux+tJx?tD E8+t:8?t5EtE8{tE8\x{U؉UȋM‹])ÉӋu~FF=vFUr2:M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]CC]K]̋u‹M)@;FӋu~"FF=vFUr289M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]u؈Fu؋EU9U7}tE+EPMQj m}uTu7]u+3s1? 6. & e[^_ÍvUMU E BBÍvUS]M EUAAQQ[ÐUS] UJ9t IJ9uuSu]ÉUS] UJ9t IJ9uuuSuw]ÉUS]U ;Uvz\1:(u uu:|uf|t[ÍvUVSuU:\ÍB1;E s1 t :)t-t t9)tf} :|tvtt 9|u[^ÉUS]MIxU9\uIy1[UWVSU;E u vHMMQEP~1ҋEt 1ۉSURMQSo}tËUuƃ}tËMvE8}t&ËM%)ˆӉ%)C<1e[^_ÉU,WVSE@EUUMQUEEeEE1҉߉@EH`U9Uu:},M9Mu(}GU $gGEMUEUMAM$Ȋ}OUBM}74G}v}FM}F$)ljsENyLU2vMF~}74G}v}FM}F$)ljrENy1<uUF~1<tMF~1}>F~E@ @u G fUBWM1Aƍ|}<?t ?.EE0@ƋUtu}UE9tMM1AƃM;EsjU;UuBk{9EwJE$)ĉPuSO6]t}}UEu4EvEH}tYEEOEMAƒMu1ME4EEo4vE}}E9E}UBM $bB1e[^_ÐUEU Mt`H EBEB`BBÉUEPuuuPu jjuU,WVSu] E@EURUMMM39} ;E~])}t8 u~ }t'E@uPQu yr};uUBE];u}3;E| E))M;u| E+EU }t5;]~W} 8BE<uCK;]~= }9BM<t';]~"B}<8uK;]~ BM<tE)A}t;u| +E}8U }t%M%E8tJ|;uu}t }GtGE(PU$RVMQ}WEPU RMQY tt~KFCNe[^_ÍvUEPuuPu jjuÉUWVSU$EEЋMAE̋Y]ȋqFuEEEEEEEEEEEEEeEEy$)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe}}}}}}}}|}EE9EE}9}sIEM]u}M $$$@E]9r}u } tu u}}E EE EEMMM;UU U]]uuU})U܃}~E9EU UU؋MM]]u)]؋}܉}ԋE9E@U9U}}tM9M w E E9v]9]0Ѓ}tt u9uwx}9}lEE؉EEU9ULM]u}UAM]9r!}tXuu؋}܉}ԋE 9r U9wMME]9]s)vu}UM]Fu}9rڃ} E@@uYE@sU P)M AP)] C{ufN\}GuKE@U 9s@Pr(+M APq+] C{u >t(F}8VE9Eu M+M E+EEEM Mv]urދU+UE9Et E+E)+U UEUBUЃq$<] MC]Ѓ}tIu9uu}9}HEE؉}9tM]ЊC]AM؋u82MuA}9}uE9EUU؉E9tMЊAMЋ]؊C]8MuEU9M  @;Ev]9]uu9u}}؉u9tE@ @u*}tUMȀ< iv]؀; Xu~ }'}t}UȀ<u5M؀9(E]9u  @;Ev}ЀËE9EuU9UMM؉U9t}tu}Ȋ 8vE؊ыu9s%Tȃs}DEЄvEU9UM  @;Ev?]Љ]uu#V}WEPS$EMt]MUuEMU}EMUuEC;]vċUEM EUE]EUEuu4EUE}؉MUuEMU}EMUuEC;]vċUEM EUE]EUEuu4UEBEUЉUM9sJЀ8uE]9]s6E8tu9us&U:uBEBE}uJMU+UE+ED@9sjE+Ep]čD[{9EE$)ĉPuS#]}}M+UDv9r]E9w>MUuEMU}EMUuEC;]vċUEM EUE]EUEuu4EUE}؉MUuEMU}EMUuEC;]vċUEM EUE]EUEEUEEU+UE+ED@9ssE+Ep}čD{9Ew9E$)ĉPuSB ]t EEqM+UDv9r]U9w>MUuEMU}EMUuEC;]vċUEM EUE]EUEEUEEUBEBE}~"MM EBUv}]CCUBEBEtMMJEB/vEKvuFÃuމuUEBEUЉMUEB}t] 9] u9u}}9}EH;Eu U UJEH9u MA v]CЋu9uu}EH9Eu MA]%9G}tu 9u }9}}E9EEH;Eu U UJEH9u MA v]CЋu9uu}EH9Eu MA]%9cu9uu}EH9Eu UBM%}t] 9]; u9u,}"EH;Eu } UJEH9u UB vMAv}t] 9]uu9u}EH;Eu } UJEH9u UB vMAL]9]uuEH9Eu }GU=M9M1]9]uu9u}}؉u9tE9Eu UvEH9Eu MA]EU9vM  @;Evr]9]uu9utt}}؉u9tE9Eu UvEH9Eu MA]t1EU9wvM  @;EvE3vv}MUEtEMEUEMEEMEEM9r=MUE]MUEuMUE}I;Msă}nE9EsVMЊ<w <s < t A<u<]C]@EMtE8 E8] 9],u9u }}h[^_ÉU WVS} uEU9E<<EE@E)EE@ÃEE| tE3E| u'VE؃Pu}tl]E8tEX@ÃVEPuIt8]*UE"VWEPt 9}1e[^_UVSE] uE9sBE8tVSEP:u 1&vEE@ƒEU9]re[^ÉU WVS}uEEw<$EVu EP>u $$uq1wE@ExMREE@EuăEE@EMEu 뙉E둉Ee[^_ÉUWVSM}u] tCF8::tIu1[^_ÉUMU E``HP5{RQ賱{ÉUWS]u=u @1}=uCh*t#hue1 h5{߰HPS {e[_UWUװHjPjPRh}ÍvUEÐUVSE u]t7PhhpSVhp  hpj SVhEPse[^ÉU WVSE }]tJPhhp賥SWhp蠨 V0oPhhpJuSWhVrK0)Ph)PVbe[^_ÍvU WVS}u jVRÃu!躊0PVh7W؍e[^_ÉUlWVS]u ǃ ǃǃǃ0ǃǃǃ$t'H=vhՌ#AEthv}uEjEPEP} EPvEP} EPE%f= uǹ ujP u tEPh 3S3nEPh?~ }Jh?vjjV~}Vh3SDvSW|)}thCPEP9S1e[^_ÍvU WVS]h4 ƃt*1҉ Suu uV$h40MPS1e[^_ÐU WVS]h4o ƃu*t 0PShIhp1&1҉ juu uVe[^_US]| | |0t S~t $t$r Sf 1]ÍvUWVSEu }V1>te8t^EEEE8_uEEPjjZ`tCCfCECG ;t8u)ЉЉ)e[^_ÍvU WVS}E jE 1RPE Éփu.u)Ѕ8tE PhQjEP!WEPE FÃ}hfjEP9shoE0P]hjEhfE0PuEPE PEPÃL9vjE1RPEuuɄ8hSVE]ÃXt ] )m+Ee[^_U WVS} fjE 1RP 4Éփuu68t E PhQjVEPu Ã}hzjWZ,;]sh7Wvh7We[^_ÍvUS]0t&08t 0 0]ÉU,WVS]jSyǃuh/v0EBEEPS5uuELEEPS t hU^jEPE)PSt hb8hShVuS} =u71hv3S|e[^_ÍvU WVS]} |hv08u E8v}"%?ЋM@) %j1RPuu hFjEPPu Et-E%U)%h3SWhƎjSS1e[^_ÐUuu uÍvUlWVSEEu EE}ttjdlÃu1HC C$C(CDCHC CCC@C8C<jjjCLCPCX}PCT JURsTC\9mt]>ruC\r>wt>auC\w< w ЉE,>fu E>hu E UBUFu{\{\wuFj8hEPjjjURSƃ h@ CHC u4zh@CDj8hjSƃ uN{DtHC@D}}EPEPEPUR)C@{@uS{\wu2jjjjjjjj5{5{hs@ C` SCs@f+CC`؍e[^_Uju uVU VSu|!Vhj]SUVu S'1e[^ÍvUS]t{\wtD{u.CHC s@h@jP0=@tC8C@uu S]US]{<tT{uC}s@h@jsDCuC<C@@ @tC8뵐CDK]U WVSu1ۉVw;{t+tFt FFX~%CvV1ÃV&ǃ utF81ۉVCvt4VÃVà rVutVtutvVtut1ېVcCv1~<tF8e[^_ÉUVS]1u {PtsPg{t&{\wu SS{\ruS ƃ{@t!s@o)t{8t{8}s8{DtsD{HtsH{TtsTt Se[^ÉUWVSE }Et\rt 8t8u 8u1vG8~EG EGjXtn_;_v_t"S7w ]UW )_)_tw@wjEP)GW)UEGGuG<EuF<u@Ozw@h@jwDwGuG<G@@ @%GDjWm G8u~G +EPURwLpGLG EW ;GLt G8EWW> 8u?_wW_wjjjGL 8u<u G +EPURwLGLE+Ge[^_ÍvUjEPuuUÍvU WVS] u߅t19vN~jSEPuC< u9u1e[^_ÉU WVS} u]t{\wtrC8Sv;sv{tB{u'CHC s@h@jPz=@uC@jS"C8tVWsLCL+Ce[^_ÍvUWSEPu hSe_߰H~PSu1[_UEU UjURPuUUWU װHPRu}ÍvU WVS1]t{\wt C8vC?vE PSC8u uC81{u{8u{8w2@+st"s@VjsH9uCHC C@t1{8tC8e[^_ÍvUS]u S"us@D1{8tC8]U WVS] Eu~8~8~\wuku+^~DuJh@mFD1)@?؃PvDEPtb)ÅԋFu^|H~Xt*FFDjSv@ܿ|$^^u;^sMQk} T+^tI~Hu?h@FH*@?؃PvHEP~)ÅԋFe[^_ÐUS]t{\rt^C8C<CCDjjj@CL{`tSjs`s@s@]1]ÉUjju ÐUU1t z\ruB<ÐU WVS}] 1vW%PcF~e[^_ÍvUVSuVÃV à VÃVuF8É؍e[^UVSuu@{\wu1jV3usLs@.ss@ Vu+C84{{PtsPZ{Tʉ)P/CPsTP4 hsPVsPCPe[^_ÉU ÉUWVSM] }u 1у 2Љ3 C2Љ3 C2Љ3 C2Љ3 C2Љ3 C2Љ3 C2Љ3 C2Љ3 Cdt v2Љ3 COu[^_ÉUEtxu <@@@P1Ƀz t jP@pX1US]t {t{$u 2vCxtSp,ss(C$C1]UVS]u Et 81u}8t u C{ uC P9C({$uC$h9jjs(C ЉCC@C@ } ދC@ FvSYvCpPC1҃x u)RS‹CPtSN1Se[^ÍvUuu juU WVS]{z;q1} uE EC8 L$v{E ECKCPtC C SB;Bv C;C{iE EKC8sNB))9t COS uC C{E ESKCBC{E ESKCBC{E ESKCBC{`SKCBSBC0C CfC@uEPSCpEuC C@}uE E}E ESBPSr9Cx t C{E ESKCBC {tVE ESKCBC {t+E ESKCBC {uE`vE ESKCBSB;Bt CvC@C  e[^_ÍvU WVSu} ]]t~tF8t cEPWj;F0t CF0FHtKE)ǃSWFpR'F1e[^_ÍvU WVS}tu G8 t G@_u vGPt7w2:ēuBv9t1 v)ЉAKtvՉ+G_GPu"_wW_wG1e[^_ÍvUUtzt BxuBpb&Uuujjjju uÍvU WVS]}E Et{:u}$8t vtsC{ uC P9C({$uC$h9} uE } EߋEHw(}u"~} |}  }|}~ Tvhjs(C Љƃu ,vsEF~(F$HF,MNHFDHFLU %VPjv$s(C ЉF0jv$s(C ЉF8 jvDs(C ЉFu~u{ut{F/~3C E{ {*S(UC|Hv E{dtM BEыE))ƒCqRS{dt%F0PSF0%PSm F0{tV~u~u ;}u{u~t{F$v~u{lu{C|@WS(ЉBwCtu ~umdukuS08vjjjS@0u$SDCvc6vb.v-&vlvsvpvwv?@tr-@}wv-@ʁ@@t' t3vt@t-vxvSvs@ tr-@tw-@ʁt' t3vtt-vxvSvs@tr-@tw-@ʁt' t3vtt-vxvTvt@ @ÍvU|WVS}u BvE]EP螚EEЉEPSj }WSj]Sg jSٙuVSj ÃuWjEPj3jWj& jVj>jEPh h#h&%;0jߍuvjjVWQÃu *8tjEPjjEPj jEPjtEx[^_ÉUlWVS] 1jh.`}.fhuS'jƃj/S&Bt7x9u0H9v8/t@؃P#p߀?EPWupE%f=u;F ~>)hSWPE%f=@uW2WPhS" 1;/u {tf߰ҍЍD@=v1?]uh0SNPS;􋅜P} .􋅜PY2􋅜P~􋅜P,1[^_UVSuAiÃt=j=St"j@PSƃS跊vS觊e[^ÍvU WVSu} ]= u 8u[ 95}38-u!xt,8-u@  :tPSu[= -u 8u=;:= ?5 5!hAhx:t 8u{s8uZ;5D@;:u :P=t5 5!h`hp?# @ e[^_ÉU WVS} ut4E8SEPU҃u~E<Nu1e[^_ÍvUVS=$thf @ 5 =$t h*ÃtŃ=$th;5 t@=$t S=$th C  {RSEDC=$t 1e[^É$FreeBSD: src/lib/libc/i386/string/swab.S,v 1.5 1999/08/27 23:59:35 peter Exp $VWt$ |$L$tfffIutCffffffffffffffffffffffffIu_^É$FreeBSD: src/lib/libc/i386/sys/reboot.S,v 1.5 1999/08/27 23:59:43 peter Exp $鼑7̀rϐ$FreeBSD: src/lib/libc/i386/sys/pipe.S,v 1.8 1999/08/27 23:59:42 peter Exp $^*̀rL$QÍv$FreeBSD: src/lib/libc/i386/sys/fork.S,v 1.8 1999/08/27 23:59:39 peter Exp $̀rtÍvUH ÉU WVS}u]9U :PWSuFP#‹M 99t )1e[^_ÉULWVS^:EċE8L vU:% 11E]z $vMuV}WE xw‹BMċD|vIP! ]SuV} wGUċD`IPz]SuV}  w$GtUč MčD0IP2]SuV}  wGUċIPqMQ]ShKu NlQ)RURMQ] Su}WEPU RhPMQ]ShKu v uvtlNXP2}WEPhYU r \vMQ]Su Vh]}WEPhKU r$vMQ]ShKu N*)؍@)Ɖ)ڍR9u P}WEPhfU B@PsMQ]ShYu vUv}WEPhYU J*)؍@)Ɖ)ڍR9u PB}WEPhKU r$vMQ]ShKu F@P}WEPhkURMQ] { ~ uċ }ċPrEPURM QhmW]SuV} WE;URMQhK] 3a"Eԋu PGBPhs]S9 EPURSQMQ]Su Vh{}WEPhURMQhK] Cދ^)ù$Iэ )PjMQ]Shu FuPCCQ})ω$I)ЍH+vU ZlJMruu?Qщ)Ѝ9u)Ѝ9u nmEM)$I)))ȍH$I))Љ)‰Љ)lj}9E9MKuCQщ)Ѝ9u)Ѝ9u EnEmu>Vu}WEPhKQU:gu@-MU;Ju Bu];s> @UE;Pu@tf]M;Ys{ u@uMEu;FPvR] 44%Uz_u]M;YfvR] 44%u>_%UE;Pu@ti]M;Y; u@uMEu;FvR]v44%U:_]M;YSvR\ 44%uKu~_tB`EU@MP%Eu%=uEu$E9EuU9UEyMM@u%=X w+=HDw=8tG6=PI$=pw=hv=xEP|u | UUJT)‰UE)9E0MAUy NjM UP @M9tuP @EM9uUUE@AuVEPE@PURMQuV %UMD]CUuTUE@FuMAUu;uE@NuMAUuVMQ%])É@PuVREPw UE@MlMA%U\uVSQEPURMQ. <u@%=CKP%Ë%=uK뛍vEHUTEUEu+F UDEPURE@PMQuVEPMQ]ut1}uNE‹DT EUE+F uD1D1 MQuVE@PEPURMQ u uVM]L\ 넸e[^_ÍvUWVSE EEU;BtHMƋMVhVEPQU2>ƉuE }EEM;AtU;uuMME1ۃ u U@uuMAuEUX,} u M@u}u'E@u}uEUX0t(~&VMQVEPURM1mƃ Kہ}tAҁvR`Wv44%uI_tD}t;UvR#W 44%u}_uEҁvRV 44%u_uL}t<}t:UvRV 44%u }_tEE{w VEPVURMQE0!ƃ Ur4M9Mt,URMQPEPURM1EUEPMr1vE@e[^_UWVSE@0EU UEM;QtBEƋMVhVEPQU2iE }EEM;AtUE1ۃ u M@uuE@uEUX,} u M@u}u'E@u}uEUX0t'~%VMQVEPURM1ƃ Kہ}tAҁvRTv44%uI_tD}t;UvR[T 44%u}_uEҁvRT 44%u_uL}t<}t:UvRS 44%u }_tEE{w VEPVURMQE0Yƃ UsMM;ut5E9Et-URMQPEPURM1EvEe[^_ÐU WVS]E EƋM}9vUBM%=Pwx=(qw/=== v=8w=0<v=@q=Hfi=xw;=`Hw=Xs>=h)=p!= w=p==t]=tn9EE}t }EE~Ev}Eyv}oEav}ZEL%}O}4E"A"E! Éс‰! ÄM)MƋM! É!с! É!сUBMT%=t'EH%NjE%=u!=v! ÉсUʋ}G%=t!! EE9E[^_U\WVSEȉEċUJ AMr$uBtE}tU EUM HM"vu uЉDEM9Ms vu~<~Dt}~Htwv<}GLT0UOD_H]}\8D;<u;]s2KJ:u9u:t )}9}ËU;]r9tnv]E9sSMQ<:uE);AL|މ׋ILt/C;]s'uV<:uE);FL|މ׋EHLu;]MUĉ urBB} z EBMJuFPv]}ĉG$uY }vEp$UrB^Mq$4^ H]s$^.uċV$V(F y׉~,F AЉF0F kAЉF4F qjPaEx@؋U+B@;EsEEMA]SuV}WEpPƃ tփ}u UzTMăyu#@P@P@\]ĉC}ċ;XPw.UB@@ @C;XPvҋMyTu!]Cu}WEPVsS\UzX~8MăyuBX@P[]ĉC}X~ Eăx7jURMQV]sSYà !j}WEPVUrR.à uwM;qv!}WEPFPqQUƃ uuJUċJAM]SuV}WEPUR ƃ }=MyT0}t#]ċC S)‹}W)ƉGG }vs;]siuċ;XPw.N}TTTTT T -vUDMDD C;]r]ă{ts [uă~tvZ}w$Z1e[^_ÉUWVSE E];]]U@%=Xtw =Htav=xt!UvM@u%Ɖu8U‹@MJu%Ɖu%=uEU@%=PwV=(w==8w=0tlv=@=H=xi=`xw=Xt+j=h=p&MEDEvGMQSPuVEP ǃ URMQuVWEPm 9uC]]KSURWMQuVH tSEPWURV }vEvGMQSPuVEP ǃ URMQuVWEP 9uC]]KuuuƃSURWVMQ t9u݅uuS]SPVuVEvGURSPMQuVg ǃ EPURMQWVL ;EučsuU@%\)CKMuP%Ë%=uKSEPWURMQ 9uS]SWuVEP} \U@%JE]+C D/vU@%JE]+C DD ];]dEe[^_ÐU,WVSU EU1EU9fM@u%=0w2=w =tZ= =(tf=w=`v= =E9EUBU8M9MEu%JE9EU"AEPn]M;Yu A4Eu;FHx >@-MU;Ju Bu];s> @UE;Pu@tf]M;Ys{ u@uMEu;FPvRD 44%Uz_u]M;YfvRD 44%u>_%UE;Pu@ti]M;Y; u@uMEu;FvRDv44%U:_]M;YSvRC 44%uKu~_tB`EU@MP%Eu%=uEu$E9EuU9UEyMM@u%=X w+=HDw=8tG6=PI$=pw=hv=xEP|u | UUJT)‰UE)9E0MAUy NjM UP @M9tuP @EM9uUUE@AuVEPE@PURMQuV %UMD]CUuTUE@FuMAUu;uE@NuMAUuVMQ%])É@PuVREPw UE@MlMA%U\uVSQEPURMQ. <u@%=CKP%Ë%=uK뛍vEHUTEUEu+F UDEPURE@PMQuVEPMQ]ut1}uNE‹DT EUE+F uD1D1 MQuVE@PEPURMQ u uVM]L\ 넸e[^_ÍvU,WVSEX(P,U@0EU UEE;PtRUUpjSSEShSURPE0ËU0pSEPSEUUEUE;PtEUދ}HuEE11} u U@u}uE@u Up,} u U@u}u%E@uuNjUp0t'~%vSWSEPURE0à NށtB}UvR>v44%uG}_tA}t8UvR= 44%u}_u}t{UvR= 44%u}_uIt<}t8UvRR= 44%u }_t{wSWSUREPU2à E<ubU9UtZUpSEPQUpEPSQ SUREPUREPU2?E UEPE<u1E@e[^_U,WVSEX(P4U@0EU UEE;PtRUUpjSjPEShSURPE0E0}EEU;BtUE1 u U@uuE@uEUp,} u U@u}u'E@u}uEUp0t(~&SEPSUREPU2à Nہ}tAҁvR;v44%uI_tD}t;UvR: 44%u}_uEҁvR: 44%u_uL}t<}t:UvRJ: 44%u }_tEE{w SEPSUREPU2à E<tUUUދ}Ht]U9UtUpSEPqNUpEPS\N SUREPUREPU2E zEe[^_ÐU WVS]E EU9uFu%=Pwx=(ew/=== v=8w=08zv=@=HZ\=xw;=`<w=Xk1=hq=pf=w=l==tY=tb9EE}t]}NE~E}~#}nE_}YUT Jv%ƋUr}+E>8"FE vD ׁ)4 M)}MD %vT D %v<uFuT%=tSEp%NjE%=u,vD ׁEUr%=tD EAU9U[^_ÉU WVSE} u]UH 8eu9EuA(t1y w%uRSVWQvRSVWQe[^_ÍvU:-u9B;Cs1z]t+;Csz-u E-SE vEEM:MuEN fEfF=tCE:Ev j S ]E9ËN ffFC9~qEPEP ~j Sl SEP (EPSq ËN ffFC~e[^_ÐU WVSu EEU;Bs:vRD!v44%t M;ArƋE8+}0v;t"WUR3u<uڅujMQx v{ C$PvӁvR v44%tËN ffFC~vӁvRH v44%tËN ffFC~+vӁvRv44%tËN ffFC~vӁvRv44%tËN ffFC~v=w%1tËN ffFC~;vӁvRv44%tËN ffFC~vӁvRv44%tËN ffFC~vӁvR\v44%tËN ffFC~?vӁvRv44% tËN ffFC~vӁvRv44%@tËN ffFC~vӁvR`v44%tËN ffFC~Fvv=w$%1tËN ffFC~ōe[^_ÐUVS] j=uƉҋK %fCe[^ÍvUS];CrjS(;CsB;Cs:[uz.u Fvj.S=E;SsB;Cs:.uz]u  jSE]U WVSuM E;Fs6s @;FsU;VssB;Fs9uz]u;Fr jF>+}=t'WEP3詛u<t;uڃtjV 1CUe[^_ÉUS]vS,v44%t*vSv44YvS 44%t*vS%yv44Ë]U WVS]3{E UUSEE]ES3{e[^_ÍvU WVSu] Fx8@tMӁvR 44%t"S9tSVY'vPhV<;u FP4;@4e[^_U WVS]3{EECE^E@ @]@S3{e[^_ÍvU WVS]u }CE{~u}~B}u BM$E))CvVC)@PhxS-EPjFPSY C)PhSC)PVS jhSjCHPSo jhVC)@PhxSC)PhSM C)PVS"jhS* jCHPSjhS E@PFPS‹EHPj_vVC)@PhHSC)PhPSJvMQVSN‹EHPEPVS6‹MQGPRS vjS e[^_ÐUUzuE BB1ÐUWVS}GP U@ WJME;GGGMMzuP0&PGp6‹GPGxuEP%‹GPNURGp‹GP1҃;U})GpЅ}BEAB;U|׋Wzt"ztMQjE)BPi*vEj WWEZE}EBE}$M)CfCCC ؍e[^_ÐU WVSu UBP PUx19sˋF ff)FC9rE9u UBH [^_ÉUWVSu FfEUBP HʉU@E9Ef9Cu`9t\1;}sP"CЋ"F%9u0vG;}s'ҋ"Cȋ"F%9t;}t;]r;]sVURދUB+pe[^_UVSEu @H19svŠ"FtB9r1[^ÐUWVSE} @H119s7Š0"GtCB9r[^_U WVS] s}C{ u P4#ss >C { uj ua!vEPC HP0SC De[^_ÉUÍvUÍvUVSuV Jȅ}B] 1ҋF9}v<t  vBF9|1[^ÉUWVSEP Z؅}B} u1ɋEP9}v:t1AEP9|[^_ÍvU WVSEU z8xuiv<>uUVE P)tAU R4UE @4>^'<;uSVU R@tE;C~F~e[^_ÍvU WVSu~]+] t;FPVBV EFЋM MQRP&^e[^_US]{u4C;C|C@@PSSC M M C]ÍvU WVSu}~u^uu VF ]N 9<|FH9<|C ~كF)PN RDPٮF Ue[^_UEM xuP % EÉUVS]u 9s}/Ps !uj STC se[^ÍvUVS]u CFCPs b!Fuj SC Fe[^UWVSEx E1ҋME ;H }"Hv| tEBE ;P |11ҋM A@Y;%=Xwk= )w.=w===0ew=( v=H=xtiw/=hw=`^=pzL=w=t}3v=tn$uCEF=MQRSƒ%;%=`t'=t =L%=`t=uE ;pL~'MMpL~ P@vE P@M ;qL~ EEqL~ Q@vM Q@~v~oBlE ;pL~ MMpL~ P@vE P@~~B1}t0)M ;qL~EEqL~Q@M Q@1%=E xLu @@kvU BL@PM AE H(3vU J<]RL~;%=uAJe[^_U WVSu} u X11%v%=pw@=0w==(=XtY=h=w=xt4=t!==9~1EPRV.ƒ2%4%=`t'=t =%=`t=u}Bv%=`t =9~׋U :e[^_UVSEu xuUhFDtAFDvVDFLA~1;^L}F< VDFL)HC;^L|e[^U WVSEu xFLPdǃuFHvFLP=FH1;^L}VHFL)HC;^L|FLX|? ;NL}3V<:t(VHFL)H;~ ;NL} F<:uIKy19vVHFL);~C9~;NL}79';NL},vVHFL);~A9;NL|;NL}|˃W^e[^_ÉUWVSE} 11xt1K_Ht Pt A9~I%=uɅtO([^_ÉUjjuuu uFrUjuuuuE PuÉU|WVSu 4nuXhkÃtBhhat)9Pu!SEPMQuVREP}qtChh`t*9Pu"jMQuVEPRMQ}Wq}1EE EEE%PhjPjPEPPu64>à tOS=Phhp# ̒0Phhpxt?x=w'hph MDžtvuDžhBkDžvP8#t ~tvϑ8#uh hp(v襑0Ph@hpΫ -<􋵬VRjEPjQhvvP3m 􋍤Q 80u 8=u Dž~uZt~Lؐ0Pu6hRhp [;􋅬Pisv~S膐j"jjhh@ vv h@ hZhp茪Gj vu8BPRDžj"jjhh@ vv h@ hrhpv}u(jhQ&DžvPjFjVjhjPf PPQЃ9t.ǎ0Phhp VI9}G~)hŴhp跨􋵘V hSX։ 4 jjjSWi0~uW8t)貍0Phhpۧ h hp§􋵘VP`PP+kƃat t#vbb1ۃuV􋍘Qy}6ߌ0PhKhpDž cE0=vh`hpЦ}PMQV}PMQV }PMQVjPV t,0Pu6hhp$ svt?jSPjuFjSjA u+v􋍬Qid'6Pvtu6􋅤P􋍬Qd 5x[^_UjuÍvUWS] }1҉ ]tt8E]E8E]EBEBEB E蓊/TvjjEPfǃ|7fEPW蜱t%UWh[_U,WVS]u}1҉EEURURhS5tHu41>]܅t&VEPM Qssu tʋ[uۃuH4e[^_ÍvU$SU] MEEEEEEUPQSjEP]ÍvUWVS}  E PuSDž}uhh1ۅtBEPEPE P PS^ uSf61JvSS6)=u }DžEP>}ǃwShSm -fƃwbhSà Vb1EPPLb} ]E%f=t ͵FvEPCP}$}tE;Gt vEt 5 S5[^_ÉU$S]E MUEEEEEERQjEPS]ÍvUWVSu ]1ҍ} }t }tEu?UBEB5u'UBEBFB FBF B vUuuEPRuh[^_ÍvUWVS}DžxDžt|Pvt Dž|jjjhPEPU R "v1j S{u0OyWj1 u; ;#]vRv44%t*vR44C; t; t; t;u; t; uAC; t; tހ> t,> t'> t">tvC; t; t; t ;u<+t <-tQuDžt@u|jPPty^@u'|jPP@tIkPEPU Ret&HPEPU RAt<+t <-tZ~uDžxv~@u&|EPjFP譎xvFPURzvt~~@u#|EPjFPZtTFPUR)u6jvtt>E>tPEP)Љxtt xWhPX[^_ÐUPWS]U {uO{uI{ uC9Cu2EEEEEECE]ƅj"jjhPRSK }1CEEDžPEPhu-t~~,ivtLƅj"jjhWss uWP,(t[u,1[_UWVS]9{$E`jjUnÃ[j.SwƃFEjhaP*vu[}HP5N‰fFP5UujuljhnSuu EtjhzSuu EpjhS\uWEKu3E'޿t޿t΃hSHr붉kEWECE/EEEpD`E^v߹D(EJv˹D܉E6v跹|]rEq@Eq@Eq@ EE` p>'X*:X,Eu! pV$uE.vE+tE-}teЃ@P5t9UV@PeEv蛸EE`Ee[^_É$FreeBSD: src/lib/libc/i386/gen/setjmp.S,v 1.17.2.2 2001/07/06 12:41:44 deischen Exp $L$APjjW L$T$QYai qyy1ËT$jBPjV T$D$JZbj rzju@L$ÍvUjuu u[Ujjuj[ÉU WVS]}u vV 44%u^$tY-tT_tO.tJ+tE!t@*t;'t6(t1)t,,t'%CVPjSSvV# 44%u<u t/u t"u t t/Fv u"C\E@9\0 $\Cn\Cr\Cb\Ca\Cv\Ct\Cf\Cs\C0CE<0C0v tt"\C0C$0C$0Z@u\C}MCv V 44%t^Cu?@-CC؍e[^_ÉU WVSM] }CPWPQlu)e[^_ÉU WVSMu ]}MvvFPWRQ KwtjWPQ+Ee[^_ÉUVSutPV|"EPVuE%f= t 1jjjjh 'à DžllBfDžl EBddBj\PRSC Ѓu*`hŒ\9SCиSCЃEPV H[^ÐUpVSu h0ÃuXqS3b;Fu>B@PhŒBP貾EPhR u;EuF;EtS!ƒuS1e[^ÍvU WVShNDžu1`u1ې[#Ѕt;9v,A[u BA:u[!Cve[^_U WVS} t E }t UUEE8?1vPWu8t}U v} tpvU _vWcu4t} t/E "}tvU  FFu "h<EPMǃ 1e[^_USj Ãuh@j3vCCjPduh@j؋]ÐUS]SB9Cu/BCP37uh@j跬vKE C]ÐUVSutA>t3} t 1;^sv4C;^r6Ve[^ÐU WVSu} 1;^s$W4uC;^r1e[^_U$S]}hB]UBEPR2t1t8t E}t@]ÐUWVSE NjUEEEEEQƃt t1uu URrE 8ruhu]{t1js`Fs }t_jj@FN}tIExt@jp F.}tju FuR uD`.tvC@P$u5EPhPFjBU :ruRu0ÃuE PuÃuUZr`.`.؍e[^ÐUWVSEE`.]t 9Cuu `vP}jjWsGƃu h8t߃}u `.UStEe[^_ÍvUVSjju^Ã|u SƃSe[^U WVS}u 1CwVWЃte[^_U|WVS]EPS|}u}v}~gAvjjSjjuj6E uҍv` tXtPf=tAf=t2f= t#f=tuЉPC\^~%= t)=t"f= tf=N%= t%=tf= tf=uMV%= t(=tf= t %CV%= t+=tf= t  v %vN%= t%=tf= tf=uJV%= t)=tf= t v%@V%= t'=tf= t D v v 1҉Ӌ~ȉuƉuuE] CCfCCE ;tp8ugvEtUFuO]  ;tA8t:PEEPU uڋFCFCFfCFCM} uuЋUR@Ex[^_ÍvUU1Ɂ:ELFu B%=ufzu zȉU@WVS11DžhDždDž`DžXjjjEPutGj4̿SURg4u*SRtlPMQ} vÉP1RPEPjjPRj u6XTt\hD|Dd6T1ft"vT|tB9|1RPEPjjdRjY pXDž`U BBfBB` :t8uօ)j1RPMQ1`)h\X\8?tm] \8_u@PWt3Wu.PTR\QS``~ ;t8u\~ `eht;`~2h@v@VP]S9 ,aXtdPXR=TtPQTP=``8[^_ÉUSM] CAC=tt,!=u vC $<uQ@C;E|A/CUƒzu Bt z$AC <wI[ÍvU WVS} uMuFuFtFuDž DžF EFF]t>9sFAt>\uAu\I@f9sAuf9sAuf|PVP\PVP [^_ÉU WVSu}f>{u3f~}u,f~u%7E?vWEPE PVS1 tރj{S Ãu҃WE PVe[^_U WVSM] 9tf9uf1qf>tTf>[u.f>]tf>tf>]tf>uf>uvf>{uGvf>}utOf>uuf>u"EPURPU19[t ,tQ{t;}t:كf;]tf;tvf;]tf;uf;uvrvGltOdtf;,tY9sf9rFfN ffuEPURPUK92E1[^_U WVSuf>~E@ EU |B^9s&f~tf~/tA9s f;tf;/uE 8uM6uhuEtQ.Qu'W:PQvU RQu9HU ffA9s9u9sffufE e[^_ÍvU WVSE PhSURƋE ߃?*v[!uf>tj]FP$ uf[!f[!uf!شff>-u^]tf-شf]uNjU J f]8E H f?)U J 9tf*tf*fffEPU RPulU 9u,B uB %=uEPU REP4U B u(h#j+PBBP1[^_ÉUUE 02ÉUEf8tuu PEPRR1UlWVSu ]}Evf;fWEPEP@t 1G taf~/tZE%f=@t,f=uFWEPEPvu.E%f=@u F;Ev vf/fFGEPWEP5f;t3f;/t-f:}EA;Ewff:tf:/uӃ}u5Ήf;/vF;Eoff;/tEPWRSEPVEPe[^_UWVS} ;}v mfXEPUR`ƃucExtRhPURu&W0PUBЅu E@ t v1DžDž&UB @Bux.u Uf:.ufP;]sffBfuEPURWuf-E PUREPURSEP\ uV҃tE@ @tV‹B V[^_ÉU WVS} U:t;~VGtPwo PÅutwG멃u"~GH|vIy_UEf8t fu+EEPFƃt3EPVEPtV vG4G1ue[^_ÍvUWVS}] ;]L=?tX=*t=[tQ ;]tvEPSWt fu1fuvEfUftf;!ЉUtytvf;-u]=tfM:UwBCf9v05uVPwCPVbEvf;UuEf]uE9E(f9f?%e[^_U WVS}tBG_7Ntv;t 39sw#Ge[^_USU] f:t"hPRet19fC @uPYvPC ЋÐUVS] uhPutR?+vF @uSP:-SPF$Ѝ[^ÉUVS] uhPuxtR?+vF @uSP,SPF(Ѝ[^ÉUUM v9tfu1US]M UJtAu1 s[ÍvUEEEEjjEPjjEP =t5utVjjEP5jEPr |U%Ĕ51UWV=uu1_̔;Ĕs@.5 ̔=.tɃ=Ȕu5.e^_U WVSu=u t{1C;ĔsCV[Pu;Ĕs[.5 =Ȕu5u;Ĕr1v.e[^_ÍvU WVSu=u tw1;ĔsD9p$tC;Ĕs/[9t$u;Ĕs[.5 =Ȕu5;Ĕr1v.e[^_ÍvUS]=tu5{Ȕ̔]U=t5?̔ÐUÉUu(1҃u‰ÉU,WVS}u EEEEjjEPEPjEPk }s1rEE$1;]}Mv]jjEPVjEP* }M8-t(vFPWtC;]|Me[^_ÉU,WVSh h#M/E܃uEp/]SjSz jSlEPSj' h`//@PG/`/ %/h/j/@P1 EPu賛UR軕. @/sC/HyPjv/t ujh,MAPh`/j/@P jEPj&=/t5/.e[^_ÉUS] =/jjj*/|*=/~*S5/5/U*/} 1/_=/t5//@/P/tS5/5/)/|9/v/E/]ÉUS]=D u/jh/$}K1"D 1=/t/]ÍvUEPUWSEPxÃ}u.߰;U ~ E"vRSuEe[_ÐU WVS.h/Ã; j EPShƒuE8txu~Ev=*v@Sh?B9~jhU"ځ%ho.ڃڃWRhjh0 0ЋUHE e[^_ÐUEEUBjjEPh 0jRt 0ÐUWVS] tH j(ƃ1 EF ^$EF$tN$UR=vMQPVjhV!EYf@2EEE8vU:HP2VfC2USK@KF$PSV fC4 fufC4}t EC]C}u]UZ]EEM9`}t}~EPURV EjhVt?MHf@4 F$ujjhg<F}N$?FEP]UR vV1e[^_ÐU WVSu] C&fC$GP{@WvYj/Wƒ t09uzt&BװЍxPRC@PXf{&FCCC,F e[^_UVSu>t9f{2|$vڋCuCÃRf{2}߃S ~tvJ ~tvvF$uGv$t DE1ۃvtVE V{1e[^ÉUlWVS}?G%7V8fF8ujVW fF4QvusF4ffwejVW fF4fG$jjh:F }^DFfF4N6vf~4tG$@tBF,;G t:F6tv tw GfF4vtbG%tg%w Gt=vjVW tRCFN6wt=F@Fvu*jWMGuG%1wGvPf~2u,G$uw!VWf~8tf~8uXjVWfF4fu9G$u3jjhf8F }BFfF4N6fF8OFP$@|/uT F@$/BF&@PF@PR;UpPf~2u"V0BvV$Gf~2uG$w evF6tFG$u0v tAv HA-vv 1'vF6uhjvW t O% ~tfF47e[^_UUwE fP81v?AÉU WVS}] ttA7@G%f~4 u Ff~4twu O%f~2uF8/tG$tSW\GMvjjh6ƃ|.SW0GV uVGv1e[^_ÉUE$Ft vB:uCtBIu[^ÉUWVSE} ÍpvCvA8t uv)[^_ÍvUWVSu >=uFHEEPUR&ƒt5}AװH;EFBu1;t vG;u=;u-PR̥Ã=@PÃtlPS5e=D}UB:t:=u+EUDP蜣U u8EBMAMt:=u=BvFBu1e[^_US]EBuEPS蓦uЋ]Ív$FreeBSD: src/lib/libc/i386/string/rindex.S,v 1.5 1999/08/27 23:59:32 peter Exp $ST$L$ 18uBu[ÐUEÍvUWVS]j(gǃ6hMƃG w$t, t,N PV@FO WGFj8P38EEEE EEE=t9~؉E]EEjhXP@S%EPSi u蜥D@R@ЉÉ^S_‰V t/XSPR誦FGFGW5hhp61[^_ÐUWVShPduvE[|xPjÃ}诤v~19}2:A9|PSxP|PPX[^_ÉUÍvUEU @$JPRA ÐU VSu} ^$juuEPc{tsˠCC PEP)tC CFCF4vEC PEPCCFCFVfe[^ÉULWVSEX$@;Cu 1CEEjssuV莐UURV^gǃ tajEPEȉEEEjV@Ѓ EPVgǃtUCBCBREEP]SfEԃxt S@Љe[^_ÉUVSu^$s?{ts+v$~tv Ve[^ÉU,WVSu]~$jhGPSUVS? tF PS+uh{bCS@ЉCxt S@Ѝe[^_Ð$FreeBSD: src/lib/libc/i386/sys/Ovfork.S,v 1.11 1999/08/27 23:59:37 peter Exp $YB̀r tQcvUdSUE Åt C}fEfEUUEEuuEP5…tEЋ]U1ÐUdWEU fEfEEEǰHEEEdEEEPREP4e}ÍvUSu*9u9tT]ÍvU WVS}(uq=$t W#G u!jjjwG(ЉÉփu u=_PwTG tG)փ0t#G<)G t?tG)‰Йփ=$t W#؉e[^_ÐUSE8eX ;E{ts{ts֛{ts›{<ts<讛{DtCDP蔛{HtsH耛St]ÍvULWVS}uE EP EȃuURh-vM1G }1EEEE %PhQjEPEPEPEPE0 t(PԿPhThpp/NEԃxt(hph=wAU=u蘿EPjjjÃu hmÃuh]uju tjjuh]h'Ãuhw]h~ jMq&u60wPEphhp. hAU2G uJMQEPJu3UȋB E8tEj/MQ NjURh%j/EPNjURMQhU2UtPRMQF005vPEPh hpA- hqumjE̍e[^_U WVS}} u}E EU PBRE}~؋E 8h賙Ã}t t;uE4荙Ãt;uhrÃt;tj/StjS]BPqtƃB}EE4Ãt;uBjS]BPtƃBE}~;v}t*jE P]BPsƃBj/E P*ǃu=EjE P]BPsƃBE}~E/u vG/tv+u ~VE P]BP+sƄ3BE} ?/u E E 8/tG?t?/uE 8u}+vUAPBR踡E}~؃}tEP&EU PBRpEP uA;]}0vBPBR5S C;]|1vE}~ e[^_ÉUSh@hCv Ph@t=hhC^ PhCF C~ vC~C]U WVSEB E=,udhƃtDu;Ѓ+=yVHr,u_v,EPS u E8}u.SJ1u߅EPJ}u.Ss1|߅EPs}u.SH1|߅EPH}u&S91|߅ufEPe}u&S譗1|߅u:EP蒗9}u:S=1|߅uEP" SEP蟞v1e[^_ÉUEDDhDjjhC5DhDPMÍvU =DtDUPWSUE]CE8װHPREP}WjS至 |muuuu uWde[_ÐUWVS=lMu qt^=Mt@MM pME2j]EPhpMLR]E@P~ u1@M8+t8-uu=uhhM%@M@MװHPhMRQM hMs8@Me[^_ÍvU,WVSu=lMu ZtE1Ѝx~ 1vW]EPV?Q]EGxPtà u3=u=thPVh@MÃt@M8+t8-u1ۃ=tMu91t@Me[^_ÉU0VSu=lMuu1E3uj]EPEP|P]܍E@Pà uD=u=t)Vh^j]SQhaSh@Mà t@M8+t8-u1ۃ=tMub1t@Me[^US]pMMt j@tM]UjÉUpMM=lMtlMP@lM= t" P@ ÍvUSztnjjjjS9lM t #D=DuShjI1]ÉUVSlMjURuP@ Ѓu3uE;Dv/DP5DMDu 1vD@MFCuDMFCujVhHMjVhLM jVhPMiTMFCuXMFCu\MFCu`MFCujVhdMjhhMVMe[^ÍvU(E4EEMAlMjEPQRB Ѓu{Eu7=QuhQ uG5QTQ Q= ujjhXjj ÐUWSUEPEPװHPRh5QO u]uuhEhEEuZ] hEPthEPu1e[_ÉU WVSuE ]}8+8-SPh Ih IEhEPà N(hEPuÃF(u9u-hSt6tF^N(hEPÃZF(uS@FN(hEPÃ#F(uS F N(hEPÃF( u^N( hEPvÃF(uS^>FN(hEP?ÃF)uS'>F$N)hEPÃtNF(@u^N(@hEPÃt'~(|^N(hEPÃu1)F)u^ N)j v ZÅte[^_US]EPhS u ,t#uEPhS u1]ÐULWVSu ]=QuhQ=QuShShhPPPHPVP5Q ti=QShhSPPHPVS5Q%0<Q=M4j:Džƅ5jWPGCS u9ƅ2jWPGS M@M8+t8-f.=@M7@Mx@5QVjP uS@MPnÃC 8VC 0*tC C 8u=ЍE@M@PVԦ=hЍHB jhRP@ Ѓ9%@M8-x@5QVjP uS@MPRÃC 8VC 0tC C 8uЍA@M@PV輥lЍHB jhRP@Ѓ:17:5QuÃ؍[^_UWVSP=QuhQ=Qu=MuR=$Mt5$MwEPEPh(Mh$MV5Qsǃ uXM>$MEPEPh(Mh$M5(MSV5Qǃ StM1vj:usÃtiE=t;EǰЍUHB jhRP@ Ѓu:!:5QuuEPTuu^uIe[^_ULWVSE8+Cǰuh@M5aEx@M=@ 8t{=t@EǰЍUHB jhRP@ Ѓu @ 뜐hP@ 0h@Má@ M1v=uEPEPEPEPuJЅuPSh ShЅuPhQ|hQ|]U,WVSu}}QEPQ=L Dž1hQ~PP߰HPStP5Qfǃ u5EPǃqyu&PEPuE PSDYEP} t"tE P;uXttVu5}t"tEPu 0PPPX1[^_ÉUWVSu tsVzuuVÃt{t nCC EV8ME8(jvÃjSe ((E hEPuEE]hEPOƃtfF> t> thVt)H~4XS+vUMSPV8 EUE}f#hEPƃVx u}t*EE8 t8,t8 t}t E81e[^_ÍvU,WVSv=Q=QuhQ5PP}HPURh5Q t/v=L QfEPh(hP u+uQv;#C; t; tC; t; t ; t;u)C; t; t; ;j-t@FPtB VPW5B߰ЍpDž| uN|\u NDž DžDPs~/PRP`5RQt VPS75tN50hW>tЍp DžB  URpДu C=Q50hP)>5061[^_ÍvU=$Zu t=Sh(Zxà t=8Zua1t(Ze[^ÍvU=$Zt5$Z4hJhL;$Z@ZEP5$Zj't18+uxtx:t=@Zu @Z@Z5$Z\4=PZu#hoLZt)PZ=HZu#hoDZu1HZ@ÉUjÉUtE8Z=:t>#t =pZt|\upZv|\u'pZ%v8?pZCB:t ::t:\u1t:CP5lZ ƃuV=lZtMlZ@ fÃt<85lZ~lZC&DLt(|t:tAB:t :|t::ujjPjE PPEP,ÍC wC[^_U WVSj=u ugÃu sjdTǃu0 KEd;?u BC$v;\C;:;<w$1tCIt ;/~;7~ZC2w?$l@v 8v 0v (v vv:vCCBMu()FdPWǃEd>;:t;t;^C;:t ;B)K}t)PWrDžE8؍e[^_ÐU WVSj=u uÃu jdSu mvd.vCBOu")΃FdPQtǿd;:t;uB)Kt)PQtE؍e[^_ÉUSj#u u…um:0uB:xt:XuB  1 vB< w  <w<w 9|ƋE1]ÉUVSu >:tF>:u^FPus^e[^ÐUSU}t vAzu$)ĉE UECtABu5Su蠩]ÍvUSU}t vAzu$)ĉE UECtABu2Su4]ÍvUSU}t vAzu$)ĉE UECtABuSu*]ÐU5u u誨ÍvU|WVSDžj/EPtEDžIE8Hh8Rƒu=װЃ$)ĉu1 R\8uDžMЍp}ЍxD7=vBjhOjEZVPj3Z jhXjZ vVSP/WDPEPD7 5E PP=wq$t1ҋE 8t BE <u$)ĉ$iD$PCPE P-5Shl}PPu uGDžhKP蝠@t> /v#x[^_ÐUEt xZ vxZpUE|ZÍvUS]EPu 0S:US]uu 0SvUEPuu uUVSu]=xZu jW5!h5xZt(uS5xZjh5xZ[ u *+Ph5xZ9 =|ZtV|ZЃVWUEPu uUVSu] =xZu j5!h5xZtuS5xZh5xZ=|ZtV|ZЃVVUE Pu0@ÉUu u0!ÍvUEPu uÉUS] =xZu j5!h5xZt(uS5xZh5xZ uz)Ph5xZ]UE PuÐUS]=xZu j5!h5xZ3tu S5xZh5xZ]ÍvUj juTÐ$FreeBSD: src/lib/libc/i386/string/strrchr.S,v 1.5 1999/08/27 23:59:35 peter Exp $ST$L$ 18uBu[ÐU=h[tZUhZj:j:h5l[hh[uvPUVSu]=$t VSu V(Ã=$t Vq؍e[^UVS]u 9sHr1"VsDJt CDsH1e[^UWVS}WMpwj 7C ƃtF)ËU O )_7_ECPPWO+EUWDP7RM]Wo uVwj 7 ƃu_롐F+EÃSWu)EGDUR7PDME)G7U GD E 1e[^_ÐU WVS}}Hw}utuu41=,uqh&JÃtQМuH߰Ѓ+=v ySK&,uvXv,5,SSh&SwT EPSgTh(SYT h2Sǃu WÃuWoOvWo{s4uSIs9u Sfs>u S FsBu S/ &sGt S3[^_U|WVS]EPCPP}}S {u0EEbS SjuЋEP* tUR1MMuЉuT L EOt PUB0B0P P 4 4 < < D D E׃4Ӂ4с4U::  E}~NjML 8 4 ЉL u9v EPML @ < ЉL u9v EPML H D ЉL u9v EPEu8 UDD DAuTL)AL D L E9L )I~0}D; IED EMU;4 IEEu;< }KU@ UDDDDEuM;< |EUE;D }HMH UDDDDEu;D |UP L ;EvMQ vuVB1[EP u ǀL U4 u ǂ8 M< u ǁ@ uD u džH Ex[^_ÉUE@(L@,481ÐUVSM] uu 4P05Av ww 4P0I  At[^ÍvUWVS}] E~9ust/'tV~ CJ[^_UUvR1%v44ÉUUv R0 44%%ÉUUv R0 44%%ÉUE%UUv RN0 44%%ÉUUv R0 44%%ÉUE=w%1UUv R/ 44%%ÉUUv R/ 44%%ÉUUv RJ/ 44%%ÉUUv R/ 44%%ÉUUv R. 44%%ÉUUv R. 44% %ÉUUv Rj. 44%%ÉUUv R2. 44% %ÉUUv R- 440%ÍvUUv R- 44%@%ÉUUv R- 44%%ÉUUv RR- 44%%ÉUE=w$%v1UEÐUUv R 44ÐUUv R6 44ÐUWVSE@( @,L u PUL C; t; tj$;EuMQ< *v1jEPS9F‹E;]t]uEPC; t; tjEPSE‹E;]t]u URDvC; t; tFwjEPSE‹EP ;]t}uMQ;u;OWEP #v L u u;UEL MǁP $ 481e[^_ÐUWVS]1} tC4L }%tu 1ɉ΋ ;M v}tE4@0Pv|$~Iv CI}tE4L P ! [^_ÉU WVSM] }4L #r !M;ru`4L p9ur7tJv E CJv4L ;pu 09usZѐ4L ;pup9ur"4L ;pPp 9urCJv ECJt[^_ÐUE@( @,481ÐUWVS]}1} t_]w;M vt4@0Ix CIyt[^_ÍvUSUM E]f}v.Qt ttA t 1[ÐUVSu] SV 3tihCPV9tPCPV1t}-E =tGUE9|81VW}SV UEF~̉:E v!e[^_U WVSE@U9B0uEh+ƅtvEp0@4ƒ@7OyU21KEx4?URp0`,ƃt#7WVS0Ep0UP41ve[^_ÍvUVSu] =,u=$t S荲C u2C tOC t"Su9c CCK {0tCC;C4|+St=$t S5o CLvc ߃{t;Cv@9u C)CC<C8C@C0C4SBCBC=$t Se[^UE@(@@,4481ÐUSM] Ut9vvt/ tvtCtAvA%=uhtA$ACA%=u@A%=u0tA$ A$? ŠA$? ‰tA 4@0[ÉUSMU E]tKv2t $ $? B$? Bt vtjvt<v#t$ $? Bt t&vtt tB t[ÉUVSu] 9u1'[[h[h[u)؍e[^ÉUt)}u#}WEPEPV u>t}t;t+}u%}WEPEPSu ];t}t}t-}t'E;EuD}u EU)‰U>t;a>u;t)>t;uU+Ev>u ;uEEUR&EP&Ee[^_ÐUuu uÍvU,WVSEEUUEUvR v44%@uƀ}-uEEEvE}+u UUE}t}u'}0u!E8xt8XuURUEE}uE }0uEEEEEURPjj=EUEURPjjEܾEE©v=w%1tEnUvR 44%]ځvS 44%tCCEE;E}y}|;}wu;uw;uu;}uE;E~ E0vEEӋEËEEΉƃUUEU€}}连"v}tރ߃} tE}tEHU e[^_ÍvUuu uÍvU,WVSEEUUEUvRXv44%@uƀ}-uEEEvE}+u UUE}t}u'}0u!E8xt8XuURUEE}uE }0uEEEE5\=`}t 5T=XEURPWVAE܋EURPWVXƉEEEE©&v=w%1tEnUvR 44%]ځvS 44%tCCEE;E}|9}wu9uw9uu9}uE;E~ E7vEEeӋEEËEEEM]EUUUEU€}}7\`EU}tTXEUƛ"}t ]U]} tE}tEHU EUe[^_ÉU WVSuE EVURte>;}vE8uVuubUt tQu VËE uhhp31avVjS@$19s(}t"jSURU҉E]F9suߋE8uU 2 E Ee[^_ÉU WVS}] 19s'vjSEPU҃u1]F9rܸe[^_ÍvU WVS}uyua=,t[5,SC+hS+ EPS+hS+ hS.ÃuSjj hPuePuOSjh h`eu5Sjhh`KuSjhh 1tSF^SF` 1ɿ`a` vA:9u<2t` 1[^_ÍvUWVSuHEt>uhE}EUURÃuhjGqE>t}u؍e[^_ÐU WVSuE UE = tSv߰HPSVPu%߰HU C UC#;u`UdUe[^_ÉUuguhjGÉU WVS] w0!װHPRj%jhj% ډװHPSj%jhj% V"ƒӉ߰HPRj}% jhji%EP}%U WVSuu u1=$tEP?Ex}@u}LSE0W=E)ރP[A t$=$t EPE)1u } tUt]E PVSރ>u}~u~u ~ >ub~u9Ft(>uF~u@~u:~ t49F t# EE U1Iv=@|uB1ۿv<8tURURU RV8ЃuC~1e[^_ÉUuÐU,WVSEE}u1E8t8ЍPMYt*;t%8tǰE;u܃UMTEH MXtEuEE‹ETR EuE 1/uU:t*M12Vƃ vUEEMAUZtLE;t@8t0MAU4BU3V:ƃ;uUBMBtUBMAB A qZtEEtE;t2vUBM4AMEp 3Vu;uыUBMEe[^_ÉU(UE MEAQu A  A EAEEEuQUWVS}u E w} u EgE쉅$UuU $EB1Dž(vE (uEXtV Q;tLU v1F9} 43􋅘P-x[^_ÍvUlWVSEPu1C1􍅬P9ƒ}uEPRvEPREPu}M 􍅬Pƒt{]UEC1 EFWƒuEECE C CEDžEPSÃ&PhP􋅠P,؍[^_ÉUU 1uu juzWt uPÐU1}u#ju ubWt uPÐU<WVSE UUE} t(}tv}Dž  Dž,UBЉUB%Dž@\Dž փ ;EtU;PRVPURà P҃t;vU}t}uJӁ~UEډ)EDž\\UBDž[[BDžDž;}RPVREPjà R҃ލF ;VǃV VÃ3;vU_3t v}t }$\fhPVREP{à P҃;ӁZ);."PR Eډ} hWVPURqà W;;pdPR );}; t"vfRP:lRPVREPmà REEERE0kuqU;Z uiu-E‰)=@|r u[rcSPVR)ރ;tUv7vu~;s t{E8u?};B:URPUUEU E1[^_ÉULWVSDžDžDžDžE h*u Dž}?t?.uG?uDž;}v.ЉEP+ ǃ<hPvjW ~v~uU}uUUR]SvURPP t*URSrURPP 6_Dž+9hWvjjUR ~p~uU}uUUR]SvURPW t*EPSURPP 6fUu=h*| }oi*bDžDž*=*AhWvj0UR ~p~uU}uUUR]SvURPW t*EPSwURPP 6`Zs8=Ut t2*u#!vu i*u8t u i*@hWvjjUR[ ~p~uU}uUUR]SvURPWe t*EPSURPPq 6fu-tU=vtU& Et U1[^_ÐUU t>t Gt>EE@E EE@EE@uPuXÉU,WVS}uUf=h*uy},M}1EEEU U1E|}9}36؃A.A%A.AFO;u |ԡGKAcv fÍf0A v]fӍfЍ(ˆfЍЍf0AfӍЍf(€0A.AFO;u /OOBABAB A hPj jPBƃ TEP]Sj PVPL t9UUM MEUDžMQS1[^_ÍvUh*u D |}t h*ÉU%h*ÐU WVS}u =5|5`,?@Åt9{utVs uك=`,u?|؍e[^_ÐU WVS]ufh*up u ,ch*tSE PEPh`hWjjjSE PEPj(Ã0~"k*@tEPhWSr Ã%h*t hz蓶,EPEPSPwÃ}&h*t hP,Fu Ffuwh*t!F%PFPhFw-$,",, ,v؍[^_ÍvUWVSEEEEEh*u u ,v/l,1E8t 8.uG@8u1;Ev x.؅u3URt URURURU RPE+9r5EPUREPU RjEPY C,UEu=h*|i*1۾*=*vEPUREPU R6EP  k8=,t t%"uEUBuECi*uC>ty}u/u i*@u"EPUREPU RjEPL=}tU,'v}t,}t ,e[^_ÍvUWVS]u h*uu ,h*t%EPEPuPSh uF߰ЍpTNx <.uVSS-ZvR߰҉ЍD=~,5VSh$P uuEPEPP[^_ÉU WVS]i*Bh*.ph6PaǃUjWYE!vRv44%@uF>ù>SP`[FvR/ 44%@uҀ>^~t4vRv44%@uC;u`hVh`|+W>`|.vWhP觷W 1[^_ÉUU h%PRuÉUWVSu}}t}w} mv=$t VsEV~0tF@9F0tv0F0FF^ }v\}taEPEPV Ãu E }} uZWE uDE;}t}WE } u f^ FFCFFZˀ;}t}uf^ E F~t tF؉Fv~ vF,=$t VQrEe[^_ÉUlWVS}$u(h*uu ,8h*t EPURE PURh@Z  GG}f**fE$gGh*$gGg_ }Em} }tz}neEPEPVSU R7 D)ƃSEP趷SEP襷 UfB} }EPEPVSURȵ ÃSj LSEP; SjSjUfB E 9|vCSEPSEP׶ Sj讶SEP赶 }tEPURS]UfB )e[^_UVSEu 0U)‰Ѓ ~_CSj)DSEP3CC SjSj F @fF )e[^U|WVSDžDžDžDž=`*u `*=d*u d*h*u h*f=*u t f*t*q*5fr*p*jhp*h`'l*%+ ++;hcƃhVh* +*5**Dž=*t|=*sa=* tXv> t> uDž%vt0DžDžF>t%=*s > uF>t> t > t> uhohqP8;#jhPU t  p t  u F> t> t>B> 9hVh*+hh*Rƃ tDžjhPT+ t   t  u F> t> t>> yhVh*+j h*Uƃ t*5**Dž=*t[=*sE> t> uDžvt0DžF>t=*rF>t > t> uDžj hPS t   t  u F> t> t>6> ->t8vRv44%@FC;uȍ1DžDžj5hj S4PPSV zzw"`'rrP`'1 󫋕zw#p*rrP.p*DDD 2jhPQW t  A tF> t> t>^> U>;L1vRv44%@u(F>t"Ph`Qu >;t>}PW+Qh`hQF/vRXv44%@uF>t >;t>}PWJt+"􋝌++ǂ(+(+(UPWj蚷=ǂ(`'    (F/vRv44%@uF>t >;t>}‹&t/u+W-ƒ SWj贶t|*1vy ٸCGv؋ǀ+ǀ+ HjhP.Nu) t  uhPRhP ~ l*%++􋅠P=*uChS.!u(j.S4NƃtFPh*u***2t i*$h3ƃthV h*1x[^_U WVS}u h*VSh諠{vC; t; tjhSLuRCP*$%++ +h* +Ph DvjhS,Lu9h*uVWh  h*hAjhKSKu i* j hQSKu i*aj h[SKu i*Aj heSxKu i*@!jhrSXKu k*@C;t; t; u;e[^_ÍvUE|)%=tÉUjEP,13‹E3E1%ÉUEv ÍvUVS]s{tsSu׍e[^UU:t.Ej EPR}tE8u v1U|WVSUE}EEE]ECCC CCCC}u} u (zzzzt EBtttEv߉{tZ{ tTE=|DSE;u-xt'xt!CM;AuC ;AtE CEE8}% =t=Iv= u {tcv{t {t{uB}{uCE PS Eߍu}E=.vߍuE8CU;tBt :CM;AtAt yC U;BtBt z{uMC{uExt@C{ uUztBC }uEPM QSEPE PURS'E}}tMytE@EtxuEU:}CtEE}uE1CtEPf  vE=ߍuCU;C;BtBt zC M;AtAtstyui{uExt@C{ uUztBC EPM QEPSE}tUztMIMtyuEE81}tE}u}t EU1$E}t uMEx[^_ÐUVSu1ۋF=t:t @8t:u#uAt 8tA8uAut;u1v[^ÉUWVS1ۃh&h6:vƿ(t9ƿ.t&ƿ4tƿ9u\?Uvƿ?tƿCu\<ƿHu \,@CPz7&PhP跞P|\vC~[^_U WVS1EEUREPt 1v=u61ۿ\v<:tSEPE PEP:Љƃu6]t#vjURSƃu[uᐋEU1C~}t ue[^_ÍvU,WVSu} EE]jjv7)}M8t1vPWVuكvttpPVoCt#vpPVSCu %jWszÃu EUb}t u؍e[^_ÐU#thPV1ÃthSV{1ÃtDžCt;kv; t; uCCvރuhSS1ÃtCVU RC1t;u}uEPEPjPt0UtQSR[uы[^_U,WVS} E]h&hVƃu QCtt[t{uEPWVu҃V}tUE1ve[^_ÍvUt8tF8u 1EEF89~ulWƒtZFM4REPCu ELUt6sRBE؃u,[t{uE܋FM܃<uUE1}t ugE؍e[^_UWVSDžDžh*uu ,Qv] sfC{hPjjjs sEPjƒ0~%k*@tWhPRƒ,WPRPƒ|Fu FfuFF%S*uQw4$dv,",, , v[^_ÍvUWVSE @EEEEh*uSu ,9,1E8t 8.uG@8u1;Ev x.؅u'UR{tU RPSE+9r(E PjUR5,EEu=h*|i*1۾*=*tzvU R6EP88=,t t%"uEUBuECi*uC>tt}u#u i*@uE PjURH9}t E,$}t,}t ,e[^_ÍvUWVS]u h*uTu ,uH߰ЍpwVt!N<.uVSS-ZvR߰҉ЍD=v,*VSh|P uPp[^_ÐUME EUB EjjEPQjRt1vÐU WVS}ƅuKvV;~tWs8tՃ{uVj61e[^_ÉU WVS}u \ÅtJ؃;t/v98u PvBAuS)8uԃS51e[^_ÉULWVSEEEEEEEEEEEjjEPjjEP }1vuѹE؃u踹ẼlP虹E{jjEPEPjEP% UUUԋM؉M9 vEЉEȀxxEĉB MUʋE܉D]ȃ`U#BtQ߃u6{u0SMM܍CRPQECE܋M̋E@E܃?t H \uEU;luFlP芸ÃtqlPMQSӽEP_] UEЋM9ME<U܍:P+Ãu"3+nv3 ^vMQPEPy]1;u}%MMMDЋMDF;u|ދUMD}tEP蓸}tUR~}t MQiEe[^_ÉUuKÐU WVS}=xE |5`,Wv6WMt&^;t:3W1t ;u} t!E Pv t ƅu=`,ux|e[^_ÐU WS5|%PhhPo | =uh4PP߰HPSh52 tFu;PP߰HPSh5e2 t19hhu b[_ÍvU WS=uh45|5xhhSx| PP߰HPSh5x1 u9hhu {1[_UVS=uh"3t1=puW=t5EPEPhhh53ƃ uSpWvEPEPhh5Sh54ƃ S蟴tp10uuhhu u_e[^ÍvU=tuhhk~t5twE `,ÍvU=tt5t7t`,ÐUVS=pthRt =tuhh}tt!5thh9~ƃu1e>+u[j);tJ=xth'=th hP>#nhVe ÃS5ĄhVA ƃ/F> t> thV ÃCV%̄ЄȄƃhSÃtBCt<;t7; t/; t*hsvhSÃtCuĄe[^ÐUj ju蛻ÐUSM4D H }'B+v1;}; | ;J~@;|[ÉU WVS}1=t4Wu vF<u1e[^_ÍvUWVS1h0h2L{#hAV~Ãtz;ttqvR<v44%tStGhAVÃt;tt~PhPzt $P.[^_ÐUS]h*uu ,1(i* tjSu jS]ÐU WVS} 11=uZ.St$rt t(819WEPWEP{WEPÃFt؍e[^_ÍvU WVS}11=uf_t(rt t0D1EWE PEP&WE PEPOWE PEPwÃFt؍e[^_ÍvUS]SySX]ÍvUlÉUWVS}u11Ɖ@M A9uu1@ u։[^_ÍvUWS]}t^(/=u'h+t,1jEPEP߰HPSu 5,) t,1$uhu=nEu&] j uÃthu{Cu薇¡ C; t; tǃhSÃtACt;;t6; t.; t)hshSÃtCue[_ÐUu hu'ÐUEuh0vPÍvU=uhhu5oEU=t!=u5ÉUVS=u/hhuu,15hhuƃu,1l>#tǃhVeÃthVKÃtChVjn~UvhVjHQi* t$hhZ vЊ̊ȊvC; t; tĊƃhSmÃtACt;;t6; t.; t)hshS2ÃtCu,e[^ÍvU WVS}j#^;tW3t-;uƅtE 9FuW6ue[^_ÉU WVS} ujÅt9suWEPC0袉u~؍e[^_USh*t3#u uSl#]ÍvULWVSE DžU0E} t% }t,}"Dž  Dž,UBЉUB%DžDž փ ;VPURsà ҃st;c}t }u?vӁ40)‰UDž``4Dž@DžDžd,;vVPURrà 9҃ލF ;>VatǃVSt }uuVtd,vVtÃ3;3t}t }hWVREPqà 8W҃!;EӁ);P0} hWVREPpà |BW/rt2;V;~"vP3)v;}tOWPEPPjPURh@j%; 0{v t# [vJP/tURVPURXoà otx;u0/svӁ~kv)Wv50(t%50hj% ރ&v;<tu'0ǰ))Љ=rSh~(r,ij#hRSVYb)ރ;t+vWhru~;s H+t&~}uPh=0uM};iaURs0)i* tPPh0ew,0 ,1[^_ÐUEtu8<v8<Puu u%ÍvUWVS]u h*u茷u ,#tt(,/58<j.SuS蚰ƒt=w%v1 ڀ;{.hSVyv2hSh{DžDž004``@i* tPPR\u,0=w%1u:.uB:uӀz. =w$%v1tj:S7u ;:ڀ;{.hSV-uhShwzDžDž004``@,=w$%1u ::t:.uB:u΀z.,hVWjS褪 |%WSPV*,,Ph1[^_ÐU WVS}h*u/u,1}uI} uCj hW|tj hW|uE EE }t }t v//v;E t,1wv}t }t0vPGPGPGPhP襝 P>%P>$%Ph)SrÃNy֡04C vhPj jP9ƃ } Vh8vVh`1vj PVPÃu1qECE C PhEPN[}u)i* t hhqCC ,؍[^_ÐU\WVSEM1E 9E}v+ЉU1;us:#+9+t(+л+vF9s#9+uEf4x}u~ Dx9}}G;} |}t\] 9]}TvuNx@Mv6u f; ~& f f< ED]TNyEE 9E|[^_ÉUh*u t}t h*ÐU%h*蟻ÐUVSu];s~s~Vu 33)s1e[^ÉUEPu uÉUl WVS]u tShj#كnu BjjhijR7\ǃ 􍅸PCtShWl, PPhRPhWA,  tWāꋅ+P=u!t5hW+tPhW+=thW+hV@jjhijP [à uNWоv<%u(~mu"FS􋕨RtP_vSP`FuSj_Sqƅ uVW-WK+  tT)‰Ћ)‰DžDžjPjy=$uj P5 jPW5RajRW5(a}vtmjjh;ƃ|Sj>W@))‰SDžDžjPV藢 V连[^_U=t5藞 ÐUVS=u/jjjjjP8== EjEjhhu]SqjjV5d % uPjhhSpjjV5, % u5藝x[^ÍvUEUtE tut$ÍvU5  ÉUUtÐU WVS]u EFt7ЍxCu1:EuWVS`uK؍e[^_ÉUWVSE} " Btpv9u Bu@u1[^_ÐU WVS]} vRdnƃ444GvR:n449u Cu1QvRnÃ44Wv Rm 44)É؍e[^_ÍvU WVS}]E EvvRmƃ444E@EvRXmv449tWvR+mà 44EPv Rl44)ÉCtO>1e[^_$FreeBSD: src/lib/libc/i386/string/strncmp.S,v 1.6 1999/08/27 23:59:35 peter Exp $SD$L$ T$@AJt}tm8ui@AJtnt^8uZ@AJt_tO8uK@AJtPt@8u<@AJtAt18u-@AJt2t"8u@AJt#t8u@AJtt8t )[1[$FreeBSD: src/lib/libc/i386/string/index.S,v 1.5 1999/08/27 23:59:30 peter Exp $vSD$L$ 8t@u1[ÍvUVSuU ]u CFl vCB3s sߎS֎Npe[^UVSuFltXPjV؃ue[^ÐU WVSEpl1EPkt(E;F|^VWEP3܍vvՐe[^_U WVSu}~pt V~p~=1ɋFltv9P}P@uAVKj֌Ãu ltPE0訌Cu3蔍-7膌Cu$jr3h S\PjiCUCS PsEp)N 7swNFlC^lFpe[^_ÉU WVS]} uSM[ltOv3W u;CuPsvm[utC UCBv1e[^_ÉUEtt.tt 1)!Phh@蕎@ÉUWVSDžDžDžj/uuǃ=tB9=t:5l,t&~`t VAV裋ރul,=} t E }t}u 5l,6tFPu{uu4jt&ƃjtVF\FhDžPPv\7tu f;FdtM~\WÃ~`tF`PPBЃFhF`WSHS蓔 ~hG~`t F`PPBF`F\juhhhS. jS<ÃjSd8#DžDž jPS腗Nj9tS臓VhjFHPFIFHFLfFJfFXS>(S/Fh@,~`t F`PPBF`F\jSlƅDžjjPjhSà u:=@-=@- =H-=h)f=v{CS@g  DžKRPPhURhjSЉǃ tFCS@Fh uh@hpatKCS@Fh  BPRYdCS@ЃjFHPFIfFJFLfFX FhjAuFP~`1  DžF\h hF\PRPjhFHPvF` uhs'Fhjjv\YuhJDžSSv\tƅ PSv\7ufFd/vF`PPBЃt V訅 $t l,5l,} tU 21h[^_ÉUWVSuE~`tuEPEPv\t}u Ef;Fdt8^\SǃF`PPBЃ SWW F`PPBЃF`F\FhVe[^_UjuÍvU WVS}1l,tHCPW迥u,St l,SP ދue[^_UEU@PtMU2Pu^DMM1EPEPt v UEj ]SE@`HE؋URPShEPhjEp`ЉÃ0t)hEp`#uC cvu ÃuOEU@P肁MU2PulCMM EPEPuuEPh{؍e[^_ÉUS]=uhh^t 1]ÍvU6.& ÐUS]=uEPuth't1h']ÐUU hBPRuwt 1U,WVSjEP EEUREP\u!URh$pE 1*}u"URh$pE vUUtvE@PuǃuWu7E8 E@PuÃuSu7E EPh$o5h,uSuWURp,ЉƋUE 0WevS\v 8vEPh$oU EPh$oEU e[^_ÉULWVS} ]$1=uEj tEt"DlPtƃu0h hpn @- H-DhFXjEPUfzu(jEPU REP蟃fgUfBE@pUFBF BFB FFEUFV F$F(~T^\F`Fd33E3ẺEEEE E܋UUjWvX^8SeEPSh F]u~tuE0scvFP^LS@ЉFHFPxt S@ЃhhdVuuFLPIRG0w O  t Vht W{h1e[^_ÐULWVSEXsLS0UE{u E U$CS E}u } u}$tEC$U ẼVsHC0PVB ЃtDFU RV@Ѓt-UP VPBЃtEPVU҃u{$uC$jVUlEPVUuC$Hv}u 18v} u}$uC$vt,t,E܋GEGEEEVuTEPVZu{$tvU9UuC$PEP[{$ukEJ EPRAЃuC$C(#vuVU҃u {$uC$}t8EPVX#mrUP PB ЃC$e[^_ÍvUEM PB$B(AB,AÐUSE] M@PL@LQRӋ]ÍvUÍvUEMPE H&$BB BAB BBR QBBABAB A vB0vtvHB0teB@]tRB@Jt>B<6t*B<"EEPQ2μ}1ÐUVSu^{t 3bnSPztCLPBЃS&dVde[^ÉUWVS}u 1nvEB=~=Z Sbƃu 1SjVguhV7jxP迹MAQ PT`} PTptpPjjV@PϹH LjhP0hx)‰`l|)ȉC}`C@B`}W)‰XXCO )ȉB} XB@BX\PTP| uTu DžHHt-Hu\E9t V,b}G$8E9t VaE@$LP(SMQu }7 lEtu-G(6G$E/UB(B$E([^_ÉU WVS} u~=VWE0kÃuUB(B$v)߅ċEe[^_ÐU=uh`UWVSuEÅu 1vVEPVBЃu.Pu h hS²߰Ѝ\@}E$vu>Ph'+U)PSp{uƃhiSb߰Ѝ\ tVhrvuhvuuh@SWbuuhSCbEƀ ƀEe[^_ÍvUu uPhrhpaÍvUEv > ÍvUuPhrhpÉUVSuÅu 1v@- tuM5D-x5H-<P5@-TPVhXhS$5@-+PVhehSƃ ƃ؍e[^ÉUu4Phrhp8ÉUEv1pÍvUu uÉUWVSu uMDž|u|PVEPP^|jEPav^u+DžlDžhDžpDž|Et".%Džl)DžhDžpDž|~^|fukDžxxPtPhPlPEPkà jpPhPlPEPBà |||VEP:Ãfu]G8t)jtPhPlPEP E9t"|PVEP}8؍H[^_ÉU VS u$j@jFÃu 1 {<uxt, t,K PS@C SCC HujjC(PV^LSVHN C PV8NFV@ЉC:u~/t>/tj.Vt1u d&>:uF>/ЉDžsװ҉PSehSkf VS^fj.V# t DžtjV蠱LjVÃEPSbE%f= hPS=cƃS c RQ Sk} PWG RBGQ0G ?2LB5+r 2 ;GtU ;Jt)É؉)} WG@BG 91E ;p}+Ã􋕄RIFM ;q|1] ;s}1ځGM ;A5F;q|1] ;s}n} L􋅄PCB{CB;G FM ;q|1] ;s }%ځLGFE ;p |U ƄL1;2}>M L􋽄W'WC FE ;0|1U ;r}HM Lt"B Cz vdB F} ;w|1E ;p}FM LtBCzv 몍vBF} ;w|1h[^_ÍvUMAtƒЃ v,t -t+u߉ÍvUVS]ut= Ѓ w01҉TP9C Ѓ v;U| E 1[^ÉUS] hjEPut[U)9:uLAj;jEPQ\t(E+E9:u!AjQщU)Ѝ9Eu)Ѝ9Eu)EE}2;VNE1ۋM ;Y}OPu L*C} ;_}$;8Puߋ8L؉EE1ۋE ;X}SU Pt L+vCM ;Y}$ PtߋL؉E1ۋ} ;_}E PEu UЉUMԉMv}; }9};E \u#1tXu E+EE+EM Lڋ}<8tUvUCE ;X|MًU LǂPǂT}߉`ǂdE@h8EU BBMىLǂPǂTE@} G }t UċMDG }  /] LEPURS.)]C}tMQ}WS )E1e[^_US]Sh`8tjSh`]U=|5h jth DÉUWSh/MÃu =~ShUl߰H=%tShV;u= $lth`hlV?h St,;:tjh Sth 6e[_ÍvU WVSE}E ~t;F}1ҍP<t6B;V|1,;V}E;F|NvB;V};}2LWV3EP6SW CL|G(e[^_UVS]u 5VjS=e[^US]hjS]ÍvUVSu ]=uhJShVut C(q vC(Le[^ÉUhjuÐUS] Sjuh؋]ÐUhu uGU,WVSU1E IuP}썲LL};EuUB};D~E}tW~SA2@93u5u2B93u)E~!I:@9;u 2@93t؋EXIUU E.‰)ЉEU))E )yMQx vEQų )‹uV)))ЉF))EM$I)))ȉF}FEEM)Ћ}Dž}O+]؍؍؍G}GwuQ։U)))4EHyEEHEQmӉU)))))E}}E1ۋMu>QщU)Ѝ9Eu)Ѝ9EuM; }ǔu~NF;|MA)EAAu;4}E@}G G U W$[^_ÉUuPU8u EPuaPÉUSEM  9%1[ÐU WVS] M;| 3 Й։)Vue[^_ÉUSUM AZ)É؅u@AZ)É؅u2A Z )É؅u$AZ)É؅uAZ)É؅u)‰[ÐUWVSE}ԋu jMALؙ]u!!jVSqMуu E@UBz0t"Ѓ@9B0tr07MA0E` ߋ})tP'^u(U9zr :)z=$MQEP8"u$URE URPUrMуu"u=$t EPlSUz0t"Ѓ@9B0tr06MA0UBBb ߃=$t R1x[^_ÍvU WSE] EǰHEUBUE=$t S襽EPSǃ=$t S薽e[_ÐUVSu] =$t STKyC;C|< tSV+ƃ=$t S'e[^ÉUVSEPu e]ƃt+Åt huu辥} fC 1D7;Es5^SURW0]߃B;}v!}t M(+E e[^_ÍvUShPuu uAà t$uuPtÍvUShSuCtuuuu SÍvUVSu] 9s!@tсt t@9w1([^UEރ:w$v1UE߃]%ÉUUBvB ÍvUWVSEEU9EEU2u%t =tl~UBU9t.UPBUuǃPFf 9uWKuԋE8u@>u E+E _vU:u(2؃? Ћu ӣ(*vFTEE9E0解e[^_US] jEPu1C@ ~CCjSEP]ÉU WVSEu }xu]x uW@@ X;tA)B9} &)63X;ue[^_ÍvUEM UttRQ"RQ蓢/ÉUWVS}EEuEeShtZƒt1tB=wW}u/E}FE.u7}t1}t+FEGu}~UE v1e[^_ÉU,WVS]ECCC mEE8:u @E8:yUUEE2EvVW]uVWGt e) E܁}Ey:uG}}}u}]XC;EECE܈CEE-.s;uSUR&*}7G}*}tC;EvnECE܈C}t,+u9M)ى)ڋ}::C9~];]u"EU EBEBEB 1e[^_ÉU WVS߾fjSEPj؍e[^_ÐUEPuuEÍvUWVS]1菟jEPSs8"tM9]tHE4]tM<.u t0GC6v RX 44%@u1v1vtt&tIwʁ}wEpvw}w}wEUCw}y}l}_EU ЋU ƃ} tU e[^_USM4< @ }'B+v1;}; | ;J~@;|[ÉUS]jEPy} tEE]ÍvUME EUBEjjEPQjRDt1vÐG.v̀rÐUVSuUt$] CAuJtvAJuvJu[^ÍvUSE]|+;X}#S4u 19r"]ÉU,WVSu|;5X} yv跜}ٍ]迂)Ȋ8Cхu}-Chrh-E9r KB9se[^_ÉU WVSuӃS ǃtSVW%v1e[^_ÉUWVSuEFӁvR 44%@uҀ-u E+uF}t}u0u>xt>Xu ^E}uE 0uE1uEU1EÉ©=w%1tnӁvRv44%ۉځvSv44%tCC;E}=}| ;}wu;E~ EE}NJF€&}}B" }t߃} tE}tFU e[^_Ív$FreeBSD: src/lib/libc/i386/string/bcmp.S,v 1.5 1999/08/27 23:59:29 peter Exp $WV|$ t$1L$u L$t@^_ÐUu u\t1Uu u8t1Uj@u u t v1Uj@u ut v1Uj@u ut v1UE hPPuUt 1UE hPPu)t 1UVSu] SVtACPV,t-CPVtC PV,t1e[^ÍvUVSu] SVt-CPVtCPVt1e[^ÍvUVSu] SVTtCPVht1e[^ÍvUVSu] SVtACPVt-CPVtCPVt1e[^ÍvUVSu] SV\tCPV4t1e[^ÍvUVSu] SVt-CPVtC PVt1e[^ÍvUVSu] SVtCPVDt1e[^ÍvUVSu] SV|tCPV`t1e[^ÍvUVSu] SV8ttuCPVu1e[^UVSu] SVtCPVt1e[^ÍvUVSu] SVthjCPVt1e[^ÍvUVSu] SV`thjCPVt1e[^ÍvUu ut1UVSu] SVtCPVt1e[^ÍvUu u$t1UVSu] jSVtjCPVt1e[^ÍvUVSu] SV|t.tu"CPVCPVou1ve[^UVSu] SV,t-CPV,tC PVt1e[^ÍvUu ut1Uu ut1UVSu] SVtJt"wt :t#2CPVCPVCPVu1ve[^UVSu] SVHtJt"wt :t#2CPV'CPV[CPVu1ve[^U WVS}uE uSt uGjV3ËU uh`hp1u_SVtNCPV t:CPVt&C PVtCPVv1e[^ÍvUUE w:$v8 0 ( @PÉUUE tu@PÉUVSu] Ftt"0~u fSv4Sv FCtwt ( t!FCFFC FCF Ce[^ÐUVSu] CCC t{uSuLC);S|SBu+1KB;St C t uSte[^ÍvUSE] MUtt!RQS) vRQS}v߃/1]ÉUWVSU} ]BPBPBPPhuVv 9wVW 1e[^_ÍvUlWVS}1EEEUUME<M)ȹ)ȍ M E}~E]EEU<uu Ӿ Ft}t;u~]uE}~t}t;u~]u}t }E]E}t&M9M|E9E}9E:C}t:C}u\}uV}t}uJ}uAEЉ)¸.)PSE P:߰Ѝ\*EU4hS ÃE}?}tEEu:CCUЉ);EwRM QE 胁1e[^_ÍvUWVS} u]tVtACtJuutAu)H[^_ÍvU(UE EPEPÐUÉUSM] t$r t5;vEQEPQB#AURQЅt E1]ÐUSM] t$r t5;vEQEPQB#AURQЅt E1]ÐUUM trt"(BQR@BQR 1UUM trt"(BQR@BQR 1USM] t$r t5;vEQEPQB#AURQЅt E1]ÐUSM] t$r t5;vEQEPQB#AURQЅt E1]ÐUVS]u tGrvFEUBCRS@Ѓt^CURS@NCURSЃt6CURSЅt#E1҉Ӊ1ɋE1 Ӊ^1e[^ÍvUVS]u tGrvFEUBCRS@Ѓt^CURS@NCURSЃt6CURSЅt#E1҉Ӊ1ɋE1 Ӊ^1e[^ÍvUSM] t$r t6;vEQEPQB"AURQЅt Ef1]ÐUSM] t$r t6;vEQEPQB"AURQЅt Ef1]ÐUSM] t$r t6;vEQEPQB"AURQЅt Ef1]ÐUSM] t$r t6;vEQEPQB"AURQЅt Ef1]ÐUSE] UURPt E1]ÐUSE] UURPt E1]ÐUSM] t,r tFKv;%EQEPQB*AURQЅt}%1]ÐUu uÉUVSuM UӃt )؉Ã>u.FRQV@ЃtRtUFShV@F>u/FRQV@ Ѓtt"FShؚV@ >t1ve[^U WVS}uE VW6;uv?uwt rFtQgvu[u,VsËE uh@hp#)VSWvtS3E 1e[^_ÉUE hPPu-ÍvU WVSu} ]WVLt{t9t{u}u1$jEPVCvjURVUҍe[^_ÐU WVSuE t u߰HEEPV;E9Ew|UBt rBtNhtZu,RËE uhZhp迒5EuSV\ SE v1e[^_ÉUju u UhEU fEfEEEEEEPREP#‹EÍvUE@(X@,481ÐUEU} ut4@0 tH ÉUM U}ttEtA vtÍvU=@‹,B0B4B 8B<B@BDBHB IB$JB(KB,LB0MB4NB8O@=Dt(‹ B$B(D ÐUSEDh`jjh5phlPà u=lt5hbh؋]ÉUx=lt`Uj juuUSE@hjjh5hPà =55k¡ 5Q¡5:¡ 5 ¡5 ¡ 5¡5¡ 5¡؋]ÉU帠=tU|WVSE U }uuutVEP}щ=,5,SPhS URShS uSjS.iǃ DPW tPuP vPV螸ƅEPV|2PSW ;u;uwW@ugx u[PSU9|E9|%U R5V}E 1/DžVWU x[^_ÉUVSEu 19sj Ph@C9r؍e[^UWVSU]1;u }װ‰F;u |[^_ÉUVSut>u >v:;:-uz1uCBr=w%1t B=w%1tB  u 9tvCB:i[^v̀rÐUWVSuEFӁvR 44%@uҀ-u E+uF}t}u0u>xt>Xu ^E}uE 0uEE}tEE1uEU1EÉ©=w%1tnӁvRv44%ۉځvSv44%tCC;E}=}| ;}wu;E~ EE}NJF€&}}}tGo" v}t߃} tE}tFU e[^_Ív$FreeBSD: src/lib/libc/i386/string/strcpy.S,v 1.5 1999/08/27 23:59:34 peter Exp $L$T$QtLBAtBBAt8BAt.BAt$BAtBAtBAuX$FreeBSD: src/lib/libc/i386/string/strcat.S,v 1.5 1999/08/27 23:59:33 peter Exp $W|$T$ W1OtLBAtBBAt8BAt.BAt$BAtBAtBAuX_ÐUE9vMQSU҃ MQWU҃‹E} v؉E}uMMMEJv}&u]MNvu]MvCAN}}}E HEEEEmueE}uME}&u]vNvu]CANEE};}URWMуs|uqE}uEMMEH}&u]MNvu]MvCANU)UM)M;}EPURMуa;}wl}uMD}&uMvNvuMCANE}E)E}UUUE EE9E EEEЉ}ev}u+U Jv+E}%uvNvuCAN+};}vW+EPMуEEU9UiE EEEU+U+E9~Ѕ~E)ƒ}$]щNvƋ]ѐCANU+UE+E+E9vЅ~CU)ƒ}!ыNvƉщCAN+E;EvMQUR1uPMQE+E;EvU)‰U1uE e[^_UjuÍvUWVSEPEP8@$E%f=@tevjUR*[DžEPS{E%f=@t5enjjP<Mj o2it DžU tFPSl?1 t t 1ZDž1Dž1IRP輩c)؋NjPSWRƃ~)눉M ] tV􋅘POjURaY u+c􋅌P􋕜RC Džv1;sDu:ft3WG)É9׃9t˃t F뵐hdjVRDž1;t_tPCPT t {u E tF<u􋝈S$vPP+x x-CPxC tBCe BE BR+ B3a􋅜P􋕘R a1h[^_U=u5EUBEjjEPhjRetÐUVS]sSa 3Cs s SO S^ Vje[^ÍvULWVS}w``} TEEuUЉUE EPEԃu EEЃUREPU REPURE EEԉEEE EEЉE؃$EċUԉỦ׋E9FvẼ$E̋U؉U+EEЉE܉EE9Et Ẽ$E̋E+EEЉE؋U9UY9EvEPURU҃EEuU܉UEEEuU؉UE}uC E}t/u;uVEPU҃;E]yvEEE;SURU҃;E]E9EEދU҉UE0;]r]+]9vSURU҃;E~ދU29EvqvE)1uE0SEPU҃;E]vދU29Ew/}U2SEPU҃;E]ދE9EwҋuUUE9EuY}t/vUU9rUUEuyUBUG9rUBUGMuV}t.UU9rUUEu!UBUG9rUBUGMuE9Es U9UE9Es;}tUUE9rZvUBUGE9rBvU9Us7}tUUE9rvUBUGE9rE؋Uĉ$EċU9U}ЋEԉEЉ}ԋE EEȉ$U9oE9Eu!E EPUREPKoUЉUԃEP1e[^_UWVSEE}w1URMQEPURE $UUU v]MQEPSU)ډ]S]+EM D$UUʉMuU2PVMу ЉU;u{M<1 v};}s"U:PWMу%;EtӃJUM1+EE E}~E0F BKu+uu9rv}U<2;}seW+]SMу%;Et:U+EE E}~ڐ]F BKu+U9r};}r}~ +U]F BKu+U9r;urV+EPU҃~U+EUEEE Eu;ue[^_ÍvUWVSEEEU JUtG}vuvCANu+};}v+]WSU҃͋EEMue[^_É$FreeBSD: src/lib/libc/i386/string/strcmp.S,v 1.5 1999/08/27 23:59:33 peter Exp $D$T$@BtX8 uT@BtL8 uH@Bt@8 u<@Bt48 u0@Bt(8 u$@Bt8 u@Bt8 u @Bt8 t)ÐUVS]u EUM;tuQRPVS3vtX{u5t:wwX t4jh P2k"t:wBX qu1fSwI$@c , We[^ÐUu uhÉU WVS}jÅt85sGCGC { e[^_ÍvU WVSuU Ѓ  vߋt]9SutTC ;FuC;Ft7jCRP6CFFF;C }VwuS#e[^_ÍvU WVS}1  t!9zuRӋ݉F~e[^_ÉUVS]C;C| CuUC{u!CuCPss 3*C~'CK ufytASJs)։9~1AC9tyuCuȍe[^ÍvU WVS]} U0US>U8tuvU=kU0t%C$PSW&t E8 vE1e[^_ÐU WVS}=u EPu &ƃt5jjWh,Ã|ڃtE9tT1?#tfp Et uH fx@@$@,$@(h@ e[^_ÐUE URPjujhVUS]SEt K]ÐUUB f t1 ROÐUS]=,uCC C uMC uS vC t&Sc CCK 6{0t.C@9C0ts0C0Ct36m)KC =~L_v~tFC4~t F ~tFE~t~t ~uFCMQSu1e[^_ÉUVS]E H{4@}P(SDAK C$jP @PSpQ t QVS0S(uC,K@C<Й{@PC(;C~CPS e[^ÉU WVS}E4jWx-t JEtN04uуWt}u -JE1;}*8<0t40pC;|܃teWA}u1IUe[^_ÐUSE} tI?tX4t+jjS3,uӃSuǃ01]ÉU WVS}4aGj h ЉG@SW0 jjjVut6hSVat=t"HOH,Bv1ۍ8<2t"jjXP42W M uC~1[^_ÉUSEX}uuu jS Hǃ,]ÐUSEUXt$tGǃ,GvuGǃ,vuu uPSl]ÍvUSEX}vhGǃ,/tju jS"7Gǃ,]ÐU,WVSEp URUM MjjRQPmPEP@&EuUUXMMIEXUE9U.vf{v5)9EuuMy׋MHsEf{uAjEPPUR%EX MEEp f{URMQEPURMQUE EEEPURPVfju%PMQ$E~XEEUr E9E} w/} r)URMQEPURE E`;Ub,v} r,} t} vMavEXUf|SwjMQRPEPUUDSMAMECDK)‹MQEPURMQ>uEPURMQEPDtXUbSMQEPUR>t02vMaE` Ub1e[^_ÍvU WVSEUpt*t%t Cdž,$|udž$dž(dž 1 u^$ Cdž(;^(w#jjSV"ƒt zf?t͉$;^(~dž$A x(f|GuA=C=A>CEA?A@EUBA@BAABABEAC1ҍyD]vECDDCDECDFEDGVfEEQEQB~[^_ÍvUWVSu1Lhhxt#x=x~ttth Džt|uDž|x}uEČ}uNLECDž|xDžlDžhLUDžtEČDžx}t }h$胾à 1ǃEǃ|Eǃj$$Ɖso1 󫋅L9t ^FXRFfF IF ,JF`F܁FlS}tWE  tt uU RMQ.-vE  jj0oEPRE EjEP'}b1u  EddBEBEBEdEE``BEBEBE`EE\\BEBEBE\EEXXBEBEBEXEETTBEBEBETEEPPBEBEBEPE}b1}U=EE_xE EEdxu0Ex=w Džxxv Džxhu  ǃǃ xlt*xI#ltlBl!‰lx9lsllO1Nj1tffw fǃWjI uSh8NhJ3JStRM t!@E@t!}}"[vK5v;5Ot7{ts萺tSj18[^_ÐU WVS}jj7Jƃt jV484EP7AIƃt|EP7*IÃte}u_CCfCfCC jV蒽jV7MK jS7=K1e[^_ÍvU0VS1uh=Ã؅uPhhVB ]SV EPSj` V à t VljEPj1 ؍[^ÐUtt  1USEX{tjs3:JC u v2]ÍvU WVSEX{tjs3IC}t2}EPu S<ƃu[}uj63I@jPujjVS6?ǃ !@tj63JICe[^_ÐU|WVSEU } uRUӋEUBBCBCECCEUBCBCBCECCEUBCBC BC EC C EUBC BC BCECCfEECECCfEECECCfEC 1f;u/CEUUEEU܉U}ؐ֍ EfEEDSEDSU EUBBABAEAEUBBABAEAt?AE܋UBBABAE܈AE؊GGAGAE؈AfFf;uCQC @1f;u4CEUЉUẺEUȉU}ĉ֍ EfE֊E׈DSEֈDSU EЋUBBABAEЈAE̋UBBABAËAAtDEȋE@E@AE@AEȈAEĊGGAGAEĈAtDEUBBABAEAEUBBABAEAfFf;ux[^_ÉU|WVSEU } uRCfEC 1f;u1CEUUMMEE}vƋUB EUBBABAEAEUBBABAEAt?AEUBBABAEAEGGAGAEA֋MQfEEDSEDSfFf;uCQC @1f;u4CEUUMMEE}܉ƋUB EUBBABAEAEUBBABAEAAtDEE@E@AE@AEAE܊GGAGAE܈AtDE؍U؊BBABAE؈AEԍUԊBBABAEԈA֋MQfEҊEӈDSE҈DSfFf;uE̍ŮBBCBCËCCEȍUȊBCBCBCEȈCCEčUĊBCBC BC EĈC C EUBC BC BCECCfEECECCfEECECx[^_U$SMEUBBABAEAYAEUBABCBCECYAEUBABCBCECY A EUBA BCBCECYAEUBABCBCECYAEUBABCBCEC[U WVS}w~tjv6AFjW6A~tv贯F Ft%茯dždžt%^dždžV8W/ S;1҅tЍe[^_ÉUSEX{tjs3@C} te)C t11 tS"t3@u ]U VSujj6C>ÃtZEb1EEEE %EjEPS;jS6?1ve[^Wv\̀rÐUdSMU Ӆt S}EfEfEMMUUPuEPfE…tEЋ]ÍvUu jEPutUÐUjjEPuvtUÉUS]jjjSN1҅tډЋ]ÍvUS]jjjS&1҅tډЋ]ÍvUuÐUlWVSu} t}tC'l;tC;u+]K9r.% ))ŠK;XtύSU} u }tMvK9vC;/uEPV6/E%f=@t&} t.hh VU }*b&8tQ}thV`uָlEPVt&8%D];t79t3Pht@8u 0CӍvCv1e[^_ÉUWVS}jEPKEjjh@2à |jtEPS"SE|Džxw 0_ˈwxw|GG02G 0xx~X[^_U=u+1v@=~hÍvUWVS}u =u 1ۍvȈEؙE:C~[^_ÉUS=u       É[ÍvUM19s v@9rÍvUVSu1ۋM Itۍ1Fs%P))É[^ÍvUSM] 1iGuWEP"jWE0l(vESG9`SG9u.%CPWE PEPƃtsf{uECfKftSE PEPktGtIjWE0'}p1EjWE0'.jWE0'WEP,e[^_ÍvU WVSVj6E0k%ÃvfuESB<GtG PUR!ƃDCu^;u!fCUfCC SEPSUR"v7 C؃)RPP-"fsUCuWEPEPEPQ]SWWEPEPEPVEP ƅEBFf9Es'%U)PЍDFPЍDFPfFEUԋB tdw tbMVF)fFfJEB0WMQS2UԋCMVF)fFfJEB0}u M܋vEЉUԋE܊H CEЅuU܋PE܃ PSMAq ]S f}tEDF0vEPTPEP U؋CMVF)fFfJEB0MQ UԋC vf}tEDF0vEPTPMACMVF)fFfJEB0UBC/v}M 9u9] }uuQS]vuuE PURt}jMQ]3rjEP3b E,U9tv1ۅjuM1 ju]31ejEPU2jMQ]3 juE0juU2 Mqe[^_ÐU WVSEPEPƃu 1qvMfFUfF] CFFC F {u:]] C9u$KfFEfU]3E7ǃujVU21v] GCGfGUfGC G {t?js2ÃuW辇1pCjSU2[u]SVWE PURà EWU R9u] WYU EE0؍e[^_ÉUWVS}EPW#ƃtEPW Ãu1jEEFCCFfCfFfCfFU B C F uuSVRW‹E0EЍe[^_ÉU WVS] }UfCfCC4G t G WwFCfCfCC4E@ tBEP4UFfCc K jSE01e[^_ÍvU WVSu UMfFfFF0CF tuUBNj F)fFfFF0C7G PSGtbw MQuKiEP‹ F)fFfFF0QRSSUC vfFf N jVM1f1e[^_UuPvv36xF3C P66G GC }Ct.EPUREP PEPuM} u E!@tzC@U;Bv>:u PDvC@PE0wuPUC@Bs PU2lCUBUUvCUB É1e[^_UVSuEfxuyuA u v1A t@QB@uv@QB@tX P UEt6PPEPSV t vEEPu Ѝe[^ÉUWVSu} W;VvVr:t)‰ACsGv)Ɖ[^_ÉUWVS}E P;WvWE r:tCAFsGU ;Bs@[^_ÍvUWVS} ]ujWEPjGPEPE U;Es;>uutu65u |vEUEU> ߋFEjuE0ƃt];]v]SFPWjVU2<E)؉E u1e[^_ÍvUWVSE UMEUx MM]EPEPÃu ECCC fCfCu9vVURCP@}tMAjQE0g U)]jSM1A1e[^_ÍvUVSu] jSEPjSEP ju6ƒu \vB tjR6Bvju6ƒt)]BERV9]w1e[^$NetBSD: bcopy.S,v 1.6 1996/11/12 00:50:06 jtc Exp $vVW|$ t$L$)9rL$D$ _^ONL$D$ _^ÐUMU BB jR1ÉUVS]u t9j3ƒtB  V3e[^ÉUlWVS} uEPW<{uE%f=t1lh(jeÃt[1ҐDDD B~E 1RPEЋURP؉e[^_USEU M] $[ÍvUS]uhhposS u1YQE AAHTt HJ QACA CACA]ÍvU WVSU E;r1vE PURÃCHUL;t CBCACtXYK{tSC B vC UBS CCUBC BCBKvURÃ1E U1jWVz99Es&yU;t[OE CCE HULtXYKCUBC BCBtss$АCe[^_ÐUE U`P1ÐUS];t4 yt QA B A CQ AQm;u̓Sm1]ÐUVSut"vCtSVt"[u1҅tЍe[^ÍvUVSu; rrtlCu^CtSVtyCHT;tvCBS{t SC B C FS C4[uPkÅtCC1e[^ÍvU WVS} tE pp$ ЃU B1jVSw9u39u/E pyv;u U b1e[^_ÍvUU BE9Ptu1Ð_wv_̀rÐUVSu uVjÃt VS]؍e[^$FreeBSD: src/lib/libc/i386/string/bzero.S,v 1.5 1999/08/27 23:59:30 peter Exp $vWS|$ L$1~ڃ)Ӊك[_ÉUEPu uÉUS] {tSuP'CC C1]ÉUlWVS}M UG $fEGfEGEċG,EԍEEEEERQuVBÃ|VTtE@tO @؍[^_UVSMEU] t txv w K0 }K% )щʀ0gfffK)Ѝ)щʀ0u=K$0u}t(<0t$K0Kȃu lv[^ÉU WVS]u MEUυwRURPQS t#vwu wOjj VSe(0v(Ojj VSH(0jj VSb(É֍vOjj VS`0jj VSjÉ։ uOvO$0 u}t0?0t+O0%O؃ u Wkve[^_ÉULWVSkkDž =$tEP<UB tzu2MQNt=$t EPUB f uDfz|==$t RMQE PUR_DžM Dž$DžEuuEEDž t%%t  t%u⋝+tLS^]E}~EPMQ u DžDžDžDžƅ  X$Xuƅ 뵍v1ۋƒЃ w\BBЃ v⋅8$$u)0$$PQE Pr$t$EURAEv$t#$BvEMIvƅ+v *1ۋƒЃ w!v\BBЃ v⋅8$uw$u)0$$PQE P$t$ vEUZA5$t$BEMYWDžH1ۋ & \BЋ ȃЃ vԉDž1ۉ \BЋ ȃЃ vԃ$uC$0$$PRM QltR@Ft /" P$t$AEMA  tw$t*$H!EUBRt $uIj@t2$t$/EMI=$t#$BvEMI} ƅ- u u Džu Džt<$t$(ݝ:E MiݝB$t#$ݝBvEE@ݝ t+ܝEuƅ-Dž$v tDž(F  t _Dž  PP RPPQP,0 gt Gu?~9~E gue vDž g eA QEPV fu;~&u tW|9K@;|Njt%"+ Gƅ- tI$t$AEUBHtE$t$BEMA?v@tE$t$BEMAf$t$AEUBv t[$t.$HvEUBRtA$t$JvEMI@tF$t!$B^EEPEv$t#$AvEE@ $t#$BvEMIDž,߀Dž x$t#$BvEMIu Dž=|>PjR6t+;Ѝx tZ$t-$HEUBRtA$t$JvEMI@tF$t!$B^EEPEv$t#$AvEE@ DžD Dž, t[$t.$HvEUBRtA$t$JvEMI@tF$t!$B^EEPEv$t#$AvEE@t& t t tƅ|M tK u twQPRPQR=vu t1QPRPRn +x1  P Pƅ9}tt9}+~EXFEE}~EPMQ uX^]E}~EPEP]utFEEtcƅ0 ff FEE}~EPMQVu%=+~~~ChFEE}~EPEPkuh^]E}~EPUR-u)~EhFEE}~EPMQ`uh^]E}~EPEP"uu~} eG݅D@UFEE}~EPEPu;|FEE}~EPEPKuKH~ChFEE}~EPURwuh^]UFEE}~EPEPuFEE}~EPMQ`uۅ~~~ChFEE}~EPEPuh^]E}~EPURQuFE;FEE}~EPMQau)Å~FvhFEE}~EPEPuh^]E}~EPUREuFEE}EPURFEE}~EPEPCuFEE}~EPEPvu)N)‰EE}EPMQ-BBFEE}~EPEP;u݅E@t@JVEHEE}EPMQK~ChFEE}~EPEPuh^]E}~IEPUR)FEE}~EPEP/uUNME}~EPEPou+~u~DXFEE}~EPMQuX^]E}~EPEPu]}tEPMQu4Eu}tEPEP~uE t mLUB @t Dž=$tMQ$t09$t$L[^_ÐU,WVSEEUUEEE@M EE/%u"E1MAMBX$1ҋu TPFЃ v>$];]|EPEPS;]~]E]jvE@E*1҉vTPFЃ v>$u9];]|EPEPS*;]~]E]Fu;]|EPEPS;]~]ECBЃ MAMBЃ v1ɉLBЋE@EBЃ v$v@t sk t1;]|EPEPS?;]~]E Cvt0;]|EPEPS;]~]EC@t0;]|EPEPS;]~]EC;]|EPEPS;]~]ECft0;]|EPEPSf;]~]EC.;]|EPEPS6;]~]E C t0;]|EPEPS;]~]E Ct0;]|EPEPS;]~]E C@t0;]|EPEPS;]~]ECV;]|EPEPS^;]~]EC& @;]|EPEPS;]~]EC;]|EPEPS;]~]EC t0;]|EPEPS;]~]E Cbt0;]|EPEPSb;]~]EC*@t0;]|EPEPS*;]~]EC;]|EPEPS;]~]EC}~UPkEMU;M~Ewj$ UE U NvUE U :vUE U &vUE U vUE U A;M~}tE9Et uEe[^_ÍvU WVSE EE84?E@9}ƃu,V{DÃuHWSEP^VEPgÃuQH)PjPIE E0e[^_ÍvUWVS]M}u fu vetEuC]EuE]-vu(EPEPWSRu ugtGuEtK fu90uEE@t@ED@uU E0E9UrE$U)ʉȍe[^_ÉU<WVS}] Ew}G-wv+F ~AIgfff)Ѝ)Ӊڀ0à I09sAF9r 0F0F)[^_UWVS}E xG tuWF*U  MrUG t^EEUrUtvPMQwG,ЉÃl])ދU B)؉BuPG *M MEpEtG %Bf=BuB9ws=W)ӍOOPRGÉ_G t&9s~SEP7F)_v;Gv-9v)SURPFW, Dv_9r!SMQwG,ЉÃXSEP7OF)_])ދU B)؉BEEu EM MEpEt}u3Vj UR#ƒtEH)‰U vNMEU9vG_Ë;Gv'9~#SURPEW+ uw>_9|SMQwG,ЉÃ~TӃSEP7KE)_)]uW5+u"E])ދU B)؉B1 O @e[^_ÍvUEPEURPEU RP*,EUÉUjEURPEU RP,ÉUU1Bf%=uBu}tUE1ҋ@%=u }ЉÍvUVSuu Vm@Ãu t V?؍e[^É$FreeBSD: src/lib/libc/i386/string/memchr.S,v 1.8 1999/08/27 23:59:31 peter Exp $W|$D$ L$uG_Ð1_É$NetBSD: bcopy.S,v 1.6 1996/11/12 00:50:06 jtc Exp $vVWt$ |$L$)9rL$_^ONL$_^ÐUVSuP=pX@@ e[^ÐUug>ÐU WVSuFE^1M ME ЉUȉG;}|ɅtOM;N|7F@PDËFK V PRQHB V\ލFMU BVe[^_U WVS]} M98)1Ҹ~ vB9R‹EBB  ~$ PCj RƒF9|C! vPCj RƒF;u|Ѝe[^_UU1uuuu|@@u ÉUMt't1`t NB1fuuuuu @u US]jdX@]ÐU}ԋuEE}tl}$}tU3U96+EE,v]K9|) )]]1EĉEȅ} )EUUUjE~}~EE9~}ȋU)U))U}~h}tL~4VEPEURPà UR2]])t#SuVvEPURU WVS]=t S5!װHPRj װHPRj HPVj߰HPSje[^_ÍvUVS]jG SM u/ +hPl;trRu1ve[^ÍvU WVSu p=tjjjhj Pjà t=tP5pS 5tppWPd1e[^_ÉU\WVSE}u6j?}WhdŇ>"}uhÃ,O;F> $v-  znbVJ>2&5h5CE}>=t&EEEj EP=t =t jjjhjhjep uh?j ht=u % jY`e[^_ÉU WVSE]1 xv t29Yruy9tABQMvyA)Y uSǃtW +5hp9sv1pA9r=t PhW }t"=u EvEPXe[^_ÉUWVSEwEHEupU<shENMEU9~.}WÃuEP1v]MfCfK MfC fC}{CE1vS E)w;u} {v F;u|;[uD1}~<{ME쐉!fK fKU)UF}ՋE +hppMu 1vp}K{u9t1u Ft1fK up}A)K =tCPhCPe Ce[^_UVSu=tc v9s1$w V VsÃ=tt VjS ؍e[^U WVS}=t +h wh v;lvh@vp;u[thf;t=9u 9E ;v{@Ht hn%J MƃM#t h2p=u-9u s(9E wuxh1KvE P4Ãt1} t"t;u sV M QWS W ؍e[^_UWVS}<=`uh!=M + h wh; lvh@pEuhvthnEthfQkppƒ|u1A1p<t =tVhUR = tjVMQ3}=uj|UPx p=xu@xxv}xM9K s;tE9C s;u9{vSPCPjU9S u<S KK;tw;PugE@ C EHKUtSXE9{u sMK4;uXh;C;vuC ;ujj 9uUS‰S CRC s +5hFl9wpA; lv}@UR/}K CHEthMSM#th=tCPhEP DfC S pf{ u2:t%8tʃ:t 9t @;CrOC f;CuE9t9uC +hps9t SVe[^_ÐU VSu=$th S d=dt/h. d=$t  1=`u=t u1VÃ=tEu]j EP  d=$t  =tu h><؍e[^ÍvUS]=$th RMd=dth.5SS=t]EEj EP d=$t  ]ÉUWVS]} E=$th RYd=dt0h. d=$t  1vt=`u h1ۃ=`uO=tuSM1,u W' WSƃЉU=t]}uj EP  d=$t  =t}t h>Je[^_UWVSEE}tu=uj+UX]vC;t;=u+]]=/v]utNt9t CA8tuA<=tu1[^_ÍvU WVS}tw=ul+E X]vC;t;=u+]]=/v]utNt9t CA8tuA<=tu1[^_ÍvU$S=,t,Ѓ]S jS jSjQjUPT jj;jSjP jiUP_Tj$FreeBSD: src/lib/libc/i386/string/memset.S,v 1.5 1999/08/27 23:59:32 peter Exp $WS|$ D$L$W~$ĉ Љڃ)ӉكX[_$NetBSD: bcopy.S,v 1.6 1996/11/12 00:50:06 jtc Exp $vVW|$ t$L$)9rL$D$ _^ONL$D$ _^Ð$FreeBSD: src/lib/libc/i386/sys/brk.S,v 1.7 1999/08/27 23:59:38 peter Exp $D$9(v (D$̀rD$,)UEU RPjuuuu ujh*US]uu CP| șCPSTfc ȋ]ÍvUS]C tjjjCPfc uu CPD]ÍvUS]uE URPCPiuu fc vK CPST]ÐUE@PU WVSEȩt1v_wNxvf{ tSU EXNy?uҋEe[^_ÍvUu ht,@uPÐU[u Ou1[^_UWVS] UB;] wME ;EwBUBuUBUB%9t1vOhRSE PURǸ |ÍC;E wS轺ƃS诺 URURPVP8 cO[^_ÉUlWVSEUh*u} fh*u +t(hh蘀hu uq Džh*u } ~ DžDžDžDž<1#}}!e0hhpvDž Dž;l*| 􋕨R8t 3xu Džx%s =lto11ۍvPURMQE PEPPlЃ w$P􋕤R C)~􋍤QK th*tKj"jjhhP uh@Phh~3d*Dž=\|A=dt*At@9h=\|S @hjjP?\}7cc0hhp vcR5\j?}7fcSc0hhprdPE PvEEEEE EjEP5\:‹E  9t7bb0hhp(vufDžPV5\-Ã~)ffuɅ]TbDb0h+hp 6Dž^ MQ蔵U9~4h*th7h|DžMf ff wAh*tPhNh{Dž(vu vf)ft PV5\Ãͅ!aa0haot^J+Mfft?fwSP5\OÃ~ f)uf;-h*u + hjhzh;E~EPEPY =\|=du@9htv=dtN@hjjP;\}6__0hhp`i*=l*t=`uWQ5\.;}+$_0hhpC`ju u5\[;E ^0hhp9=`tIƅDžfDžjP5\r:`k^Qju u5\ ;E t+,^0hhpK`*~ =l* DžBR)ЍjP=9Bz?B~B=\}jh\fDžfDžDžDžDžPjPjPRtà \8jPg8;u;|z;}j)B)ȉB}B@Bv)Ѝ\0hu0h*thh1vDžv[DžPPjEPUR5\9 ([0hhp[2Dž =h*thNhxuDž(f;t$h*u + hi*u[P8uEh*u + Ohhth;E~EPURmi*usEEPMQE EPuyuRh*u + hhnth;E~EPEP: Bt tuYh*t5hh th;E~EPMQ =+Sh* u>Bt2h*th(hsDžh*u+%!=!uh=h\sh*u + t5hMh5sh;E~EPMQ th*tu i*u=ptJ11ۃPEPURu upЃ $dC)t􋅤P;l*; d*Pc􋅤Pu(uW=W<vW[^_ÍvU=\|65\\`dhÐU WVS}u hVqu`*#GtSPhVMq uNx   Vj 5e[^_ÐU, WVS]E#+=+tEx #=( ,1PVE PEP30tpwV8tgV0耹Ph8++ Kx  Sj ]u1t(+tWE PRPhSp } uMPRPPPtPhSo0jhPjjPEPy }"OU0hPhS|o&SPSj Y F|[^_ÐUhuUu huÐULWVSuh*u2|EPu u#-}$T0覷PhVn@]#( ,E#h lU}MމMMMMMă=+t +ut R44hV@n =+t +t)NyF;F|;Vj;=+t +Ih0VmE#  $th9VmE#0 4th=VmE#8 <thAVimE#@ DthEVBmE#H LthIVmE#P TthMVlE#X \thQVlE#` dthUVl=+t +t{WSjPhYVvlEPSjPhbVXl MQSjrPhbV7lEPSjTPhbVl =+t + t"Nx Vj Vjj]SVj jS Vj@jSVhjS u1}u+}u%}uNx  Vj e[^_ÐU WVS}E ]hRWURP菢ƃ }1Iu+KyC;C|.!Sj. vSPl>[^_ÉUuhu uSÐU WVS]EPSEPEPu ƅ|&߰ЍPt|.tB;E|1fEe[^_UVShVhu ujà tuV蕞1[^U WVS]} u{t)sWBu t {uׅte[^_ÍvUSEU ]xt;ut@, xuRhb ht]USEU ]xt;ut@, xuRhb ht]Ujuh0ÉU} u<juPÉUjuhlÉUE= wbw+wB2 wv@=w/=w=== w=v=@=@e j p  y q i a Y Q I A 9 1 ) ! Ph h@@ÉUS]j(hS/}Sh h`]ÉUVS]fо f1fʃf1f<Q)QRh he[^UWVSu11ۋ=w%1tTPAѐ9.u]A=w%1t8A=w%1t\A1;rG;\s14 ~ Љ%[^_UWVS1EEEEv=w%1t|PCѐvR̿v44%@tCύv=w%1=w%1tETPЉUCˍvvR8v44%@tCύv=w%1J=w%1tETPЉUCˍv;.C=w%1t~EC=w%1tFUBEC=w%1tUTЉUCvRv44%@tщvRȽv44%@tCύv2wt$ )U4)U4)U4<+u)U)‹E)Ѝ)v12w"$ vU E  U CvRڼ 44%@tӉvR謼v44%@tCύvEe[^_ÐU,WVSE1EEEEEEEEǰH}ǃEPEPÃEPEPƒ EEu+}u}u ]Uv}u}u]U1E8-u EEE8+uEvE=w%1tUtBōvE8.uyEE=w%1tOEEEE=w%1tEUTЉUEU]؁ÀvEvR轺 44%@u 9}sEȋEvR腺 44%@t9}5E9}'EP#EEvR- 44%@u 9}sEȋEvR 44%@t9}E9}EPEEvR蝹 44%@u 9}sEȋEvRe 44%@t 9}sE9}sEP EE UPUPUPEU BEBEBEBEBEB EB EB B B BZe[^_ÍvUP= EH"A$}$6u4u0u jE4PE0PU,RE PE PUR` vE4PE0PPu ]ƃu E4PE0PjhGE4PE0PRlE4PE0PE,PE PU REP E4PE0Pjh{E4PE0PU,RE PE PUR PE4PE0Pjh1DžU )ЃR ÃE E4PE0PjhP Sh]SƃE4PE0PVS E4PE0PPjVJ  E4PE0Pj h"m Džu WÃE E4PE0Pjh0 u4u0Sƃ E4PE0PV*E4PE0PRjV  E4PE0Pj h,* Džu 覎ÃE E4PE0Pjh u4u0S3ƃc E4PE0PVyE4PE0PPjV * E4PE0Pjh7y Džu ÃE E4PE0Pjh< u4u0Sƃ E4PE0PVE4PE0PRjV7 y E4PE0Pj h@Z Džu DÃE E4PE0Pjh u4u0Sƃ E4PE0PVE4PE0PjhJ< E4PE0PPjVg  E4PE0Pj hM }$b u gE PhX]Sƃ E4PE0PVSK E4PE0PU,RE PE PUR^ }$ u E PhX]Sƃ E4PE0PVSI E4PE0PE,PE PU REP  E4PE0Pjh E4PE0PU,RE PE PUR d vE4PE0PPu ƃD  u 9U  }4]0vWSPu [ ƃ u 9U  WSjh<9E r Su U$RE4PE0P߰HPSwv}$N u4u0u j膲E4PE0P}0HPk  Su E4PE0P߰HPSv}$u ׉ÃE u ƉE  PSh\hSƃE4PE0PVS E4PE0PRu ƃSu E4PE0Pjh ZE4PE0PPu ƃ6u E4PE0Pjh| E4PE0PRu F ƃu E4PE0Pjh0 E4PE0PE,PE PU REP }$ju oƃE u ^ÃE  u JE PSVhc4Sgƃ0E4PE0PVS )E4PE0PU,RE PE PUR< vE4PE0PE,PE PU REP E4PE0Pjh% E4PE0PU,RE PE PUR }$^u4u0u j薯E4PE0P}0HP{ E  E Phm]STƃE4PE0PVS E DžDž9U E4}0UE E v}|u+PWjht Dž RhzP虺ƃRWVP Ui9E NE4PE0Pjh~}$u E E E E E PRQh]Sƃ0E4PE0PVS hP+E Pu r ƃ]~,E4PE0PjhbDž Dž19U4E0RPHPR`PR)؃0~0P+P*09|v}$zu ƃE E E E 8E u tE  PSVPh]Smƃ E4PE0PVS/EP9u E P Ph]S ƃ0E4PE0PVS=u ÃE PPh]Sķƃ0E4PE0PVSu bE PhX]S脷ƃ E4PE0PVSFE4PE0PU,RE PE PURY hP+E Pu ƃ~.E4PE0PjhBDž vDž19E4U0PRHPR|^PR)؃0~0P+P|,09|E4PE0PjhJkE4PE0PE,PE PU REP |΋+U 1ۉ9}؅}CE ؅}C$)t9SPhW腵ƃ E4PE0PVWGC9| Ph]S1ƃE4PE0PVSa9E DžU4E0U]hS˴Ë+} ~19}!E PhS薴ÃF9|PR+PP?YRPjh~RPRj0+@P ]hS19}[CE u7vRv44%t E .F9|PR+PP<} 9U mE0+[^_U WVS]} ހ;tAtWSfu )9v&H#C;t;\u C;t퐀;.uC;u)e[^_ÐUWVS]}]EEUEPWjhl;] s\3D3;E wPFPhn tURWjhr|E Es!F@qFLoF hF iF@FXhFrjj3+ƒtcB ub J jjR3,t$t! ujSЃtCSHt V}t|P詤1h[^_ÉUSEX{tjs3,C!u v]ÍvU WVSEX{tjs3+CEHwq$U 0t]svC(ts$Fd]C(ts$NuP! ujSЃvt;vB\N)Ãr2PGfFEf+Xp0PGfFf>E)fLFf\Fe[^_ÍvUWVSE pUEf|FwU REPv}t UDVUB NjUf+|VEH9trLFˋE XډUUDV)PSEPU5f|VuVfDVfDVVfDVDVfDV;U~DFUfVfDVfDVfEH8U J1e[^_U}EPPEPURM QEPgUbMaIEH UJ HM؉ˋBEfEEf|svsE؉EUމUs)‰ЉEPuMQ;E u\f+EtHf|sDsU)‰PDsEPEP4fsf+DsMfKf|K|sE6DsE؉E sDsU)JREPEPfETsfUރ9Mf) E)fLCf|CE`Ub1e[^_ÍvU\WVSEE܋XURU؉]EMfM;Of;;CfHfw{EPu VEp PURMQuV CEE5URUԋMMuvu؋EE܅kU܋ZMMf|C CEf)Uu)ftSUfTCjuVQEPE܃U܋ZMI fME}tuVEP U܉UЋMI fMοf;;f{uuȍEEĐS؉EMS)uȉNDS؉E SDS)uĉNTSfU΃EpuURK;E u{Mfyv)FuFTQ9wEPVQ6vURMQEuvuԃEPURVLMIuf~v6EEMAUBETF9UwQMQV E@<\tPU\@jؙ]K t1RPEPPut/URV]Stt;Et2Of}u)f9u#fEP fV]C fFExt~}t:X 19}lMvEAADADEDB9|>fEEEA9uQfEFQEDQB9~1e[^_UWVSu }E@ EUuR[G]]Extj}t:X 19}XMvEAADADEDB9|*19MVfEAVEDVB9~}t$UZG~j1h j莇aEx ED  UB H9EuhE}MQj PEPEDC~[GrUz ЃD  12EE}E}$M)M U4ÉyC؅}C$)M UB ƍ\;Z$|KJ$19}E;XD~ DF9};tU+\@ %1e[^_ÉU WVSuU B f ft‰T@JQ;V$}V$NF H!Í8uQVƒ؅}C؅}C$)!U RVbe[^_ÉU0VSu]SeEPSjr ht"hojj jEPj"1ue[^ÍvUWVS]fELSfMD{fEM AtS)ft{q1PEf+pf4{p0PMf EfD{fD{MAM fAM)fLSftCe[^_ÐU WVS]E ;}ms x8M tMjjjU PP847S u78M 4ty1e[^_ÉU,WVSEU z}M@EEEURU"%U9~fUDG)fESMQEEPh)]]7FEfwFf7uM)fLWUfTGfwM QEPBE [7}uzf|wtkTwE9~fEDGf+EfEfw]SUREEP])]fDwMf)LGUfTG vfDwM y}IDGf}ȋU9~fU%;EuUE;PufMDGf+EfE]SMQEEP)]]7FEfwFf7uM)fLWUfTG}t5fwM QEPE u 3U z}fwM IDGf}1e[^_ÍvUWVS}] ]1KEJDAfEKjSEPWÃt VWޅtjK}tfyt'AffwEfyuf|AtELAfMUJ~!EfAfACBviUBEEfUUUW +UfTAW JfTAEHt SW9t VWO81e[^_UWVSE PUMM]]ur}_ )É;Evf|runu}w4}uvE)EjE PUMDQP]S9E tOPUEBu^ );Mfzt;Mu}]{4}t Ee[^_ÐUVS]u jQDPPSt)Afxuۃtfuǃ $jU RDFPS  @f8uL$ǃ :jE PDFPSƒtUEPEEPRSǃ~:EU 9B u#EPFBPEPe[^_UVSu]uuju V"Ct1e[^UWVS}E pFW )‰UE @ fE]FffwTtpSoUREPjU RW t:sjE PDFPW3tWURURSPWAà ~;EU 9B u$EPFBPEPf{e[^_UWVS]jEPEPuEP u`uuUR誩;EЉUEPEPU fB ft,juB PEPIU BuE @E }tEHXX|CLC3F֋EfSFfCf3f|CfLCEU E BEXHf;vGsLC|CffLCf|CuUR$u/}t } tFs$!jU RVjSe[^_U,WVS}UM9AvFEPQRUUMAEE]CBEMEU E;w tu vPM Q]Su .ptItEU E;s7PSMQǃujS]3_FExCS)ЍW9s2PWURMQjS]SvCf9s)RDCPPfC΍SC)fCfJC؋MQU@q1PQM jS1|1e[^_ÉUS=tvЃ;u[ÐUfixit_crunch%s: %s not compiled in usage: %s ..., where is one of: %sgrepexviewvitelnetftpmount_cd9660mount_msdosumountswaponrrestorerestorerebootmountmknodfdiskdmesgdisklabelclrichgrpchownsyncsleeprmdirrmmvmkdirlslnkillexprechodfddcpchrootchmodcat@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/cat/cat.c,v 1.14.2.7 2002/04/24 13:36:45 asmodai Exp $benstuvusage: cat [-benstuv] [-] [file ...] stdoutdddddddddddddd ,DX-stdin%sr%6d buffercat@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/chmod/chmod.c,v 1.16.2.3 2001/08/01 01:21:09 obrien Exp $HLPRXfgorstuvwxthe -R and -h options may not be specified together.invalid file mode: %s%s: %s%s%s fts_read(((((((((((((((Ȍ(Ԍ((((((((((((((((((((((((((|}}usage: chmod [-fv] [-R [-H | -L | -P]] mode file ... @(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/usr.sbin/chroot/chroot.c,v 1.4.2.1 2002/03/15 22:54:59 mikeh Exp $.%sSHELL/bin/sh-iusage: chroot newroot [command] @(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/cp/cp.c,v 1.24.2.5 2002/01/01 06:32:04 mckay Exp $HLPRfiprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%sD`|ԑ%s: %s%s: directory causes a cycle..%s%s: name too long (not copied)chmod: %s%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).%s -> %s fts_read$FreeBSD: src/bin/cp/utils.c,v 1.27.2.5 2001/12/15 14:07:05 mckay Exp $%s(y/n [n]) overwrite %s? %snot overwritten readlink: %sunlink: %ssymlink: %smkfifo: %smknod: %sutimes: %schown: %schmod: %schflags: %s cp [-R [-H | -L | -P]] [-f | -i] [-pv] src1 ... srcN directoryusage: cp [-R [-H | -L | -P]] [-f | -i] [-pv] src target%s %s $FreeBSD: src/bin/dd/args.c,v 1.25.2.2 2001/01/23 14:20:03 asmodai Exp $\@@`pȦ ئ@@ئ@@|skipseekoseekofobsiseekifibsfilescountconvcbsbsunable to allocate space for the argument "%s"unknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsseek offsets cannot be larger than %qdbs must be between 1 and %dcbs must be between 1 and %dcount cannot be negativefiles must be between 1 and %qdibs must be between 1 and %dobs must be between 1 and %dJ D= 9 3+#     unblockucasesyncswabsparseosyncoldibmoldebcdicoldasciinotruncnoerrorlcaseibmebcdicblockascii,unknown conversion %s%s: illegal conversion combination%s%s: illegal numeric value%s: %sPƨƨƨƨƨƨƨ`ƨpƨƨƨƨƨƨƨƨƨ%s: illegal offset$FreeBSD: src/bin/dd/conv.c,v 1.15 1999/09/13 21:47:10 green Exp $%s: short input record$FreeBSD: src/bin/dd/conv_tab.c,v 1.10 1999/09/12 16:51:53 green Exp $    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/dd/dd.c,v 1.27.2.3 2001/08/01 01:37:35 obrien Exp $stdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffertruncating %sư>%s: seek error creating sparse file%s: end of device%s: short write on tape device%s: short write on character device$FreeBSD: src/bin/dd/misc.c,v 1.18.2.1 2001/08/01 01:40:03 obrien Exp $%qu+%qu records in %qu+%qu records out blockblocks%qu odd length swab %s %qu truncated %s %qu bytes transferred in %.6f secs (%.0f bytes/sec) ư>?@$FreeBSD: src/bin/dd/position.c,v 1.17.2.2 2001/01/23 14:23:55 asmodai Exp $%siseek/skip%s: illegal offsetskip reached end of inputoseek/seek%s: write failure@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/df/df.c,v 1.23.2.8 2002/04/05 00:25:14 iedowse Exp $ufsabgHhiklmnPt:BLOCKSIZE=512BLOCKSIZE=1gBLOCKSIZE=1k-l and -t are mutually exclusive.BLOCKSIZE=1monly one -t option may be specified%s/tmp/df.XXXXXXstrdup failedmkdtemp("%s") failed$@\lx?@ 0BBKMGTPE %5.0f%c %5.1f%c$@ SizeAvailUsedFilesystem%-*s %-*s %*s %*s Capacityifreeiused %*s %*s %%iused Mounted on %-*s %*ld %*ld %*ld %5.0f%% %*ld %*ld %4.0f%% %s Y@ df: %lld: %s usage: df [-b | -H | -h | -k | -m | -P] [-ailn] [-t type] [file | filesystem ...] sysctl failedmalloc failed$FreeBSD: src/sbin/mount/vfslist.c,v 1.4 1999/08/28 00:13:27 peter Exp $malloc failed@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/echo/echo.c,v 1.8.2.1 2001/08/01 02:33:32 obrien Exp $-n%s$FreeBSD: src/usr.bin/yacc/skeleton.c,v 1.28.2.1 2001/07/19 05:46:39 peter Exp $B[aim3O (                      !"   (:%&)*+%-/*+-/:<=>:%&)*+-)/%&)*+-/<=>%&*)<=>/%&)*+-:/&|)+-<=>&)<=>&)+-|<=>&|)&|)<=>&)&)<=>|<=>|<=><=>|&)%&|*+-/|<=>:<=>||%&|*+|-/:<=>%*+-/||:<=> malloc() failedoverflow%lld|&=<>+-*/%:()%lld %s syntax errornon-numeric argumentdivision by zero%syacc stack overflow$4H`x,@Th@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/kill/kill.c,v 1.11.2.1 2001/08/01 02:42:56 obrien Exp $-lillegal signal number: %s%s -soption requires an argument -- s0illegal process id: %s%ssigunknown signal %s; valid signals: kill -signal_number pid ... kill -signal_name pid ... kill -l [exit_status]usage: kill [-s signal_name] pid ...%s %s %s %s @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/ln/ln.c,v 1.15.2.3 2001/08/01 04:38:44 obrien Exp $linkfhinsv.%sLdpd%s/%sreplace %s? not replaced %s %c> %s link file1 file2 ln [-fhinsv] file ... directoryusage: ln [-fhinsv] file1 file2%s %s %s $FreeBSD: src/bin/ls/cmp.c,v 1.9.2.1 2002/03/28 01:28:14 joe Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/ls/ls.c,v 1.32.2.5 2002/03/28 01:28:14 joe Exp $COLUMNS1ABCFGHLPRTWabcdfghiklnoqrstuwCLICOLORCLICOLOR_FORCEColor support not compiled in. 8PHlxH`l$0<T%s: directory causes a cycle%s: %s %s: %s: fts_readLS_COLWIDTHS0:0 %lu : %lu : %lu : %i : %i : %i : %llu : %lu %u-%lu%quDNXbipw$FreeBSD: src/bin/ls/print.c,v 1.19.2.5 2002/03/28 01:28:14 joe Exp $%stotal %lu %*lu %*lld %s %*u %-*s %-*s %-*s %3d, 0x%08x %3d, %3d %*s%*lld %e %b %T %Y %b %e %T %Y %e %b %R %b %e %R %e %b %Y %b %e %Y %s/%s ls: %s: %s -> 0B%*s BKMGTPE%*lld%c ?@$FreeBSD: src/bin/ls/util.c,v 1.20.2.4 2002/03/28 01:28:14 joe Exp $h4,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,dusage: ls [-ABCFHLPRTWabcdfghiklnoqrstu1] [file ...] @(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/mkdir/mkdir.c,v 1.19.2.2 2001/08/01 04:42:37 obrien Exp $m:pvinvalid file mode: %s%s%s usage: mkdir [-pv] [-m mode] directory ... @(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/mv/mv.c,v 1.24.2.3 2001/08/01 04:44:36 obrien Exp $fiv%s: destination pathname too long%s(y/n [n]) overwrite %s? %s override %s%s%s/%s for %s? %snot overwritten %s -> %s cannot resolve %s: %scannot rename a mount pointrename %s to %smalloc failed%s: remove%s: set owner/group (was: %lu/%lu)%s: owner/group changed; clearing suid/sgid (mode was 0%03o)%s: set mode (was: 0%03o)%s: set flags (was: 0%07o)%s: set times-PRpv-PRpmv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rm mv [-f | -i] [-v] source ... directoryusage: mv [-f | -i] [-v] source target%s %s @(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/rm/rm.c,v 1.29.2.4 2001/08/01 05:15:56 obrien Exp $unlinkdfiPRrvW!!!!!!!!!!!!!!!!!!!!|!!!!!!!!!!!!!!!!!!!%s: %s%s %sfts_read#$$@#$$#$$8#%s: is a directorymallocremove %s? override %s%s%s/%s %s%sfor %s? "." and ".." may not be removed unlink fileusage: rm [-f | -i] [-dPRrvW] file ...%s %s @(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/rmdir/rmdir.c,v 1.9.2.2 2001/08/01 05:16:47 obrien Exp $p%susage: rmdir [-p] directory ... @(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/sleep/sleep.c,v 1.9.2.1 2001/08/01 05:23:25 obrien Exp $usage: sleep seconds @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/sync/sync.c,v 1.9.2.2 2001/08/01 05:43:30 obrien Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/usr.sbin/chown/chown.c,v 1.15.2.1 2000/08/07 02:03:09 ps Exp $HLPRfhvthe -R and -h options may not be specified together%s: %s%s fts_read 2 2 2 2 2 2 2 2 21 2 2 21 2 2 21 21 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 21 21 2 2 2 2 2 2 2 2 2 2 2 2 228333X3333333333groupuser%s%s: illegal %s nameyou are not a member of group %s chgrp [-R [-H | -L | -P]] [-f] [-h] [-v] group file ... chown [-R [-H | -L | -P]] [-f] [-h] [-v] :group file ...usage: chown [-R [-H | -L | -P]] [-f] [-h] [-v] owner[:group] file ...%s %s %s @(#) Copyright (c) 1990, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/clri/clri.c,v 1.4 1999/08/28 00:12:32 peter Exp $usage: clri filesystem inode ... %s%s: can't read superblock%s: superblock magic number 0x%x, not 0x%x%s is not a valid inode numberclearing %d @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/disklabel/disklabel.c,v 1.28.2.9 2001/08/01 06:07:14 obrien Exp $DOC2KVinumCCDfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownvinumbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunusedBNRWb:enrs:w/dev/%s%s%c%s%s%sioctl DIOCWLABELr;;;8:;;;;;;;;;;;d:;;;:;;;;:;;;;;;;;;;D:;;:;;;;;;;;:;;;:T:;;;:?<=D==l>>?auto%s: unknown disk type/boot%s/%swrite to disk label supressed - label was as follows:ioctl DIOCSDINFOwriteioctl DIOCWDINFO%s: no disk label on disk;add "-r" to install initial label %s: label magic number or checksum is wrong!(disklabel or kernel is out of date?) %s: open partition would move or shrink%s: '%c' partition must start at beginning of diskbad pack magic number (label is damaged, or pack is unlabeled)ioctl DIOCGDINFO%s/boot1%s/boot2%s too largebootstrap doesn't leave room for disk label# %s: type: %s type: %u disk: %.*s label: %.*s flags: removeable ecc badsect bytes/sector: %lu sectors/track: %lu tracks/cylinder: %lu sectors/cylinder: %lu cylinders: %lu sectors/unit: %lu rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %lu # milliseconds track-to-track seek: %ld # milliseconds drivedata: %lu %u partitions: # size offset fstype [fsize bsize bps/cpg] %c: %8lu %8lu %8.8s%8d %5lu %5lu %5.5s %5lu %5lu %5u %5lu %5lu %5d%20.20s # (Cyl. %4lu- %lu) wcan't create %scan't reopen %s for readingre-edit the label? [y]: you have too many processesforkEDITOR/usr/bin/viline %d: syntax error typeWarning, unknown disk typeline %d:%s %d flagsremoveableeccbadsectline %d: %s: bad flag drivedata%d partitionsline %d: bad # of partitions disklabelbytes/sectorline %d: %s: bad sector size sectors/trackline %d: %s: bad %s sectors/cylindertracks/cylindercylinderssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: partition name out of range a-%c: %s line %d: too few numeric fields line %d: %s: bad partition size line %d: %s: bad partition offset line %d: Warning, unknown filesystem type %s line %d: %s: Unknown disklabel field sector size 0 sectors/track 0 tracks/cylinder 0 cylinders/unit 0 revolutions/minute 0boot block size 0 boot block size %% sector-size != 0super block size 0 super block size %% sector-size != 0number of partitions (%lu) > MAXPARTITIONS (%d)Too many '*' partitions (%c and %c)unknown size specifier '%c' (K/M/G are valid)partition %c not an integer number of sectorstotal percentage %d is greater than 100 %ld sectors available to give to '*' and '%' partitions Offset %ld for partition %c overlaps previous partition which ends at %ld Labels with any *'s for offset must be in ascending order by sector Offset %ld for partition %c doesn't match expected value %ldpartition %c: size 0, but offset %lupartition %c: offset past end of unit partition %c: partition extends past end of unit partition %c is not marked as unused!partition %c doesn't start at 0!partition %c doesn't cover the whole unit!An incorrect partition %c may cause problems for standard system utilitiespartitions %c and %c overlap! unused partition %c: size %d offset %luY@"auto" requires the usage of a canonical disk namecannot open %sboot overlaps used partition %c marked as FS_BOOTboot overlaps partition %c, %scannot install boot programWarning, (to write disable/enable label) disklabel [-NW] disk (to restore label and boot program) disklabel -R -B [-n] [ -b boot1 [ -s boot2 ] ] disk protofile [ type ] (to write label and boot program) disklabel -w -B [-n] [ -b boot1 [ -s boot2 ] ] disk type [ packid ] (to install boot program with existing label) disklabel -B [-n] [ -b boot1 [ -s boot2 ] ] disk [ type ] (to restore label with existing boot program) disklabel -R [-r] [-n] disk protofile (to edit label) disklabel -e [-r] [-n] disk (to write label with existing boot program) disklabel -w [-r] [-n] disk type [ packid ] (to read label)usage: disklabel [-r] disk%s %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s @(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/dmesg/dmesg.c,v 1.11.2.3 2001/08/08 22:32:15 obrien Exp $_msgbufpaM:N:kern.msgbufsysctl kern.msgbufmalloc faileddmesgkvm_nlist: %snamelist%s: msgbufp not foundkvm_read: %skernel message buffer has different magic number%susage: dmesg [-a] [-M core] [-N system] $FreeBSD: src/sbin/i386/fdisk/fdisk.c,v 1.36.2.11 2002/04/25 21:02:21 trhodes Exp $/dev/da0/dev/ad0BBT (Bad Blocks Table)DOS 3.3+ SecondaryConcurrent CPM or C.DOS or CTOSBSDI BSD/386 swapBSDI BSD/386 filesystemNetBSDNEXTSTEPOpenBSDFreeBSD/NetBSD/386BSDSuspend to DiskBSD/OSAmoeba bad block tableAmoeba filesystemLinux filesystemLinux swap or Solaris x86Minix 1.4b ... 1.5.10Minix 1.1 ... 1.4aPCIXNovell Netware 3.xxNovell Netware 2.xxISC UNIX, other System V/386, GNU HURD or MachSpeedGBCP/M or Microport SysV/ATDMQNX 4.2 TertiaryQNX 4.2 SecondaryQNX 4.2 PrimaryVENIX 286plan9OPUSExtended DOS, LBAPrimary 'big' DOS (> 32MB, LBA)DOS or Windows 95 with 32 bit FAT, LBADOS or Windows 95 with 32 bit FATOS/2 Boot Manager or OPUSAIX boot partition or CoherentAIX filesystemOS/2 HPFS, NTFS, QNX-2 (16 bit) or Advanced UNIXPrimary 'big' DOS (> 32MB)Extended DOSPrimary DOS with 16 bit FAT (<= 32MB)XENIX /usr filesystemXENIX / filesystemPrimary DOS with 12 bit FATunusedBIab:f:istuv1234/dev/dev/%scannot open disk %scannot open any diskcannot allocate buffer to determine disk sector sizeread_s0%s: %d cyl %d hd %d sec SizeStartPart %11s %11s Type Flags %4d: %11lu %11lu 0x%02x 0x%02x ******* Working on device %s ******* Media sector size is %d Warning: BIOS sector numbering starts with sector 1 Information from DOS bootblock is: We haven't changed the partition table yet. This is your last chance. Should we write new partition table? -t flag specified -- partition table not written. hkhkhkhktktktktktktktktktktktktktkjtktktktktktkjtktktktktktktktktktktktktktktktktktktktktktktkkktktktk ktktk,ktktktktktktktktktk8kDkPk\k fdisk -f configfile [-itv] [disk] usage: fdisk [-BIaistu] [-b bootcode] [-1234] [disk] %s%s%d: sysid %d,(%s) (active) start %lu, size %lu (%qd Meg), flag %x%s beg: cyl %d/ head %d/ sector %d; end: cyl %d/ head %d/ sector %d /boot/mbr%s%s: length must be a multiple of sector size%s: unable to allocate read buffer%s: short readThe data for partition %d is: Do you want to change it? The static data for the DOS partition 4 has been reinitialized to: sysid (165=FreeBSD)startsizeERROR: failed to adjust; setting sysid to 0Explicitly specify beg/end address ?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorAre we happy with this entry?parameters extracted from in-core disklabel are: cylinders=%d heads=%d sectors/track=%d (%d blks/cyl) Figures below won't work with BIOS for partitions not in cyl 1 parameters to be used for BIOS calculations are: Partition %d is marked active Do you want to change the active partition?active partitionActive partition number must be in range 1-4. Try again. Are you happy with this choiceDo you want to change the boot code?Do you want to change our idea of what BIOS thinks ?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorscan't get file status of %sdevice %s is not character specialcan't open device %scan't get disk parameters on %scan't get disk parameters on %s; supplying dummy onesunable to allocate buffer to read fdisk partition tablecan't read fdisk partition tableinvalid fdisk partition table foundcan't write fdisk partition table%s [n] yesYESyYSupply a decimal value for "%s" [%d] %s is an invalid decimal number. Try again. unknownERROR line %d: the geometry specification line must occur before all partition specificationsERROR line %d: incorrect number of geometry argsERROR line %d: unknown geometry arg type: '%c' (0x%02x)ERROR line %d: number of cylinders not specifiedWARNING line %d: number of cylinders (%d) may be out-of-range (must be within 1-1024 for normal BIOS operation, unless the entire disk is dedicated to FreeBSD)ERROR line %d: number of heads not specifiedERROR line %d: number of heads must be within (1-256)ERROR line %d: number of sectors not specifiedERROR line %d: number of sectors must be within (1-63)ERROR line %d: incorrect number of partition argsERROR line %d: invalid partition number %dERROR line %d: unable to adjust start of partition %d to fall on a head boundaryWARNING: adjusting start offset of partition %d from %u to %u, to fall on a head boundaryERROR: could not adjust partition to start on a head boundary and end on a cylinder boundary.WARNING: adjusting size of partition %d from %u to %u to end on a cylinder boundaryERROR line %d: size of partition %d is zeroERROR line %d: incorrect number of active args-rERROR: size of partition is zeroWARNING: partition does not start on a head boundaryWARNING: partition does not end on a cylinder boundaryWARNING: this may confuse the BIOS or some operating systemsCorrect this automatically?ERROR: unable to adjust start of partition to fall on a head boundaryWARNING: adjusting start offset of partition to %uWARNING: adjusting size of partition to %u@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/mknod/mknod.c,v 1.13 2000/01/06 17:51:46 obrien Exp $usage: mknod name [b | c] major minor [owner:group] %s%s: illegal %s namegroup must be specified when the owner isgroupowner must be specified when the group isusernode must be type 'b' or 'c'%s: non-numeric major number%s: non-numeric minor numbermajor or minor number too largesetting ownership on %s@(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/mount/mount.c,v 1.39.2.3 2001/08/01 08:26:23 obrien Exp $soft-updatessuiddirnoclusterwnoclusterrunionsynchronousread-onlywith quotasnosymfollownosuidnoexecnodevnoatimelocalNFS exportedasynchronousext2fsffsufsadfo:prwt:uvroonly one -t option may be specifiednorogetmntinforwrqnoautonot currently mounted %s/%s: unknown special file or file system%s has unknown file system type:@nfsr/var/run/mountd.pid%dsignal mountd8888888888888888888888888888888888|888888888888Ћ8‹,/usr/sbin/sbinforceupdateexec: mount_%s %s fork%s/mount_%smalloc failed, exec mount_%s not found in %swaitpid%s: %sstatfs %s%s on %s (%s, %s, mounted by %s, writes: sync %ld async %ld, reads: sync %ld async %ld) %s,%s-ofstabcurrentno mount [-dfpruvw] special | node mount [-adfpruvw] [-t ufs | external_type]usage: mount [-dfpruvw] [-o options] [-t ufs | external_type] special node%s %s %s %s %s %s %s %u %u 1 1 2 2 0 0 syncasync@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/mount/mount_ufs.c,v 1.16.2.3 2001/08/01 08:27:29 obrien Exp $updatesyncforceasyncclusterwclusterrunionrdonlysymfollowsuidsuiddirexecdevatimeautorwrogroupquotauserquotao:ufsvfsload(ufs)ufs filesystem is not available%s on %s: mount table full%s on %s: specified device does not match mounted device%s on %s: incorrect super block%susage: mount_ufs [-o options] special node $FreeBSD: src/sbin/mount/getmntopts.c,v 1.9 1999/10/09 11:54:06 phk Exp $,-o %s: option not supported%s: not a directory%s: %s$FreeBSD: src/sbin/mount/vfslist.c,v 1.4 1999/08/28 00:13:27 peter Exp $malloc failed@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/reboot/reboot.c,v 1.9.2.4 2002/04/28 22:50:00 wes Exp $haltdk:lnpqcannot dump (-d) when halting; must reboot instead/boot/nextboot.confkernel="" ???halted by %srebootrebooted by %sshutdown~SIGTSTP initSIGTERM processesWARNING: some process(es) wouldn't die (can't restart init): %s%sأusage: %s [-dnpq] [-k kernel] vm.stats.vm.v_swappgsinv_swappgsin@(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/restore/main.c,v 1.10.2.3 2001/10/02 08:30:17 cjc Exp $./restoresymtableTAPE/dev/sa0b:cdf:himNRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0%c and %c options are mutually exclusiveillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specified.Begin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure ĨPPPPPPPPPPPPPPPPPPL\PlPxPPPPPPPԨ,8PDī2222222222222222222222822222222`2 222restore -t [-cdhkNuvy] [-b blocksize] [-f file] [-s fileno] [file ...]restore -x [-cdhkmNuvy] [-b blocksize] [-f file] [-s fileno] [file ...]restore -R [-cdkNuvy] [-b blocksize] [-f file] [-s fileno]restore -r [-cdkNuvy] [-b blocksize] [-f file] [-s fileno]restore -i [-cdhkmNuvy] [-b blocksize] [-f file] [-s fileno]usage: %s %s %s %s %s option requires an argument -- %c$FreeBSD: src/sbin/restore/interactive.c,v 1.8.2.1 2001/01/03 14:36:08 iedowse Exp $/addcd%s: not a directory delete%s: not on extraction list extracthelp directory is used If no `arg' is supplied, the current help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%slspwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help QLLLLԴLLLLLLLLLLLLLLLLLLLLLLLLLLLL L0LL LLLLLL LXLLܳrestore > %s/%s%s: out of memory command lines cannot be continued missing %c ../canonname: not enough buffer space ..ls: out of memory directory reopen failed %s: %s%s: name exceeds %d char Warning: undefined file type %d ````|``%*d %srestore interrupted, continue$FreeBSD: src/sbin/restore/restore.c,v 1.7.2.1 2002/03/01 21:32:28 iedowse Exp $leafdir %s%10d %s %s: not on the tape ./%uMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %d) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state 8(<<|NIL|ONTAPE|INOFND|NAMEFND|MODECHGFind unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %d: bad first %s: not found on tape expected next file %d, got %d unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %d type should be LEAF$FreeBSD: src/sbin/restore/dirs.c,v 1.14.2.5 2001/10/15 13:44:45 dd Exp $Extract directories from tape TMPDIR/tmp/%s/rstdir%d-XXXXXXw%s - cannot create directory temporary fopen%s/rstmode%d%s - cannot create modefile fopen/opendirfile: %s Root directory is not on tape .Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %d char lsMangled directory: reclen not multiple of 4 reclen less than DIRSIZ (%d < %d) reclen name too big (%d > %d) bad seek pointer to rst_seekdir %ld error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopen: %s cannot open mode file %s set owner/mode for '.'cannot find directory inode %d error setting directory modes Cannot find directory inode %d named %s %s: cannot create file: %s write error extracting inode %d, name %s read: %s write: %s no memory directory table $FreeBSD: src/sbin/restore/symtab.c,v 1.7.2.1 2001/12/19 14:54:14 tobez Exp $addino: out of range %d duplicate inumdeleteino: out of range %d deleteino: %d not found %s is not a directory %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTcannot find entry in parent listbad name no space for string table Check pointing the restore wfopen: %s cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table .open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table read: %s cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c $FreeBSD: src/sbin/restore/tape.c,v 1.16.2.7 2002/03/01 21:32:28 iedowse Exp $-r/dev/ttycannot open %s: %s /dev/nullCannot allocate space for magtape buffer Cannot allocate space for tape buffer Verify tape and initialize maps %s: %s Tape is not a dump tape Converting to new file system format. .cannot stat .: %s bad block size %ld Tape is not volume 1 of the dump header read failed at %ld blocks no header after volume mark! Cannot find file removal list maxino = %d no memory for active inode map Cannot find file dump list no memory for file dump list Changing volumes on pipe input? Otherwise, begin with volume 1. have no further files to extract. can quickly skip tapes that and work towards the first; restore start with the last volume If you are extracting just a few files,You have not read any tapes yet. %s%s%s%s%s%s%sYou have read volumes: %s%ld, Specify next volume #: Volume numbers are positive numerics Mount tape volume %ld Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) none Cannot open %s tape is not dump tape Wrong volume (%ld) Wrong dump date got: %s wanted: %slast rec %ld, tape starts with %ld sSkipping %ld duplicate record%s. active file into volume 1 End-of-input encountered while extractingWarning: %s %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Dump date: %sthe epoch Dumped from: %sLevel %ld dump of %s on %s:%s Label: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract fifo %s %s: cannot create fifo: %s extract special file %s %s: cannot create special file: %s %s: cannot create file: %s ran off end of tape not at beginning of a file Missing address (header) block for %s at %ld blocks write error extracting inode %d, name %s write: %s seek error extracting inode %d, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s hole in map mid-media short read error. partial block read: %ld should be %ld Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %d continuecontinuation failed: %s End-of-tape encountered partial block read: %d should be %d tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%d) Tape block size is %ld Note: Doing Byte swapping 8l4s31ll2lNote: Doing Quad swapping gethead: unknown inode type %d BB'oldnewVolume header (%s inode format) begins with record %ldDumped inodes map headerUsed inodes map headerFile header, ino %dFile continuation header, ino %dEnd of tape header; predicted %ld blocks, got %ld blocksH0Xh<unexpected tape header unknown tape header type %d resync restore, skipped %ld blocks TH<Checksum error %o, inode %d file %s $FreeBSD: src/sbin/restore/utilities.c,v 1.8.2.2 2001/07/30 10:30:08 dd Exp $mktempname: called with TMPNAMEnot on ino listRSTTMP%s%ld%luwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d symbolichardCreate %s link %s->%s warning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s NODELEAFentry type: %s inode number: %lu flags: %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump core$FreeBSD: src/sbin/dump/dumprmt.c,v 1.14.2.1 2000/07/01 06:31:52 ps Exp $Lost connection to remote host. on %s: %s%stcpkshellshell%s/tcp: unknown service who are you? RMT/etc/rmtlogin to %s as %s failed. Connection to %s established. IP_TOS:IPTOS_THROUGHPUT setsockoptTCP_NODELAY setsockoptinvalid user name %s O%.226s %d C closeR%d readW%d writeL%d %d seekS statusI%d %d ioctl%s: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). @(#) Copyright (c) 1980, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/swapon/swapon.c,v 1.8.2.2 2001/07/30 10:30:11 dd Exp $aswnoautoswapon: adding %s as swap device %s: device already in use%susage: swapon [-a] [special_file ...] @(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/umount/umount.c,v 1.22.2.1 2001/12/13 01:27:15 iedowse Exp $Aafh:t:vonly one -t option may be specifiednfscannot umount %s, %s is mounted there, umount it first/etc/fstab%s+,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,+,,,,+,+,,,,,,,,,,,+,,fstab reading failure/rwrorq%s: unknown mount typemalloc failedstrdup%s: not currently mountedcan't get net id for hostunmount of %s failed%s: unmount from %s Cannot MNT PRCBad MNT RPCcannot remove mounttab entry %s:%scallocT88x7099malloc umount -a | -A [-fv] [-h host] [-t type]usage: umount [-fv] special | node%s %s $FreeBSD: src/sbin/mount/vfslist.c,v 1.4 1999/08/28 00:13:27 peter Exp $malloc failed$FreeBSD: src/usr.sbin/rpc.umntall/mounttab.c,v 1.2.2.1 2001/12/13 01:27:20 iedowse Exp $a/var/db/mounttab%ld %s %s rcan't open %s timehostdirmallocwcan't write to %swrite mounttab entry %s:%scan't remove %s by hostdelete mounttab entry%s %s:%sbad mounttab %s field '%s'$FreeBSD: src/sbin/mount_msdos/mount_msdos.c,v 1.19.2.1 2000/07/20 10:35:13 kris Exp $nowin95longnamesshortnamesupdatesyncforceclusterwclusterrunionrdonlysymfollowsuidsuiddirexecdevatimeautorwrogroupquotauserquotasl9u:g:m:o:L:W:stat %smsdosvfsload(msdos)msdos filesystem is not available%sPD PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUIT%c%c%c421 Service not available, remote server has closed connection.%s: send aborted waiting for remote to finish abort.sentlocal: %s remote: %s -%slocal: %s%s: not a plain file. STORAPPEREST %qdr+w%s %snetout receive aborted waiting for remote to finish abort.receivedRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly.Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: EPSV return code must be 229PASVLPSVPassive mode refused.wrong server: return code must be 227%d,%d,%d,%d,%d,%dwrong server: return code must be 228%d,%d,%d,%d,%d,%d,%d,%d,%d%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dwrong server: return code must be 229%c%c%c%d%cPassive mode address scan failure. Shouldn't happen!setsockopt (reuse address)setsockopt PORTRANGE (ignored)listenEPRT |%d|%s|%d|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dacceptSTOUproxy server does not support third party transfers.No primary connection.PORT %slocal: %s remote: %s abortresetrunique: can't find unique file name.Lost control connection for abort.%cABOR ftphttpFTPSERVERPORT%sftpgateTMPDIR/tmp/FTP_PASSIVE_MODEnopftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumb46adeginpP:s:tUvV%s: %sxPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP,DPPPPPPPPPPPPPPPPPPPPP P8ftp> sorry, input line too long.?Ambiguous command.?Invalid command.Not connected.!$Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46adeginptUvV] [-P port] [-s src_addr] [host [port]] %s host:path[/] %s ftp://host[:port]/path[/] %s http://host[:port]/file macdefmachineaccountpasswdpasswordlogindefaultHOME.%s/.netrc%s/.netrc: %sr%scan't strdup *anameanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.can't strdup *apassRemove account or make file unreadable by others.can't strdup *aacctMissing macdef name argument.Limit of 16 macros have already been defined.Macro definition missing null line terminator.4K macro buffer exceeded.Unknown .netrc keyword %sAlready connected to %s, use close first. tousage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s asciinon-printstreamfile8SYSTRemote system type is %s. 215 UNIX Type: L8binaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$initsorry, arguments too long.(%s) ftpXXXXXX%s/%sunable to create temporary file %swNLSTarcan't find list of remote files, oops.%s %s? Interactive mode: off.Prompting off for duration of %s. %s: not foundSIZE %sMDTM %s%*s %16s1919%03d%02d%02d%02d%02d%02d%04d%02d%02d%02d%02d%02dCan't convert %s to a time. KMGTP %3d%% **********************************************************************************************************************************************************|%.*s%*s| %5qd %c%c --:-- ETA - stalled -%2d: %02d:%02d ETA.AMKs%qd byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d .A>P?emacsContext sensitive argument completionftp-complete^I0isipv6addr: got %d for %s @(#)commands.c 8.4 (Berkeley) 5/30/95%s sequence challenge /usr/bin/opiekeyfork!^?offwontwilldontdohelpDisplay send options?Send request for STATUSgetstatusPerform Telnet 'Synch operation'synchSend Telnet End of File CharactereofSend Telnet 'Suspend Process'suspSend Telnet 'Abort Process'abortSend Telnet 'End of Record'eorSend Telnet 'No operation'nopintrinterruptintpSend Telnet Interrupt ProcessipSend Telnet 'Go Ahead' sequencegaSend current escape characterescapeSend Telnet Erase LineelSend Telnet Erase CharacterecbreakSend Telnet BreakbrkSend Telnet 'Are You There'aytSend Telnet Abort outputaoneed at least one argument for 'send' command 'send ?' for help Unknown send argument '%s' 'send ?' for help. Ambiguous send argument '%s' 'send ?' for help. sNeed %d argument%s to 'send %s' command. 'send %s ?' for help. ?Need to be connected first. There is not enough room in the buffer TO the network to process your request. Nothing will be done. ('send synch' will throw away most data in the network buffer, if this might help.) Telnet 'send' error - argument disappeared! SENTUsage: send %s "value" must be from 0 to 255 Valid options are: "%s" '%s': ambiguous argument ('send %s ?' for help). '%s': unknown argument ('send %s ?' for help). '%s': bad value ('send %s ?' for help). %-15s %s setsockopt (SO_DEBUG)Will send carriage returns as telnet . Will send carriage returns as telnet . Already operating in binary mode with remote host. Negotiating binary mode with remote host. Already in network ascii mode with remote host. Negotiating network ascii mode with remote host. Already receiving in binary mode. Negotiating binary mode on input. Already receiving in network ascii mode. Negotiating network ascii mode on input. Already transmitting in binary mode. Negotiating binary mode on output. Already transmitting in network ascii mode. Negotiating network ascii mode on output. print hexadecimal representation of terminal traffic(debugging) toggle printing of hexadecimal terminal datatermdatashow option processingviewing of options processing (debugging)optionsprint user readable output for "netdata"output of "netdata" to user readable format (debugging)prettydumpprint hexadecimal representation of network trafficprinting of hexadecimal network data (debugging)netdataturn on socket level debuggingdebuggingdebug recognize certain control characterslocal recognition of certain control characterslocalcharsmap carriage return on outputmapping of received carriage returnscrmodsending carriage returns as telnet crlfsending of binary dataoutbinaryreceiving of binary datainbinarysending and receiving of binary databinaryskip reading of ~/.telnetrc filedon't read ~/.telnetrc fileskiprcsend interrupt characters in urgent modeautomatic sending of interrupt characters in urgent modeautosynchflush output when sending interrupt charactersflushing of output when sending interrupt charactersautoflush%-15s toggle %s display help informationenabledisable%-15s %s %s Need an argument to 'toggle' command. 'toggle ?' for help. '%s': ambiguous argument ('toggle ?' for help). '%s': unknown argument ('toggle ?' for help). WillWon't%s %s. alternate AYT characterforw2alternate end of line characterforw1character to use for XOFFstopcharacter to use for XONstartcharacter to use to erase a wordworderasecharacter to use for line reprintreprintcharacter to cause a Suspend Processcharacter to use for literal nextlnextcharacter to use to erase a linekillcharacter to use to erase a charactereraseThe following are for local editing in linemodecharacter to cause an EOF character to cause an Abort processquitcharacter to cause an Interrupt Processcharacter to cause an Abort OutputflushoutputThe following need 'localchars' to be toggled truefile to write trace information totracefilerlogin escape characterrlogincharacter to escape back to telnet command modecharacter to toggle local echoing on/offechoTelnet rlogin escape character is '%s'. Telnet escape character is '%s'. Format is 'set Name Value' 'set ?' for help. '%s': unknown argument ('set ?' for help). '%s': ambiguous argument ('set ?' for help). onFormat is 'set togglename [on|off]' 'set ?' for help. %s set to "%s". %s character is '%s'. Need an argument to 'unset' command. 'unset ?' for help. '%s': unknown argument ('unset ?' for help). '%s': ambiguous argument ('unset ?' for help). %s reset to "%s". ?Need to have LINEMODE option enabled first. 'mode ?' for help. Print help informationkludgelineDisable literal character echo-litecho+litechoEnable literal character echolitecho-softtabs+softtabsEnable tab expansionsofttabsDisable character editing-edit+editEnable character editingeditDisable signal trapping-isig+isigEnable signal trappingisigThese require the LINEMODE option to be enabled(or enable obsolete line-by-line mode)Enable LINEMODE optionline(or disable obsolete line-by-line mode)Disable LINEMODE optioncharacterformat is: 'mode Mode', where 'Mode' is one of: 'mode' command requires an argument Unknown mode '%s' ('mode ?' for help). Ambiguous mode '%s' ('mode ?' for help). won't %s. %-15s [%s] %-15s "%s" ?Ambiguous argument '%s'. ?Unknown argument '%s'. Deprecated usage - please use 'set escape%s%s' in the future. new escape character: Deprecated usage - please use 'toggle crmod' in the future. %s map carriage return on output. Fork failed SHELL/bin/sh-cExeclConnection closed. fromquitbyeVerify remote special character definitionscheckUse remote special character definitionsimportUse local special character definitionsexportNeed an argument to 'slc' command. 'slc ?' for help. '%s': unknown argument ('slc ?' for help). '%s': ambiguous argument ('slc ?' for help). List the current environment variableslistSend an environment variablesendDon't mark an environment variable for automatic exportunexportMark an environment variable for automatic exportUndefine an environment variableundefineDefine an environment variabledefineNeed an argument to 'environ' command. 'environ ?' for help. '%s': unknown argument ('environ ?' for help). '%s': ambiguous argument ('environ ?' for help). only Need %s%d argument%s to 'environ %s' command. 'environ ?' for help. DISPLAYunix:%s%sUSERLOGNAMEPRINTERCannot send '%s': Telnet ENVIRON option not enabled Cannot send '%s': variable not defined %c %-20s %s Connected to %s. notmuchOperating with LINEMODE option LocalNo%s line editing %s catching of signals Operating in obsolete linemode Operating in single character mode Catching signals locally Remote%s character echo %s flow control No connection. Escape character is '%s'. status?Already connected to %s open (to) -l-a-susage: %s [-l user] [-a] [-s src_addr] host-name [port] %s: %s hostname too long for unix domain socket: %sTrying %s... sockettelnetBad source route option: %s telnet: socketsetsockopt (source route)telnet: setsockopt (IP_TOS) (ignored)bindconnect to address %sUnable to connect to remote hostConnection closed by foreign host. opieenvironzslctoggleunsetsetopenmodedisplaylogoutclose%s> %s ?Ambiguous command ?Invalid command Commands may be abbreviated. Commands are: %-*s %s ?Ambiguous help command %s ?Invalid help command %s HOME/.telnetrcrDEFAULT?Ambiguous command: %s ?Invalid command: %s ?Need to be connected first for %s. @(#)main.c 8.3 (Berkeley) 5/30/95[host-name [port]][-r] [-s src_addr] [-u] [-e char] [-l user] [-n tracefile] [-4] [-6] [-8] [-E] [-L] [-N] [-S tos] [-c] [-d]Usage: %s %s%s%s%s rlog468EKLNS:X:acde:fFk:l:n:rs:t:uxy%s: Warning: -S ignored, no parsetos() support. %s: Warning: -f ignored, no Kerberos V5 support. %s: Warning: -F ignored, no Kerberos V5 support. %s: Warning: -k ignored, no Kerberos V4 support. %s: Warning: -x ignored, no ENCRYPT support. %s: Warning: -y ignored, no ENCRYPT support. -l-s,_```<_````````````L__``````_`l_````|_`````````````_`____````_ `` ````4`@``L```X`h`@(#)network.c 8.2 (Berkeley) 12/15/93select@(#)ring.c 8.2 (Berkeley) 5/30/95@(#)sys_bsd.c 8.4 (Berkeley) 5/30/95hhLhhhhTh\hhdhlhhhhth|hhhSetSockOptmallocsleep(5) from telnet, after select: %s @(#)telnet.c 8.4 (Berkeley) 5/30/95SENTvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvDISPLAYxxxxxxDxxxxxxxxxxxxxxxxxxxxxxxxxxxx|xdxxxxxUNKNOWNTERM%c%c%c%c%s%c%cNo room in buffer for terminal type. %c%c%c%c%ld,%ld%c%clm_will: not enough room in buffer }%%%%%%%`~,0%%%Ālm_will: no command!!! lm_wont: no command!!! lm_do: no command!!! lm_do: not enough room in buffer lm_dont: no command!!! lm_mode: not enough room in buffer localremoteremote defaultSpecial characters are %s values slc_import: not enough room slc_end_reply: not enough room env_opt_start: malloc()/realloc() failed!!! env_opt_add: realloc() failed!!! USERPRINTERSYSTEMTYPEJOBACCTRCVDIn SUBOPTION processing, RCVDȔTؕ<̓ܓXz close Remote side does not support STATUS option @(#)terminal.c 8.2 (Berkeley) 2/16/95@(#)utilities.c 8.3 (Berkeley) 5/30/95IACDONTDOWONTWILLSBGAELECAYTAOIPBRKDMARKNOPSEEORABORTSUSPEOFNEW-ENVIRONENCRYPTAUTHENTICATIONOLD-ENVIRONXDISPLOCLINEMODELFLOWTSPEEDNAWSX.3 PAD3270 REGIMETTYLOCOUTPUT MARKINGTACACS UIDEND OF RECORDTERMINAL TYPESEND LOCATIONSUPDUP OUTPUTSUPDUPDATA ENTRY TERMINALBYTE MACROLOGOUTEXTEND ASCIINAOLFDNAOVTDNAOVTSNAOFFDNAOHTDNAOHTSNAOCRDNAOPNAOLRCTETIMING MARKSTATUSNAMESUPPRESS GO AHEADRCPECHOBINARYEEOLEBOLEWRECROVERINSRTMCEOLMCBOLMCWRMCWLMCRMCLFORW2FORW1XOFFXONLNEXTRPEWSYNCH0-wCannot open %s. (standard output)%c 0x%x %c%.2x%.2x %s IAC %s%s IAC %d%s %s %sEXOPL%d%s %d %dresp DO_DONT %s: %d resp DO_DONT %d: %d want DO %s want DO %d want DONT %s want DONT %d DO %s DO %d resp WILL_WONT %s: %d resp WILL_WONT %d: %d want WILL %s want WILL %d want WONT %s want WONT %d WILL %s WILL %d RCVDSENT%s IAC SB (terminated by %s %d , not IAC SE!) (Empty suboption???)TERMINAL-TYPE IS "%.*s"SEND- unknown qualifier %d (0x%x).TERMINAL-SPEED (empty suboption???) IS %.*s SEND %d (unknown) ?%d?TOGGLE-FLOW-CONTROL OFF ON RESTART-ANY RESTART-XON %d %d (%d)LINEMODE WILL WONT DO DONT (no option???)Forward Mask %x%d (unknown) %dSLC %s NOSUPPORT CANTCHANGE VARIABLE DEFAULT|FLUSHOUT|FLUSHIN|ACK%s%s%s(0x%x) %d;MODE (no mode???)|LIT_ECHO|SOFT_TAB|TRAPSIG|EDIT%s%s%s%s%s (0x%x) ?0x%x? IS IS %s %s %s %d SB SEX-DISPLAY-LOCATION NEW-ENVIRON IS SEND INFO " VALUE " VAR " ESC " USERVAR " %03o %s (unknown)ȺȺȺȺȺȺȺȺȺȺȺȺȺȺȺȺȺȺȺȺȺȺȺȺpȺȺȺ %02x@(#)cl_bsd.c 8.29 (Berkeley) 7/1/96@(#)cl_funcs.c 10.50 (Berkeley) 9/24/96smcuprmcupError: move: l(%u) c(%u) o(%u)xterm]0;%susage: ex [-eFRrSsv] [-c command] [-t tag] [-w size] [file ...] usage: vi [-eFlRrSv] [-c command] [-t tag] [-w size] [file ...] %s@(#)cl_main.c 10.36 (Berkeley) 10/14/96TERMunknown]0;%s/dev/ttytcgetattr%s: No terminal database found %s: %s: unknown terminal type signal-reset%s:%s @(#)cl_read.c 10.15 (Berkeley) 9/24/96x,Xinputlines=%lucolumns=%lu@(#)cl_screen.c 10.49 (Berkeley) 9/24/96016|Vi's standard input and output must be a terminalTERMLINESCOLUMNS%s%s: unknown terminal typetcgetattrtcsetattrcupsmsormsoelcuu1%lu@(#)cl_term.c 10.22 (Berkeley) 9/15/96ywkgeWRPD@>4/>4)'ztrhcursor upkkcuu1cursor rightlkcuf1delete to end of screendGkedscroll upkripage upkpppage downknpcursor lefthkcub1delete lineddkdl1insert at cursorikich1go to sol^khomekendgo to eol$kllscroll downkinddelete to eolDkelcursor downjkcud1delete characterxkdch1insert lineOkil1ykth zlakahajakf%d233|This terminal has no %s keyfunction key %dstderr%s046|messages not turned on: %s045|messages not turned off: %sTERMlinestigetnum: linescolstigetnum: colsLINESCOLUMNS@(#)cut.c 10.10 (Berkeley) 9/15/96@(#)delete.c 10.12 (Berkeley) 10/23/96002|Line length overflow$FreeBSD: src/contrib/nvi/common/exf.c,v 1.3.2.1 2001/07/09 04:58:38 obrien Exp $/tmp%s/vi.XXXXXXXXXX237|Unable to create temporary file238|Warning: %s is not a regular file%s239|%s already locked, session is read-only%s/%s-c option240|%s: remove241|%s: close242|%s: remove243|%s: remove244|Read-only file, not written; use ! to override245|Read-only file, not written246|%s exists, not written; use ! to override247|%s exists, not written248|Partial file, not written; use ! to override249|Partial file, not written250|%s: file modified more recently than this copy; use ! to override251|%s: file modified more recently than this copy252|%s: write lock was unavailableaw254|%s: WARNING: FILE TRUNCATED256|%s: new file: %lu lines, %lu characters315|%s: appended: %lu lines, %lu characters257|%s: %lu lines, %lu characters258|%s expanded into too many file names.%d259|%s: not a regular file260|%s: not owned by you261|%s: accessible by a user other than the owner262|File modified since last complete write; write or use ! to override263|File modified since last complete write; write or use :edit! to override264|File modified since last complete write; write or use ! to override265|File is a temporary; exit will discard modifications266|File readonly, modifications not auto-written@(#)key.c 10.33 (Berkeley) 9/24/96079|No non-printable character found0123456789abcdef01234567,\qq,,qP276|Unexpected character event277|Unexpected end-of-file event279|Unexpected interrupt event280|Unexpected quit event281|Unexpected repaint event285|Unexpected string event286|Unexpected timeout event316|Unexpected resize event287|Unexpected write event x$0xx<HT`@(#)line.c 10.21 (Berkeley) 9/15/96003|unable to delete line %lu004|unable to append to line %lu005|unable to insert at line %lu006|unable to store line %lu007|unable to get last line008|Error: unable to retrieve line %lu@(#)log.c 10.8 (Berkeley) 3/6/96009|Log file/usr/src/usr.bin/vi/../../contrib/nvi/common/log.c010|Logging not being performed, undo not possible011|No changes to undoH,,l,,l,,,4-012|Logging not being performed, undo not possible0.X.----..013|Logging not being performed, roll-forward not possible014|No changes to re-do//0@00x0/0015|%s/%d: log put error267|Log restarted@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1992, 1993, 1994, 1995, 1996 Keith Bostic. All rights reserved. @(#)main.c 10.48 (Berkeley) 10/11/96exnexnviewviewc:eFGlRrSst:vw:only one -c command may be specified.only one of -r and -t may be specified.only one tag file may be specified.-s option is only applicable to ex.window=%s4444444P3`34444444444|33444444444444444 34D3444444p344444333433ex/vi: %s%.*s---c$-s%s: %s @(#)mark.c 10.13 (Berkeley) 7/19/96017|Mark %s: not set018|Mark %s: the line was deleted019|Mark %s: cursor position no longer exists@(#)msg.c 10.48 (Berkeley) 9/15/96020|Error: %s, %d: : %s%.*stABABA8,  299|yanked298|shifted297|moved296|joined295|deleted294|changed293|addedVL301|lines300|line%lu 317|%d files to edit021|new file022|name changed023|modified024|unmodified025|UNLOCKED026|readonly028|empty file027|line %lu of %lu [%lu%%]029|line %luLC_MESSAGESLANG%s%sVI_MESSAGE_CATALOG030|The file %s is not a message catalog268|confirm? [ynq]269|Press any key to continue: 270|Press any key to continue [: to enter more ex commands]: 161|Press Enter to continue: 275| cont?271|Press any key to continue [q to quit]: lOOOOOO@(#)options.c 10.51 (Berkeley) 10/14/96Lw tw8zyph8z]8zUKzEw@y;z60&!y yzyyyzz uj@`WL@C91z@'" zT{ { { {writeanywrapscanwrapmarginwraplenwindownamewindowwarnw9600w300w1200verbosettywerasetimeouttildeoptersetermtagstaglengthtabstopsourceanyslowopensidescrollshowmodeshowmatchshiftwidthshellmetashellsecuresectionssearchincrscrollrulerreportremapredrawrecdirreadonlypromptprintpathparagraphsoptimizeopenoctalnumbernoprintmsgcatmodelinemesgmatchtimemagiclocklistlisplinesleftrightkeytimeignorecaseiclowerhardtabsgtagsmodeflashfilecextendedexrcerrorbellsescapetimeedcompatibledirectorycommentcolumnsceditcdpathbeautifybackupautowriteautoprintautoindentaltwerase   "%&,*024:786~>{=xBu<q?i?gIdNaI^K[LXMwswmwlwiwawttytypettytstotltagswsmdsmslowshsectscrroreparaoptnumodelinesliichtgtexedebdircobfawapaiCDPATH:cdpath=%sTMPDIR/tmpdirectory=%sescapetime=6keytime=6matchtime=7/usr/share/vi/catalog/msgcat=%sreport=5paragraphs=IPLPPPQPP LIpplpipbppath=%s/var/tmp/vi.recoverrecdir=%ssections=NHSHH HUnhshSHELL/bin/shshell=%sshellmeta=~{[*?$`'"\shiftwidth=8sidescroll=16tabstop=8tags=%sscroll=%ldwindow=%lu031|Unable to set default %s optionall032|Usage: %s291|set: the %s option may not be turned off313|set: the %s option may never be turned on034|set: [no]%s option doesn't take a value035|set: %s option isn't a boolean036|set: %s option: %s037|set: %s option: %s: value overflow038|set: %s option: %s is an illegal number314|set: the %s option may never be set to 0039|set: %s option isn't a boolean305|No %s edit option specified%ld%*s no%s%s%s=%ld%s="%s"set %s set no%s set %s=%-3ld set 033|set: no %s option: 'set all' gives all option values@(#)options_f.c 10.25 (Berkeley) 7/12/96040|Screen columns too small, less than %d041|Screen columns too large, greater than %d042|Screen lines too small, less than %d043|Screen lines too large, greater than %d044|The lisp option is not implemented048|The paragraph option must be in two character groups049|The section option must be in two character groups@(#)put.c 10.11 (Berkeley) 9/23/96053|The default buffer is empty054|Buffer %s is empty@(#)screen.c 10.15 (Berkeley) 9/15/96@(#)search.c 10.25 (Berkeley) 6/30/96072|File empty; nothing to search073|Reached end-of-file without finding the pattern074|No previous search pattern075|Pattern not found076|Reached top-of-file without finding the pattern077|Search wrappedXdp|078|Searching...@(#)seq.c 10.10 (Berkeley) 3/30/96 %s@(#)recover.c 10.21 (Berkeley) 9/15/96%s055|Files with newlines in the name are unrecoverable%s/vi.XXXXXX056|Modifications not recoverable if the session fails057|Copying file for recovery...058|Preservation failed: %s059|Modifications not recoverable if the session fails060|File backup failed: %s061|Copying file for recovery...062|Information on user id %u not found%s/recover.XXXXXX063|Unable to lock recovery filePrecedence: bulkSubject: Nvi saved the file To: From: root (Nvi recovery program)Reply-To: rootX-vi-recover-path: X-vi-recover-file: %s%s %s%s %s %s %s%s %s%s %s -r : to this file using the -r option to You can recover most, if not all, of the changes , when it was saved for recovery. on the machine was editing a file named , the user On %s%.24s%s%s%s%s%s%s%s%s%s%s%s%s%s%s 064|Recovery file buffer overrun065|Recovery file.recdir: %srecover.r+066|%s: malformed recovery file%.24s: %s vi: no files to recover. %s/%s067|%s: malformed recovery file068|No files named %s, readable by you, to recover069|There are older versions of this file for you to recover070|There are other files for you to recover/usr/sbin/sendmail071|not sending email: %s%s -t < %s@(#)util.c 10.11 (Berkeley) 9/15/96@(#)ex.c 10.57 (Berkeley) 10/10/96script 170|Interrupted!#&*<=>@~080|Unknown command name1bca1082|%s: command not available in ex mode083|Count may not be zero084|%s: bad line specification085|Internal syntax table error (%s: %s)lr086|Usage: %s088|Flag offset to before line 1089|Flag offset past end-of-file090|@ with range running when the file/screen changed091|Global/v command running when the file/screen changed092|Ex command failed: pending commands discarded093|Ex command failed: mapped keys discardedڴڴڴڴڴڴڴڴڴڴڴڴڴڴڴڴڴڴڴڴڴڴڴڴڴ0l Ht094|The second address is smaller than the first(5$0123456789'\/?.+-^095|No mark name supplied096|\ not followed by / or ?097|Reference to a line number less than 0xxxxxxxx70000000000xxxxx@xxxxxxxxxxxxxxxxxxxxxxxxxxxx098|The %s command is unknown099|Address value overflow100|Address value underflow101|Illegal address combination102|Illegal address: only %lu lines in the file103|Illegal address: the file is empty104|The %s command doesn't permit an address of 0DtP@(#)ex_abbrev.c 10.7 (Berkeley) 3/6/96105|No abbreviations to display106|Abbreviations must end with a "word" character107|Abbreviations may not contain tabs or spaces108|Abbreviations may not mix word/non-word characters, except at the end109|"%s" is not an abbreviation@(#)ex_append.c 10.30 (Berkeley) 10/23/96 273|Entering ex input mode.@(#)ex_args.c 10.16 (Berkeley) 7/13/96111|No more files to edit112|No previous files to edit113|No previous files to rewind114|No file list to display ][%s%s%s@(#)ex_argv.c 10.26 (Berkeley) 9/20/96echo 115|No previous command to replace "!"116|No filename to substitute for %%117|No filename to substitute for #./%s304|Shell expansion failed289|Shell expansions not supported when the secure edit option is setpiperfdopenvfork-c118|Error: execl: %s119|I/O error: %s@(#)ex_at.c 10.12 (Berkeley) 9/15/96@(#)ex_bang.c 10.33 (Berkeley) 9/23/96!!%s 303|File modified since last write.! @(#)ex_cd.c 10.10 (Berkeley) 8/12/96120|File modified since last complete write; write or use ! to overrideHOME121|Unable to find home directory location%s/%s122|New current directory: %s%s@(#)ex_cmd.c 10.20 (Berkeley) 10/10/96H  n@!>] [file]wqwrite the file and switch to the next file[line [,line]] wn[!] [>>] [file]wnwrite the file[line [,line]] w[rite][!] [ !cmd | [>>] [file]]writedisplay vi key usage statement[viu]sage [key]viusageedit another file (from vi mode only)[Vv]i[sual][!] [+cmd] [file]enter visual (vi) mode from ex mode[line] vi[sual] [-|.|+|^] [window_size] [flags]2c11visualdisplay the program version informationversionexecute a global command on lines NOT matching an RE[line [,line]] v [;/]RE[;/] [commands]vdelete an input or command mapunm[ap][!] word!w1runmapdelete an abbreviationuna[bbrev] wordunabbreviateundo the most recent changeu[ndo]undorun the tcl interpreter with the commandtc[l] cmdtcldiscard all tagstagt[op][!]tagtopmove to the previous tagtagpr[ev][!]tagprevreturn to the previous group of tagstagp[op][!] [number | file]tagpopmove to the next tagtagn[ext][!]tagnext[Tt]a[g][!] [string]tag[line [,line]] t line [flags]tsu[spend][!]suspendsuspend the edit sessionst[op][!]stopread a file of ex commandsso[urce] filef1rsourcesuspend editing and run a shellsh[ell]shellset options (use ":set all" to see all options)se[t] [option[=[value]]...] [nooption ...] [option? ...] [all]wNsetrun a shell in a screensc[ript][!] [file]scriptsubstitute on lines matching an RE[line [,line]] s [[/;]RE[/;]repl[/;] [cgr] [count] [#lp]]edit the file containing the tag[Rr]ta[g][!] [string]!w1ortagre-edit all the files in the file argument listrew[ind][!]rewindgrow or shrink the current screenresize [+-]rowsc+resizerecover a saved filerecover[!] filerecoverappend input from a command or file to the line[line] r[ead] [!cmd | [file]]readexit ex/viq[uit][!]quitappend a cut buffer to the line[line] pu[t] [buffer]putedit the previous file in the file argument list[Pp]rev[ious][!]previouspreserve an edit session for recoverypre[serve]preserverun the perl interpreter with the command, on each lineperld[o] cmdperldorun the perl interpreter with the commandpe[rl] cmdperldisplay lines[line [,line]] p[rint] [count] [#l]printenter "open" mode (not implemented)[line] o[pen] [/RE/] [flags]openchange display to number lines[line [,line]] nu[mber] [count] [l]numberedit (and optionally specify) the next file[Nn][ext][!] [+cmd] [file ...]!fNnextwrite a .exrc filemkexrc[!] file!f1rmkexrcmap input or commands to one or more keysmap[!] [keys replace]!Wmap[line] ma[rk] keymarkmove lines elsewhere in the file[line [,line]] m[ove] linelmovedisplay lines in an unambiguous form[line [,line]] l[ist] [count] [#]listmark a line position[line] k keykjoin lines into a single line[line [,line]] j[oin][!] [count] [flags]!ca1joininsert input before a line[line] i[nsert][!]insertdisplay help statementhe[lp]helpexecute a global command on lines matching an RE[line [,line]] g[lobal][!] [;/]RE[;/] [commands]globalbring a backgrounded screen into the foreground[Ff]g [file]fgdisplay (and optionally set) file namef[ile] [name]filedisplay ex command usage statement[exu]sage [command]w1oexusage[Ee]x[!] [+cmd] [file]exbegin editing another file[Ee][dit][!] [+cmd] [file]f1oeditdisplay buffers, connections, screens or tagsdisplay b[uffers] | c[onnections] | s[creens] | t[ags]w1rdisplaydelete lines from the file[line [,line]] d[elete][flags] [buffer] [count] [flags]bca1deletecreate a set of tags using a cscope commandcs[cope] command [args]!scscopecopy lines elsewhere in the file[line [,line]] co[py] line [flags]l1copychd[ir][!] [directory]chdirchange the current directorycd[!] [directory]!f1ocdchange lines to input[line [,line]] c[hange][!] [count]!cachangeput a foreground screen into the backgroundbgdisplay file argument listar[gs]argsspecify an input abbreviationab[brev] [word replace]Wabbreviateappend input to a line[line] a[ppend][!]append@ [buffer]@shift lines right[line [,line]] >[>...] [count] [flags]>display line number[line] = [flags]1=shift lines left[line [,line]] <[<...] [count] [flags]<execute a buffer* [buffer]b*repeat the last subsitution[line [,line]] & [cgr] [count] [#lp]s&display numbered lines[line [,line]] # [count] [l]ca1#filter lines through commands or run commands[line [,line]] ! commandS!scroll lines^D@(#)ex_cscope.c 10.13 (Berkeley) 9/15/96v" \"G"B"  "        y m g  @ g Discard all current cscope connectionsresetkill numberKill a cscope connectionkillhelp [command]Show help for cscope commandshelpfind c|d|e|f|g|i|s|t buffer|pattern c: find callers of name d: find all function calls made from name e: find pattern f: find files with name as substring g: find definition of name i: find files #including name s: find all uses of name t: find assignments to nameQuery the databases for a patternfindadd file | directoryAdd a new cscope databaseadd309|Use "cscope help" for helpCSCOPE_DIRS :cscope.out%s/%scscope.tpath%s:pipevforkcd '%s' && exec cscope -dl -f %s-csh/bin/shexecl: %swr310|No cscope connections running%d%s 278|No matches for querysgdct efi311|%s: unknown search type: use one of %scscope: %d lines%1[ ]%s: "%s" %s doesn't match any cscope command Command: %s (%s) Usage: %s cscope commands: %*s: %s 312|%d: no such cscope session1No cscope connections. %2d %s (process %lu) @(#)ex_delete.c 10.9 (Berkeley) 10/23/96@(#)ex_display.c 10.12 (Berkeley) 4/10/96buffersconnectionsscreenstags123|No cut buffers to displaydefault buffer (line mode) (character mode)********** %s%s @(#)ex_edit.c 10.10 (Berkeley) 4/27/96@(#)ex_equal.c 10.10 (Berkeley) 3/6/96%ld @(#)ex_file.c 10.12 (Berkeley) 7/12/96@(#)ex_filter.c 10.34 (Berkeley) 10/23/96piperfdopenvfork-cexecl: %sfilterforkwparent-writerfilter read@(#)ex_global.c 10.22 (Berkeley) 10/10/96124|The %s command can't be used as part of a global or v commandpp@(#)ex_init.c 10.26 (Berkeley) 8/12/96/etc/vi.exrcNEXINITEXINITHOME.nexrc%s/%s.exrc125|%s/%s: not sourced: not owned by you or root126|%s/%s: not sourced: not owned by you127|%s/%s: not sourced: writeable by a user other than the owner128|%s: not sourced: not owned by you or root129|%s: not sourced: not owned by you130|%s: not sourced: writeable by a user other than the owner@(#)ex_join.c 10.10 (Berkeley) 9/15/96131|No following lines to join.?!@(#)ex_map.c 10.9 (Berkeley) 3/6/96132|No input map entries133|No command map entries134|The %s character may not be remapped135|"%s" isn't currently mapped@(#)ex_mark.c 10.8 (Berkeley) 3/6/96136|Mark names must be a single character@(#)ex_mkexrc.c 10.11 (Berkeley) 3/6/96.exrc137|%s exists, not written; use ! to override%swabbreviate map map! 138|New exrc file: %s@(#)ex_move.c 10.10 (Berkeley) 9/15/96139|Destination line is inside move range@(#)ex_open.c 10.7 (Berkeley) 3/6/96140|The open command requires that the open option be set141|The open command is not yet implemented@(#)ex_preserve.c 10.12 (Berkeley) 4/27/96142|Preservation of this file not possible143|File preserved@(#)ex_print.c 10.18 (Berkeley) 5/12/96%6lu TOOBIG $ [ynq]%c@(#)ex_put.c 10.7 (Berkeley) 3/6/96@(#)ex_quit.c 10.7 (Berkeley) 4/27/96@(#)ex_read.c 10.38 (Berkeley) 8/12/96!!%s ! r%s145|Only regular files and named pipes may be read146|%s: read lock was unavailable147|Reading...148|%s: %lu lines, %lu characters@(#)ex_screen.c 10.11 (Berkeley) 6/29/96149|No background screens to display @(#)ex_script.c 10.30 (Berkeley) 9/24/96150|The script command is only available in vi modetcgetattrptyforkemacsTERMemacs:TERMCAPtEMACS-iexecl: %sselectError: timed outError: shell: EOFshell151|No command to execute script-shellttypqrs0123456789abcdef@(#)ex_set.c 10.7 (Berkeley) 3/6/96@(#)ex_shell.c 10.38 (Berkeley) 8/19/96%s -i vfork-cexecl: %swaitpid; core dumped ...%.*s%s: received signal: %s%s%.*s%s: exited with status %d'55 55444444444 4 v4^4Y4 F434 #44 43333333k3T3<3Filesize limit exceededCputime limit exceededWindow size changesVirtual timer expiredUser defined signal 2User defined signal 1Urgent I/O conditionStopped (tty output)Stopped (tty input)SuspendedTrace/BPT trapTerminatedBad system callSuspended (signal)Segmentation faultQuitProfiling timer expiredBroken pipeKilledIOT trapI/O possibleInterruptInformation requestIllegal instructionHangupFloating point exceptionEMT trapContinuedChild exitedBus errorAlarm clockAbort trapUnknown signal: %d@(#)ex_shift.c 10.11 (Berkeley) 9/15/96152|shiftwidth option set to 0@(#)ex_source.c 10.12 (Berkeley) 8/10/96%s@(#)ex_stop.c 10.10 (Berkeley) 3/6/96@(#)ex_subst.c 10.37 (Berkeley) 9/15/96153|Count overflow154|Count underflow155|Regular expression specified; r flag meaningless156|The #, l and p flags may not be combined with the c flag in vi mode169|Confirm change? [n]157|No match found/ L L L L L L L L L L L L L L L L L L L L L L / L L ~ L L L L L L L } L } L L } } } } } } } } } } L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L ~ L L L ~ L L L L ~ L L L ~ L  [[:<:]][[:>:]]^.[]$*([ ]|/\*([^*]|\*/)*\*/)*\^.[]$*+?()|{}RE error: %s          ș ș ș ș ș ș ș ș ș ș            ̛                                ̛       ܛ          @(#)ex_tag.c 10.36 (Berkeley) 9/15/96158|No previous tag entered282|Already at the last tag of this group255|Already at the first tag of this group159|Less than %s entries on the tags stack; use :display t[ags]160|No file %s on the tags stack to return to; use :display t[ags]292|Display too small.%2d ... %*.*s %*.*s* %s%.*s 164|%s: the tag's line number is past the end of the file165|The tags stack is empty166|%s: search pattern not foundrxxglobal -%s '%s'r162|%s: tag not found%s 163|%s: corrupted tag in %smunmapclose%s/%s@(#)ex_txt.c 10.17 (Berkeley) 10/10/96 |  0  P     P 8  < < < <  < < <  < < < < < < < \ %c%6lu %.*s@(#)ex_undo.c 10.6 (Berkeley) 3/6/96@(#)ex_usage.c 10.13 (Berkeley) 5/3/96To see the list of vi commands, enter ":viusage" To see the list of ex commands, enter ":exusage" For an ex command usage statement enter ":exusage [cmd]" For a vi key usage statement enter ":viusage [key]" To exit, enter ":q!" The %.*s command is unknown Command: %s Usage: %s ^D%*s: %s The %s key has no current meaning Key:%s%s Usage: %s %s @(#)ex_util.c 10.23 (Berkeley) 6/19/96167|%d more files to edit168|Buffer %s is empty144|%s: expanded into too many file names283|The %s command requires the ex terminal interface272|That form of %s requires the ex terminal interface274|Command failed, no file read in yet.173|The %s command requires that a file have already been read in171|No previous buffer to execute172|No previous regular expression230|This screen may not be suspended290|The %s command is not supported when the secure edit option is set284|That form of %s is not supported when the secure edit option is set174|Usage: %s     ( 4 @ L T d @(#)ex_version.c 10.31 (Berkeley) 8/22/96Version 1.79 (10/23/96) The CSRG, University of California, Berkeley.@(#)ex_visual.c 10.13 (Berkeley) 6/28/96175|The visual command requires that the open option be set%luz%c%lu%luz%c @(#)ex_write.c 10.30 (Berkeley) 7/12/96! 253|Writing...%s@(#)ex_yank.c 10.7 (Berkeley) 3/6/96@(#)ex_z.c 10.10 (Berkeley) 3/6/96---------------------------------------- @(#)ex_tcl.c 8.10 (Berkeley) 9/15/96302|Vi was not loaded with a Tcl interpreter@(#)ex_perl.c 8.10 (Berkeley) 9/15/96306|Vi was not loaded with a Perl interpreter@(#)getc.c 10.10 (Berkeley) 3/6/96177|Empty file 4  4  @(#)v_at.c 10.8 (Berkeley) 4/27/96 %lu@(#)v_ch.c 10.8 (Berkeley) 3/6/96\ l x        178|No previous F, f, T or t search179|%s not found@(#)v_cmd.c 10.9 (Berkeley) 3/28/96" "@T"``@  ____  _`_\ <_$_l  __/ ^^  D^^P D^^t ^^ HD^`^P DJ^4^ D*^^t ^^D  @]]  ]]]] ]] ]v]| s]a]U] ] ]]|  @]\ \\  D\\  ,`\ \,  [[ D[[ "@D[[x [[0 (C[`[|+ "@DL[6[( "@D-[[P HD [Z  DZZ HDZ`ZKZ0Z "@"ZZ  @ZY YY$  DYY  ,sYUY  ,?Y Y "@YX`  XX0  XX@y  DXXX~XtX[Xtu  DRX8X  F%XX HEWW EWW`  W`W`  PWBW E9W W EWW," "@WVt  VV  VV VmV  dVNV=VV  F VUn  UUXq  DUU}  U`UAU4Ul 1UU'  @DUU%  @DUT   DTT@ @DTT "BTT  TvTXy  DmT[T  =T)TL  TSu  DSS  FSS  DSsS  jSRSP DIS3S D*SS  D SR RRp" "@WR  RRt  RR  \RGRD  6RRP  F RQn  QQpq  DQQ|  QQH~  iQ@Q~ @QP "@DPP  DPP "@DPP8k  PpP ~ reverse case[count]~ } move forward paragraph[count]} | move to column[count]| { move back paragraph[count]{ z reposition the screen[line]z[window_size][-|.|+|^|] y copy text to motion into a cut buffer[buffer][count]y[count]motion x delete character[buffer][count]x w move to next word[count]w u undo last changeu t before character in line forward search[count]t character s substitute character[buffer][count]s r replace character[count]r character p insert after cursor from buffer[buffer]p o append after line[count]o n repeat last search m set markm[a-z] l move right by columns[count]l k move up by lines[count]k j move down by lines[count]j i insert before cursor[count]i h move left by columns[count]h f character in line forward search[count]f character e move to end of word[count]e d delete to motion[buffer][count]d[count]motion c change to motion[buffer][count]c[count]motion b move back word[count]b a append after cursor[count]a ` move to mark`[`a-z] _ move to first non-blank_ ^ move to first non-blank^]] move forward section]][[ move back section[[ZZ save file and exitZZ Y copy line[buffer][count]Y X delete character before cursor[buffer][count]X W move to next bigword[count]W U Restore the current lineU T before character in line backward search[count]T character S substitute for the line(s)[buffer][count]S R replace characters[count]R Q switch to ex modeQ P insert before cursor from buffer[buffer]P O insert above line[count]O N reverse last searchn M move to screen middleM L move to screen bottom[count]L J join lines[count]J I insert before first nonblank[count]I H move to count lines from screen top[count]H G move to line[count]G F character in line backward search[count]F character E move to end of bigword[count]E D delete to end-of-line[buffer]D C change to end-of-line[buffer][count]C B move back bigword[count]B A append to the line[count]A @ execute buffer@buffer ? search backward?RE[? offset] > shift lines right to motion[count]>[count]motion < shift lines left to motion[count]<[count]motion ; repeat last F, f, T or t search[count]; : ex command:command [| command] ... 0 move to first character0 / search forward/RE[/ offset] . repeat the last command. - move up by lines (to first non-blank)[count]- , reverse last F, f, T or t search[count], + move down by lines (to first non-blank)[count]+ ) move forward sentence[count]) ( move back sentence[count]( ' move to mark (to first non-blank)'['a-z] & repeat substitution& % move to match% $ move to last column [count]$ # number increment/decrement[count]# +|-|# ! filter through command(s) to motion[count]![count]motion command(s) move right by columns[count]' '^^ switch to previous file^^^] tag push cursor word^] ^\ switch to ex mode^\^[ exit input mode, cancel partial commands^[ ^Z suspend editor^Z^Y page up by lines[count]^Y^W move to next screen^W^V input a literal character^V^U half page up (set count)[count]^U^T tag pop^T^R redraw screen^R^P move up by lines[count]^P^N move down by lines[count]^N^M move down by lines (to first non-blank)[count]^M^L redraw screen^L^J move down by lines[count]^J^H move left by characters[count]^H^G file status^G^F scroll down by screens[count]^F^E scroll down by lines[count]^E^D scroll down by half screens (setting count)[count]^D^C interrupt an operation (e.g. read, write, search)^C^B scroll up by screens[count]^B^A search forward for cursor word[count]^A@(#)v_delete.c 10.9 (Berkeley) 10/23/96@(#)v_ex.c 10.42 (Berkeley) 6/28/96207|The Q command requires the ex terminal interface <>suspend180|No previous file to edit!307|No ex command to execute@(#)v_increment.c 10.12 (Berkeley) 3/19/96aaaaa%#0*lo0x%0*lx0X%0*lX%+ld%ldabcdefABCDEF181|Cursor not in a number182|Resulting number too large183|Resulting number too small@(#)v_init.c 10.8 (Berkeley) 3/30/96@(#)v_itxt.c 10.16 (Berkeley) 10/23/96@(#)v_left.c 10.7 (Berkeley) 3/6/96@(#)v_mark.c 10.8 (Berkeley) 9/20/96@(#)v_match.c 10.8 (Berkeley) 3/6/96184|No match character on this line185|Matching character not found@(#)v_paragraph.c 10.7 (Berkeley) 3/6/96@(#)v_put.c 10.5 (Berkeley) 3/6/96@ D H L P T X \ @(#)v_redraw.c 10.6 (Berkeley) 3/6/96@(#)v_replace.c 10.17 (Berkeley) 6/30/96186|No characters to replace           @(#)v_right.c 10.7 (Berkeley) 3/6/96@(#)v_screen.c 10.10 (Berkeley) 4/27/96308|Enter to execute a command, :q to exit187|No other screen to switch to@(#)v_scroll.c 10.9 (Berkeley) 4/27/96@(#)v_search.c 10.18 (Berkeley) 9/19/96search+%lu188|Characters after search string, line offset and/or z command[[:>:]][[:<:]]%s%s%s189|No previous search pattern190|Search wrapped to original position@(#)v_section.c 10.7 (Berkeley) 3/6/96@(#)v_sentence.c 10.7 (Berkeley) 3/6/96d* * * * * * * * * * * * * * * * * * * * * * * k* T* \* * * * * \* * \* * * * * T* * * * * * * * * * * * * * * * * T* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * \* @(#)v_status.c 10.9 (Berkeley) 5/15/96@(#)v_txt.c 10.87 (Berkeley) 10/13/96191|Abbreviation exceeded expansion limit: characters discarded 192|Illegal character; quote to enterx7 7 7 @ \7 $7 \7 \7 \7 \7 D7 G 0B B G lG G G H; @ G G H; G G G C F G . conflicting matchers specifiedGREP_OPTIONSinvalid context length argumentegrepfgrepgrepreadskiprecurseunknown directories method-without-matchunknown binary-files type2.4d%s (GNU grep) %s Copyright (C) 1988, 1992-1998, 1999 Free Software Foundation, Inc. This is free software; see the source for copying conditions. There is NO warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. default@p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p k k k k k k k k k k 4p 4p 4p 4p 4p 4p 4p k k $l 4p hl tl l l p 4p 4p n 4p 4p 4p 4p 4p Sm 4p 4p @p l 4p l 4p o 4p 4p 4p 4p 4p 4p o l l l tm m 4p n n 4p 4p  o 4p 0o 4p 4p @o Sm \o 4p @p lo |o o n o 4p 4p 4p 4p 4p o memory exhaustedmemory exhaustedfgrepawkegrepgrepdefaultmemory exhausted^\(\(^\|[^[:alnum:]_]\)\(\)\([^[:alnum:]_]\|$\)\)$^((^|[^[:alnum:]_])()([^[:alnum:]_]|$))$\\#$FreeBSD: src/lib/libutil/logwtmp.c,v 1.14 2000/01/15 03:26:54 shin Exp $0123456789invalid hostname%d/var/log/wtmp%d%02d%03dT                                              ƙ    h            (    H  t                                \          <      |yvspmjgda^[XUROLIFC@=:74xrptNLMTncnsbsYGYFYEYDYCYBYAhlutccNDNPNRHC5inxxoulhzxtesosmsmidbdainhskmhcgneoxnxsxbambwʔǔĔ|yvspmjgda^[XkndTdBdNdCugYpYoBTYnYmYlYkYjYiYhYgYfYeYdYcYbYaNCpaCoMWmalwlhNlwsvtpbsglmliitco ޟ۟؟՟ҟϟ̟ɟƟß~{xurolifc`]ZWTQNKHEB?<9630-*'$!  ߞܞٞ֞ӞО͞ʞǞĞ|yvspmjgda^[XUROLIFC@=:741.+(%"  ݝڝםԝѝΝ˝ȝŝ}zwtqnkheb_\YVSPMJGDA>;852/,)&#  ޜۜ؜՜ҜϜ̜ɜƜÜ~{xurolifc`]ZWTQNKHEB?<9630-*'$!  ߛܛ֛ٛӛЛ͛=ʛǛě|yvspmjgda^[XUROLbxmumlGCGVGHGDGUGLGRG4G1G3G2kobcnlrsi2sLsAXvXtXrXoXlXhS8S7S6S5S4S3S2S1YZYzYyYxYwYvZzXys3s2s1s0cidvxlABAFGmRQMiKmZyZxZwZvZuZtZsZrZqZpZoZnZmZlZkZjZiZhZgZfZeZdZcZbZaZZZYZXZWZVZUZTZSZRZQZPZOZNZMZLZKZJZIZHZGZFZEZDZCZBZASbSfspIpIcocopu9u8u7u6u5u4u3u2u1u0WAPAfhPUTOQDDIHUWGCWRCDKSCLfMRMLMCcbFrFqFpFoFnFmFlFkFjFiFhFgFfFeFdFcFbFaFZFYFXFWFVFUFTFSFRFQFPFOFNFMFLFKFJFIFHFGFFFEFDFCFBFAF9F8F7F6F5F4F3F2F1RF!3!2!1%j%i%h%g%f%e%d%c%b%a#4#3#2#1*0*9*8*7*6*5*4*3*2*1&0&9&8&7&6&5&4&3&2&1%0%9%8%7%6%5%4%3%2%1@0@9@8@7@6@5@4@3@2@1LFLOeAXFXNRASARXSXkBpnacrPpOK5K4K2K3K1iPhuuctstawistsasrsfsccvrcrfr3r2r1rppopfpspxplpkUPSRRILEALSFICDODLDCpcnwmmmol9l8l7l6l5l4l3l2lal1l0kskekukTkRkFkrkPkNkHklkAkIkhk9k8k7k6k5k4k3k2k;k1k0kSkEkMkdkLkDktkCkakbipalicifi3isi1fsffvbueseeiedtemeaeecussomrmpmkimmhdmtimdmbashddsdldcvsupllndveCMlevihodocmCCchcdceclctcscrblbtNCURSES_NO_PADDINGCOLORFGBG A$@$  % 8% d% % x2d2d2dJ2d<2d,2d2d  Out of memory%dF4 4 4 F4 4 4 4 4 4 4 4 4 4 4 3 4 4 4 4 4 4 4 4 4 4 4 3 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 3 4 4 4 4 4 4 4 4 4 4 3 3 4 4 4 4 4 4 4 4 4 4 3 4 4 4 3 4 4 4 4 3 05 P5 P5 P5 P5 05  5 P5 P5 05 05 P5 05 P5 05 P5 P5 P5 P5 P5 P5 P5 P5 P5 P5 P5 P5 05 05 05 P5 P5 05 P5 P5 P5 P5 P5 P5 P5 P5 P5 P5 P5 P5 P5 05 5 P5 P5 P5 P5 P5 P5 P5 4 P5 P5 P5 P5 P5 05 P5 P5 P5 P5 4 4 P5 P5 5 P5 <5 P5 P5 4 05 P5 4 4 P5 P5 4 P5 P5 P5 P5 4 P5 P5 5 05 P5 05 7 6 6 7 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 ? @ @ @ 7 = |: @ @ ; : @ H; @ ; @ @ @ @ @ @ @ @ @ @ @ @ > > T? @ @ < @ @ @ @ @ @ @ @ @ @ @ @ @ = 9 @ @ @ @ @ @ @ 7 @ @ @ @ @ <> @ @ @ @ 7 7 @ @ H: @ <@ @ @ (8 h< @ 7 l9 @ @ 8 X@ @ @ @ 7 @ @ : = @ ? NCURSES_NO_SETBUF2Kn,X   `  %KLINESCOLUMNSTERMTERM environment variable not set. TERM environment must be <= %d characters. Not enough memory to create terminal structure. terminals database is inaccessible '%s': unknown terminal type. CC'%s': I need something more specific. '%s': I can't handle hardcopy terminals. @(#)termcap.c 8.1 (Berkeley) 6/4/93TERMCAPTERMPATHHOME.termcap /usr/share/misc/termcap/usr/share/misc/termcap:|:Out of memory|terminal names must start with letter or digitName collision between %s %sresolution of use=%s failedexit_standout_mode but no enter_standout_modeenter_standout_mode but no exit_standout_modeexit_underline_mode but no enter_underline_modeenter_underline_mode but no exit_underline_modeexit_alt_charset_mode but no enter_alt_charset_modeenter_alt_charset_mode but no exit_alt_charset_modeenter_alt_charset_mode but no acs_charsexit_alt_charset_mode but no acs_charsenter_blink_mode but no exit_attribute_modeenter_bold_mode but no exit_attribute_modeenter_ca_mode but no exit_ca_modeexit_ca_mode but no enter_ca_modeexit_delete_mode but no enter_delete_modeenter_delete_mode but no exit_delete_modeenter_dim_mode but no exit_attribute_modeexit_insert_mode but no enter_insert_modeenter_insert_mode but no exit_insert_modeenter_secure_mode but no exit_attribute_modeenter_protected_mode but no exit_attribute_modeenter_reverse_mode but no exit_attribute_modeto_status_line but no from_status_linefrom_status_line but no to_status_linemeta_on but no meta_offmeta_off but no meta_onprtr_off but no prtr_onprtr_on but no prtr_offrestore_cursor but no save_cursorsave_cursor but no restore_cursorexit_xon_mode but no enter_xon_modeenter_xon_mode but no exit_xon_modeexit_am_mode but no enter_am_modeenter_am_mode but no exit_am_modelabel_off but no label_onremove_clock but no display_clockdisplay_clock but no remove_clockset_color_pair but no initialize_pair/usr/share/misc/terminfoTERMINFO%s/%s%c/%.*sTERMINFO_DIRSEntry does not start with terminal names in column oneprimary namealias%s `%.*s' may be too longusetc%s (%s termcap extension) ignored%s (%s termcap extension) aliased to %s%s (%s terminfo extension) ignored%s (%s terminfo extension) aliased to %sextended capability '%s'unknown capability '%s'maMTbooleanstringnumericunknownwrong type used for %s capability '%s'unknown token typeк˺Ⱥúzwqnjga^XUPMHEB<kcuu1uptakhtsstkentnlkcuf1ndkcub1lekICimkich1ickhomehokrmireikcud1dokdl1dlkdch1dctbcctkclrclkelcekedcdkcbtbtkil1al  %s$<%d>hardware tabs with a width other than 8: %dhardware tabs with a non-^I tab string %sunknown capability `%.*s' in ko stringko translation table is invalid, I give upno value for ko capability %s%s (%s) already has an explicit value %s, ignoring koacsc string synthesized from XENIX capabilities``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~acsc string synthesized from AIX capabilitiesHOMEOut of memory%s/.terminfo@%&*!#Illegal character (expected alphanumeric or %s) - %spremature EOFempty longname fieldwhitespace in name or alias fieldslashes aren't allowed in names or aliases$[]!*?dubious character `%c' in name or alias fieldSeparator inconsistent with syntaxMissing separator after `%s', have %sno value given for `%s'Missing separatorIllegal character - %sPremature EOFIllegal ^ character - %sAllow ^? as synonym for \177Non-octal digit `%c' in \ sequenceIllegal character %s in \ sequenceVery long string found. Missing separator?r                                                                                        ̽    ܽ            Ľ Խ  Can't backspace off beginning of line     |xsnic_YUQMHC= 8!4"/#*$%"      . D}yspmic _ IZ U O JD>961+&"  !"#$%&'()*+,-./01;2L345678~9bx:r;m<g=a>]?Y@UAQBLCHDDE@F<G=8H4I0J,K&L MNOP Q RST7UiVWQXYZ[\]^!_`abc^defghijklmnopqr{s3utqumviwexay]zY{U|~R}O~KHDA=941-*'! 6Fzupkfa\WRMPHC>94/*e%   H+zupk f!a"\#W$R%M&HC(>)9*4+/,*-%. /02 3456789:<=>?@ABCD F G H I OL~xs%mid^YSNHC@= :!7"4#1$.%+&('%(")*+,- .E/0123456789:;<N=>?@ABCDpEFGHIzJtK5oLiM/bN]OXPSQNRJSET?U9V3W.X(Y#Z[X\]^|_`ab[cdefWghijklmnmopqrstuvwxxqytkze{_|Z}RU~OIC=70*$ !%&'"# ()$%&*+<{yvqlbox1memumemlOTGCOTGVOTGHOTGDOTGUOTGLOTGROTG4OTG1OTG3OTG2OTxrOTptOTmaOTkoOTknOTdTOTdBOTNLOTMTOTbcOTnlOTdNOTdCOTncOTnsOTbsOTugOTrsOTi2slengthsgr1evhlmethlmerhlmelohlmelhlmehhlmscesascescpctrmrmscsmscrmpchsmpchdispcslinessetcolorendbidefbicolornmbicrbinelbirepsmgtbsmglrs3dss2dss1dss0dscsindevtpfxlsetabsetafgetmreqmpminfokmouscsnmzeromdocrsupcssubcsrcsdrbimscsdsbimsmgtpsmgtsmgrpsmglpsmgbpsmgbscsmcuumcufmcubmcudpordermcuu1mvpamcuf1mcub1mcud1mhparumrsupmrsubmrshmrmicmrlmritmrwidmsumssupmssubmsshmsnrmqsnlqsmicmslmsitmsdrfqswidmdefccvrchrlpicpisetbsetfscpinitpinitcocopu9u8u7u6u5u4u3u2u1u0waitpausehookpulsetoneqdialdialhupwingocwinrmclkdclksclkflnsmgrsmglmgcel1kf63kf62kf61kf60kf59kf58kf57kf56kf55kf54kf53kf52kf51kf50kf49kf48kf47kf46kf45kf44kf43kf42kf41kf40kf39kf38kf37kf36kf35kf34kf33kf32kf31kf30kf29kf28kf27kf26kf25kf24kf23kf22kf21kf20kf19kf18kf17kf16kf15kf14kf13kf12kf11rfikUNDkSPDkSAVkRESkRITkRPLkRDOkPRTkPRVkOPTkNXTkMOVkMSGkLFTkICkHOMkHLPkFNDkEXTkEOLkENDksltkDLkDCkCRTkCPYkCMDkCANkBEGkundkspdksavkreskrstkrplkrfrkrefkrdokprtkprvkoptkopnknxtkmovkmsgkmrkkhlpkfndkextkentkendkcrtkcpykcmdkclokcankbegrmlnsmlnenacsxoffcxoncrmamsmamrmxonsmxonkcbtplnacscrmpmc5pkc3kc1kb2ka3ka1iproghuuctslhtwindhtssgrriindscvparcrfrs3rs2rs1repmc5mc4mc0pfxpflocpfkeycuurincufcubilindnichcuddldchpadnelsmmrmmlf9lf8lf7lf6lf5lf4lf3lf2lf10lf1lf0smkxrmkxkcuu1khtskrikindkcuf1kppknpkllkcub1kil1kich1khomekf9kf8kf7kf6kf5kf4kf3kf2kf10kf1kf0kedkelkrmirkcud1kdl1kdch1kctabkclrktbckbsipil1ich1ifis3is2is1fslffflashrmulrmsormirrmdcrmcupsgr0rmacsechsmulsmsorevprotinvissmirdimsmdcsmcupboldblinksmacshddsldl1dch1cvviscuu1llcuf1cnormmrcupcub1civishomecud1cupcmdchhpaedelcleartbccsrcrbelcbtbitypebitwinbtnswidcscpsorviorhiorlorcnpinsmlsmcsmjumpmaddrspinhspinvbufszncvpairscolorswnummalwlhnlabwslvtpbxmclmlinesitcolslpixcpixsamxvpadaisycrxmxhpahlsbcecccndscrnpcnrrmcchtsmc5inxonxonulhzxteslokosmsgrmirdbdainhskmhcgneoxenlxhpxsbambw\@@pHhTl$H x,D t<h `8@dP 4dDXL,lLd(|(H0P\|(|P00t(lX,TtL<8p4xL<$0XD`l4 \X8( x$T$x\<PXdDPDx|t4xTL<p 0`h`plL8,Tt||$<0,\pp4p@H |( @ D (lLX      | !"#$"     }zwtqnkhe b_\YVSPMJ G D A > ;8526/,)&#  !"#$ % & ' (m) * + , -. / 0f 1 23 4 56 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S~ T{ Ux Vu Wr Xo Yl Zi [f \#c ]` ^] _Z `W aT bQ cN dK eH fxE gB h? i< j9 k6 l3 m0 n- o* po' q$ r! s t u v w x y z { |R}O~ H       *'        %    u     ~             t  a m   d  | y vv `s p Wm j g d a ^ [ X U R O L I F C @ = : 7 4 1 . + ( % "        z     . '   X (   /     5 6 7 8 9 : ; < = > ? @ A B D E             ^ } z w t q n  k  h  e  b  _ \ Y V S P M J G D A > ; 8 5 2 / @= :!7"4#1$.%+&('%(")*, +) ,& -# . / 0 1 2 3 4 50 6 7 8 9 : ; < = > ? @ A B C Dg E Fh G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d~ e{ fx gu hr io jl ki lf mCc n` o\ pU] qZ rW sT tQ uN vK wH xE yB z? {< |9 }e6 ~f3 g0 h- i* ' $ !        ! % & ' " #  ] ( ) $ % & { * +              bxmumlGCGVGHGDGUGLGRG4G1G3G2xrptkokndTdBNLbcnldNdCncnsbsugrsi2sLsAXvXtXrXoXlXhS8S7S6S5S4S3S2S1YZYzYyYxYwYvZzXyMTs3s2s1s0cidvxlABAFGmRQMiKmZyZxZwZvZuZtZsZrZqZpZoZnZmZlZkZjZiZhZgZfZeZdZcZbZaZZZYZXZWZVZUZTZSZRZQZPZOZNZMZLZKZJZIZHZGZFZEZDZCZBZASbSfspIpIcWAPAfhPUTOQDDIHUWGCWRCDKSCLfMRMLMCcbFrFqFpFoFnFmFlFkFjFiFhFgFfFeFdFcFbFaFZFYFXFWFVFUFTFSFRFQFPFOFNFMFLFKFJFIFHFGFFFEFDFCFBFAF9F8F7F6F5F4F3F2F1RF!3!2!1%j%i%h%g%f%e%d%c%b%a#4#3#2#1*0*9*8*7*6*5*4*3*2*1&0&9&8&7&6&5&4&3&2&1%0%9%8%7%6%5%4%3%2%1@0@9@8@7@6@5@4@3@2@1LFLOeAXFXNRASARXSXkBpnacrPpOK5K4K2K3K1iPtstawistsasrsfcvr3r2r1rppopfpspxplpkUPSRRILEALSFICDODLDCpcnwmmmol9l8l7l6l5l4l3l2lal1l0kskekukTkRkFkrkPkNkHklkAkIkhk9k8k7k6k5k4k3k2k;k1k0kSkEkMkdkLkDktkCkakbalici3isi1fsvbueseeitemeaeecussomrmpmkimmhdmtimdmbasdsdcvsupndveCMlevihodocmCCchcdceclctcsblbtYpYoBTYnYmYlYkYjYiYhYgYfYeYdYcYbYaNCpaCoMWNlwssglicoYGYFYEYDYCYBYAhlutccNDNPNRHC5inxxoesmsmixnxsxbHPx0pX, $Px0X <@`p`4lp8<@ Lh0x\|,t\|\`$dt4| TDP @ t,d8(<|  L|l `  HL X \h t8`PH<dh l0H@4 `\tpD(H,X $(TDdd tp xpHhL t( <8XDl L lhl$8|D4TX\dTP\8<8d|04l@Pp\$PThPD l3! /!,!'!$!>'!!!5'!!'!  '!  '!!'!!!! ! !#! !>!!5!! !! !  !  !  !  !8  !  !$ u ! ! ! ! ! ! ! ! ! ! ! ! !                           #  BCKFKEKDKCKBTekKAIRISHSIBMkqGGGcGvGhGdGuGrG8G5G7G6RTPSPNPDLDHMENCOCFGSGEXENIXEEXSDSCVCIAT&TBOBSDsb! ! ! ! ! ! kselkbtabfont3font2font1font0Out of memorystring too complex to convertI'm confused%'%{string may not be optimal%Pa%ga%p%{96}%^%{127}%^saw %%r twice in %ssaw %%m twice in %ssaw %%n twice in %s%i%{10}%/%{16}%*%{10}%m%+%{2}%*%-%?%>%t%+%;%+%-%*%/%+%c%s%-%c%c%2d%3d%d%\unknown %% code %s (%#x) in %s$</>, t t t t t  t `  t  t   t t  t  t t t t t ( t t t  t  t t t t t t t t t t t t t t t t t t t t t t t T t t t t  H t  t < t t  t t t l  t t t H @ t \  h                 \%03o%>%%%%?%%{%d}%%>%%t%%{%d}%%+%%;%%?%%{%d}%%>%%t%%'%c'%%+%%;%%?%%'%c'%%>%%t%%{%d}%%+%%;%%?%%'%c'%%>%%t%%'%c'%%+%%;%B%%{%d}%%+%%c%%'%c'%%+%%c%D%n%mdoxX.%.%r H H H H H H H H H H 0 0 0 0 0 0 0 0 0 0 H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H   H H H H , H H H H H H  H H  Out of memory.,,,,,,,,,,,,,,,,,,,,,,,,,,,},z,w,t,q,o,m,k,i,g,e,c,a,_,],[,Y,W,U,S,Q,O,M,K,I,G,E,C,A,?,=,;,9,7,5,3,1,/,-,+,),',%,#,!,,,,,,,,,, , , ,,,,,++++++++++++++++++++++++++++++++++++++++++++++++++++++++}+z+w+t+q+n+k+h+e+b+_+\+Y+V+S+P+N+L+J+H+F+D+B+@+>+<+:+8+6+4+2+0+.+,+*+(+&+$+"+ ++++++++++ + ++++++********************************************************~_~^~]~\~[~Z~Y~X~W~V~U~T~S~R~Q~P~O~N~M~L~K~J~I~H~G~F~E~D~C~B~A~@^?~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"! ^_^^^]^\^[^Z^Y^X^W^V^U^T^S^R^Q^P^O^N^M^L^K^J^I^H^G^F^E^D^C^B^A^@(null)(cancelled)\%03o"%s", line %d, col %d, terminal '%s' ..}.y.t.q.n.k.h.e.b._.\.X.S.P.J.G.D.A.=.8.3...(.$..... ...-----------OTxrOTptOTNLOTMTOTncOTnsOTbslpixcpixsamxvpadaisycrxmxhpahlsbcecccndscrnpcnrrmcchtsmc5inxonxonulhzxteslokosmsgrmirdbdainhskmhcgneoxenlxhpxsbambw 211111111~1k1^1Q1@1-1!11000000000u0j0Y0@0000 0///////v/b/P/D9D3D.D*D%D DDDD DDDCCCCCCCCCCCCCCCCCCCCCCCCCCCCC{CwCsCoCiCcC^CXCTCPCLCFCAC=C8C2C-C(C$C CCCCC CCCBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB|BwBtBpBmBjBdB`B\BXBTBPBKBGBBB>B9B3B-B(B#BBBB BBBAAAAAAAAAAAAAAAAAAAAAAAAAA|AwArAmAhAcA_A[AVAQALAGABA=A8A4A/A*A%A AAAA AAA@@@@@@@@@@@@@@@@@@@@@@@@@@|@w@r@m@h@c@^@Y@T@O@J@E@@@;@6@1@,@'@"@@@@@ @@???????????????????????????}?z?w?t?q?n?k?h?e?b?\?V?R?M?H?D?@?>>>>>>>>>>>>>>>>>>>>>>>|>v>q>k>f>a>\>W>Q>K>F>@>;>5>/>)>$>>>>> >>======================z=s=m=g=a=\=T=O=J=E=@=;=6=1=,='="===== ==<<<<box1memumemlOTGCOTGVOTGHOTGDOTGUOTGLOTGROTG4OTG1OTG3OTG2OTmaOTkoOTbcOTnlOTrsOTi2slengthsgr1evhlmethlmerhlmelohlmelhlmehhlmscesascescpctrmrmscsmscrmpchsmpchdispcslinessetcolorendbidefbicolornmbicrbinelbirepsmgtbsmglrs3dss2dss1dss0dscsindevtpfxlsetabsetafgetmreqmpminfokmouscsnmzeromdocrsupcssubcsrcsdrbimscsdsbimsmgtpsmgtsmgrpsmglpsmgbpsmgbscsmcuumcufmcubmcudpordermcuu1mvpamcuf1mcub1mcud1mhparumrsupmrsubmrshmrmicmrlmritmrwidmsumssupmssubmsshmsnrmqsnlqsmicmslmsitmsdrfqswidmdefccvrchrlpicpisetbsetfscpinitpinitcocopu9u8u7u6u5u4u3u2u1u0waitpausehookpulsetoneqdialdialhupwingocwinrmclkdclksclkflnsmgrsmglmgcel1kf63kf62kf61kf60kf59kf58kf57kf56kf55kf54kf53kf52kf51kf50kf49kf48kf47kf46kf45kf44kf43kf42kf41kf40kf39kf38kf37kf36kf35kf34kf33kf32kf31kf30kf29kf28kf27kf26kf25kf24kf23kf22kf21kf20kf19kf18kf17kf16kf15kf14kf13kf12kf11rfikUNDkSPDkSAVkRESkRITkRPLkRDOkPRTkPRVkOPTkNXTkMOVkMSGkLFTkICkHOMkHLPkFNDkEXTkEOLkENDksltkDLkDCkCRTkCPYkCMDkCANkBEGkundkspdksavkreskrstkrplkrfrkrefkrdokprtkprvkoptkopnknxtkmovkmsgkmrkkhlpkfndkextkentkendkcrtkcpykcmdkclokcankbegrmlnsmlnenacsxoffcxoncrmamsmamrmxonsmxonkcbtplnacscrmpmc5pkc3kc1kb2ka3ka1iproghuuctslhtwindhtssgrriindscvparcrfrs3rs2rs1repmc5mc4mc0pfxpflocpfkeycuurincufcubilindnichcuddldchpadnelsmmrmmlf9lf8lf7lf6lf5lf4lf3lf2lf10lf1lf0smkxrmkxkcuu1khtskrikindkcuf1kppknpkllkcub1kil1kich1khomekf9kf8kf7kf6kf5kf4kf3kf2kf10kf1kf0kedkelkrmirkcud1kdl1kdch1kctabkclrktbckbsipil1ich1ifis3is2is1fslffflashrmulrmsormirrmdcrmcupsgr0rmacsechsmulsmsorevprotinvissmirdimsmdcsmcupboldblinksmacshddsldl1dch1cvviscuu1llcuf1cnormmrcupcub1civishomecud1cupcmdchhpaedelcleartbccsrcrbelcbt__^^^^^^^^^t^h^W^K^8^*^^^^]]]]]]]]u]c]T]B]0]]]\\\\\\\z\g\S\F\<\+\\\\[[[[[[[[[[[[|[t[m[f[^[W[P[I[B[;[4[-[&[[[[[ZZZZZZZZZZZZZZZZxZqZjZcZ\ZSZKZCZ:Z1Z ZZZYYYYYYYYYYxYpYdYVYHY:Y/Y YYYXXXXXXXXXXXXzXsXlXcXVXLXBX9X*XXXXWWWWWWWWWWWWzWqWhW_WVWJWAW8W/W#WW WWVVVVVVVVVVV|VpVhV`VUVLVCV9V/V%VVV VUUUUUUUUUUU~UtUfU^UVUNUFU>U6U.U&UUUUUTTTTTTTTTTTTTTTT~TvTnTfT^TVTNTFT>T6T.T&TTTTTSSSSSSSSSSSSSzSpSbSUSGS;S4S)SS??SSRRRRRRRRRRRRRRR{RlR]RKR9R)RR RQQQQQQ|QjQUQ>Q,QQQPPPPPPPvPkP_PMPDP6P&PPPOOOOOOOpO`OMO>O,OOONNNNNNNNN}NqNcNVNIN %s ""[]no inputemacsvi%s -> %s %-15s-> is undefined %-4s to %-7s-> %s Standard key bindings Alternative key bindings Multi-character bindings Arrow key bindings %s %s %s: Invalid switch `%c'. %s: Invalid \ or ^ in instring. %s: Invalid \ or ^ in outstring. %s: Invalid command `%s'. < < < < P< < < < < < (< `< < < < < < 4< < < < @< historyA A A A A A A A XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB lA xA XB XB A A XB XB XB XB XB XB XB A XB XB XB A XB A XB A XG lG hG G =G  G G xG (G *[]?Y Y (Y Y (Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y `Y pY sends cursor end@7sends cursor homekhcursor up multipleUPcursor right multipleRIcursor left multipleLEinsert multiple charsICcursor down multipleDOdelete multiple charsDCvisible bellvbend underlineuebegin underlineuscursor up oneupcursor to status linetsbegin standoutsoend standoutsenon destructive spacendend attributesmebegin boldmdsends cursor upkusends cursor rightkrsends cursor leftklsends cursor downkdinsert paddingipstart insert modeiminsert characterichome cursorhocursor from status linefsend insert modeeiend delete modeedstart delete modedmdelete a linedldelete a characterdcclear screenclcursor to horiz poschclear to end of linececlear to bottomcdaudible bellbladd new blank linealMTTab chars destructivextHas meta keykmNumber of columnscoNumber of lineslihas physical tabsptOut of termcap string space. TERMdumbCannot read termcap database; No entry for terminal type "%s"; using dumb terminal settings. downleftrighthomeend Your terminal has the following characteristics: It has %d columns and %d lines ano It has %s meta key not It can%suse tabs (empty) %25s (%s) == %s yessettc: Bad value `%s'. %s %d tabsmetabaud%lu rowslinescolsechotc: Termcap parameter `%s' not found. echotc: Warning: unknown termcap %% `%c'. echotc: Warning: Extra argument `%s'. echotc: Warning: Missing argument. echotc: Warning: Too many required arguments (%d).                                                                              chars:lflag:cflag:oflag:iflag:timeminstatuslnextdiscardreprintdsuspsuspwerasestopstarterase2eol2eoleofkillerasequitintrextprocaltwerasenokerninfoiextenpendinflushoechokeechoprtechoctltostopnoflshechonlechokechoeechoicanonisigmdmbufcrts_iflowccts_oflowclocalhupclparoddparenbcreadcstopbcignorextabsonlretonoeotonocrocrnlonlcropostimaxbelixoffixanyixonicrnligncrinlcristripinpckparmrkignparbrkintignbrk%s: Unknown switch `%c'. %*s%c%s %s %s: Invalid argument `%s'. > C < ̞ p C > <   C ( 4 L  C C | l  ̟ ؟ <   C C < ( Unmatched ) or \)Regular expression too bigPremature end of regular expressionInvalid preceding regular expressionMemory exhaustedInvalid range endInvalid content of \{\}Unmatched \{Unmatched ( or \(Unmatched [ or [^Invalid back referenceTrailing backslashInvalid character class nameInvalid collation characterInvalid regular expressionNo matchalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitL + + + + + + + + + + + + + + + + + + + + + + + + + ܣ + + + $ 8   + + h + + + + + + + + + + + + + + + +  + + + + + + + + + + + + + + + + + + + + + + + + + + + D  +  + + + + + + + + + + + + + + + + + + + + + + + + + + + + p `                            P                              0  p                         $ $ * l      ` * * * *   < <    *    L p * * * * 8  d    p , `   $   P 8   4 D \      \ <         t             <         No previous regular expression$FreeBSD: src/lib/libkvm/kvm.c,v 1.12.2.2 2000/08/23 08:53:00 kris Exp $%s: : %s : %scan't allocate %u bytes: %sexec file name too longbad flags arg/dev/mem%s/dev/null%s: not physical memory device/dev/kmem%s: %s invalid address (%x)kvm_readshort readkvm_writeshort writekvm_write not implemented for dead kernels$FreeBSD: src/lib/libkvm/kvm_i386.c,v 1.11.2.1 2001/09/21 04:01:51 peter Exp $cannot allocate vm_kernbase_IdlePTDbad namelistcannot read IdlePTDcannot read PTDvatop called in live kernel!_kvm_vatop: lseek_kvm_vatop: readinvalid address (%x)1.1.3%c%c%c%c%c%c%c%c%c%c: 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-unknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data check 1 :pHs deflate 1.1.3 Copyright 1995-1998 Jean-loup Gailly "" "$% $%$% $% $% $%1.1.3q     invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeat+`--/0 2C5666incompatible versionbuffer errorinsufficient memorydata errorstream errorfile errorstream endneed dictionary1.1.3       L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c         (08@P`p  0@`  0@`invalid literal/length codeinvalid distance codeWkX\YYZ[ \]~]] inflate 1.1.3 Copyright 1995-1998 Mark Adler  #+3;CScspp !1Aa  0@` oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengthsinvalid distance codeinvalid literal/length code$FreeBSD: src/lib/libc/string/strtok.c,v 1.2.6.1 2001/07/09 23:30:07 obrien Exp $$FreeBSD: src/lib/libc/string/strspn.c,v 1.1.1.1.14.1 2001/07/09 23:30:07 obrien Exp $$FreeBSD: src/lib/libc/string/strmode.c,v 1.1.1.2.6.1 2001/07/09 23:30:07 obrien Exp $-csh/bin/sh./%s: illegal option -- %c %s: option requires an argument -- %c $FreeBSD: src/lib/libc/stdtime/strftime.c,v 1.25.2.4 2002/03/12 17:24:54 phantom Exp $@(#)strftime.c 7.38@(#)strftime.c 5.4 (Berkeley) 3/14/89%c?%02d%m/%d/%y%2d%Y-%m-%d%03d %H:%M%ld%lu%H:%M:%S %d%04d%e-%b-%Y+-}}(~~~0L0dāP@d}p~~hp~0PH܁88܄Ѕ shut up gcc*** unknown regexp error code ***invalid argument to regex routineREG_INVARG"can't happen" -- you found a bugREG_ASSERTempty (sub)expressionREG_EMPTYrepetition-operator operand invalidREG_BADRPTout of memoryREG_ESPACEinvalid character rangeREG_ERANGEinvalid repetition count(s)REG_BADBRbraces not balancedREG_EBRACEparentheses not balancedREG_EPARENbrackets ([ ]) not balancedREG_EBRACKinvalid backreference numberREG_ESUBREGtrailing backslash (\)REG_EESCAPEinvalid character classREG_ECTYPEinvalid collating elementREG_ECOLLATEinvalid regular expressionREG_BADPATregexec() failed to matchREG_NOMATCHREG_0x%x0%dxdigitupperspacepunctprintlowergraphdigitcntrlblankalphaalnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNULD|xxxh[:<:]][:>:]]tp `\4DDDTRSHtcpshell%drcmd: getaddrinfo: %s rcmd: socket: All ports in use rcmd: socket: %s %s: %s connect to address %s: Trying %s... rcmd: write (setting up stderr): %s rcmd: too many files rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: accept: %s socket: protocol failure in circuit setup. rcmd: %s: %s 0r/etc/hosts.equiv/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts owner.rhosts writeable by other than ownerISO_ISOEUCja_JPeucJPko_KReucKRzh_CNeucCNASCIIUS-ASCIICPOSIXdxDDDDD,4<L\l|40%X%X                        /var/run/dev.db/dev/$FreeBSD: src/lib/libc/gen/strtofflags.c,v 1.18.2.1 2000/06/28 01:52:24 joe Exp $nouunlinknouunlnknoopaquenodumpnouimmutablenouchangenouchgnouappendnouappndnosunlinknosunlnknosimmutablenoschangenoschgnoarchivednoarchnosappendnosappnd ,stringlist: %mtplgc^YUQLHC?:50,'" usr2usr1infowinchprofvtalrmxfszxcpuiottouttinchldconttstpstopurgtermalrmpipesyssegvbuskillfpeemtabrttrapillquitinthupSignal 0tܼ׼üvcSG;0ӻlT@,User defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangup , | | | | | | | | | | | | | | @ | | | | | | | @ | |    @ |  8 %ur+sh-c/bin/shHOME.$FreeBSD: src/lib/libc/gen/getvfsbyname.c,v 1.5 1999/08/27 23:58:45 peter Exp $w+/dev/tty BLOCKSIZEGKM%s: unknown blocksizemaximum blocksize is %ldGminimum blocksize is 512%ld%s-blocks/kernel...//dev/ : xxswufsswap ,rwrqror/etc/fstabfstab: :%d: D,qW@." qS? a@W@&[D ya@sbN;,n[B  r\Illegal byte sequenceOperation canceledValue too large to be stored in data typeNo message of desired typeIdentifier removedNeed authenticatorAuthentication errorInappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisc quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0W$FreeBSD: src/lib/libc/gen/disklabel.c,v 1.9.2.1 2001/03/05 08:40:47 obrien Exp $DOC2KVinumCCDfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownvinumbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunused/etc/disktabb0b1tyremovablesimulatedsfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdx./$FreeBSD: src/lib/libc/string/strncat.c,v 1.1.1.1.14.1 2001/07/09 23:30:07 obrien Exp $$FreeBSD: src/lib/libc/string/strcspn.c,v 1.1.1.1.14.1 2001/07/09 23:30:06 obrien Exp $authunix_create: out of memory auth_none.c - Fatal marshalling problem/usr/bin/rshrcmdsh: unknown user: %s localhost%drcmdsh: getaddrinfo: %s rcmdsh: socketpairrcmdsh: fork failedrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: setuid(%u): %s /bin/sh-c-lrcmdsh: execlp %s failed: %s $FreeBSD: src/lib/libc/locale/setlocale.c,v 1.25.2.5 2002/03/12 17:20:53 phantom Exp $LC_MESSAGESLC_TIMELC_NUMERICLC_MONETARYLC_CTYPELC_COLLATELC_ALLLANGC/PATH_LOCALE/usr/share/locale=730noyes^[nN]^[yY]LC_MESSAGESpasswd.byname%upasswd.byuid/etc/pwd.db/etc/spwd.db%s: %mpasswd.adjunct.byname:##master.passwd.bynamemaster.%s%s/etc/netgroupr%c*%s.%s%s.**.%s*.*netgroup.byusernetgroup.byhost), , netgroup%s %sgroup.byname%dgroup.bygidr/etc/group: :/%s.dbtcrpxpxPATH/usr/bin:/bin:.execvp: : path too long sh/bin/shdddddddddddddddddddddddddddddddddddddddddddddddddddddd$FreeBSD: src/lib/libc/gen/err.c,v 1.6 1999/08/27 23:58:33 peter Exp $%s: : %s zqmiea]YUNG?5,% zq%I:%M:%S %pmd%a %b %e %H:%M:%S %Z %YPMAM%a %b %e %H:%M:%S %Y%m/%d/%y%H:%M:%SSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJanLC_TIMECPOSIXPATH_LOCALE/usr/share/locale//LC_CTYPErNONEUTF2EUCBIG5MSKanjiRuneMagi@x Cd{|+++T+++++++++++++++++++++++++++++++++++++++++++++++++lldddddddddd||$FreeBSD: src/lib/libc/string/strcoll.c,v 1.11.2.1 2001/07/09 23:30:06 obrien Exp $$FreeBSD: src/lib/libc/stdlib/strtouq.c,v 1.4.8.1 2001/03/02 09:45:20 obrien Exp $$FreeBSD: src/lib/libc/stdlib/strtoull.c,v 1.5.2.1 2001/03/02 09:45:20 obrien Exp $$FreeBSD: src/lib/libc/stdlib/strtoq.c,v 1.4.6.1 2001/03/02 09:45:20 obrien Exp $$FreeBSD: src/lib/libc/stdlib/strtoll.c,v 1.5.2.1 2001/03/02 09:45:20 obrien Exp $xdr_array: out of memory CPOSIX//LC_COLLATEr1.0 __collate_substitute__collate_strdup: udptcp%d%u/etc/host.confrhostslocalfilefilesdnsbindnis# /etc/hosts0123456789abcdefip6.intin-addr.arpa;; res_query(%s, %d, %d) ;; res_query: mkquery failed ;; res_query: send error ;; rcode = %d, ancount=%d `lTHll;; res_querydomain(%s, %s, %d, %d) %s.%sHOSTALIASESr;; res_mkquery(%d, %s, %d, %d) /&LOCALDOMAINr/etc/resolv.confdomain searchnameserver%dsortlistoptionsconfRES_OPTIONSenv;; res_setoptions("%s", "%s")... ndots:;; ndots=%d debug;; res_setoptions("%s", "%s").. ;; debug inet6insecure1insecure2no_tld_queryedns0tcpudpUnknown errorResolved protocol is unknownInvalid value for hintsSystem error returned in errnoai_socktype not supportedservname not supported for ai_socktypehostname nor servname provided, or not knownNo address associated with hostnameMemory allocation failureai_family not supportedNon-recoverable failure in name resolutionInvalid value for ai_flagsTemporary failure in name resolutionAddress family for hostname not supportedSuccess# /etc/host.confrhostslocalfilefilesdnsbindnisGAI# /etc/hostsBBBBBB%s.%s%d/%sservices.byportservices.byname%.*s %s/%sr/etc/services# ,/nisyellowpagesypdomaindnsbindhtablehosttable/etc/hostshostsr/etc/host.conf ,:;$FreeBSD: src/lib/libc/string/strsep.c,v 1.2.12.1 2001/07/09 23:30:07 obrien Exp $ hosts.bynamehosts.byaddrr/etc/hosts# gethostby*.gethostanswer: asked for "%s", got "%s"gethostby*.gethostanswer: asked for "%s %s %s", got type "%s"size (%d) too big Too many addresses (%d) Impossible condition (type=%d) res_search failed (%d) %u.%u.%u.%u.in-addr.arpa%x.%x.ip6.intres_query failed (%d) static buffer is too small (%d) syslog: unknown facility/priority: %x<%d>%.15s %s[%d]: %m /dev/console /var/run/log/dev/log$FreeBSD: src/lib/libc/string/strstr.c,v 1.1.1.1.14.1 2001/07/09 23:30:07 obrien Exp $$FreeBSD: src/lib/libc/string/strpbrk.c,v 1.1.1.1.14.1 2001/07/09 23:30:07 obrien Exp $$FreeBSD: src/lib/libc/string/strcasecmp.c,v 1.2.8.1 2001/07/09 23:30:03 obrien Exp $$FreeBSD: src/lib/libc/yp/yplib.c,v 1.34.2.2 2002/02/15 00:46:53 des Exp $SuccessInternal ypbind errorDomain not boundSystem resource allocation failureUnknown ypbind error: #%d /var/yp/binding%s/%s.%dclnttcp_createYP: server for domain %s not responding, retrying clntudp_createfcntl: F_SETFDyp_match: clnt_callyp_first: clnt_callyp_next: clnt_callclnttcp_create failed yp_all: clnt_callyp_order: clnt_callyp_master: clnt_callyp_maplist: clnt_callRequest arguments badRPC failureCan't bind to server which serves this domainNo such map in server's domainNo such key in mapYP server errorLocal resource allocation failureNo more records in map databaseCan't communicate with portmapperCan't communicate with ypbindCan't communicate with ypservLocal domain name not setServer data base is badYP server version mismatch - server can't supply service.Access violationDatabase is busyYP unknown error %d $0<DLT\dlt|$FreeBSD: src/lib/libc/yp/xdryp.c,v 1.9.2.1 2002/02/15 00:46:53 des Exp $clntudp_create: out of memory H0l4ЕܕȖ444,clnttcp_create: out of memory 4Xlԝ%s: %s; errno = %s ; low version = %lu, high version = %lu ; why = %s (unknown authentication error - %d) ; s1 = %lu, s2 = %lu |(|1u\>#LRPC: Unknown protocolRPC: Failed (unspecified error)RPC: Program not registeredRPC: Port mapper failureRPC: Unknown hostRPC: Remote system errorRPC: Server can't decode argumentsRPC: Procedure unavailableRPC: Program/version mismatchRPC: Program unavailableRPC: Authentication errorRPC: Incompatible versions of RPCRPC: Timed outRPC: Unable to receiveRPC: Unable to sendRPC: Can't decode resultRPC: Can't encode argumentsRPC: SuccessRPC: (unknown error code)%s: %s - %s %s: %s D*Failed (unspecified error)Invalid server verifierClient credential too weakServer rejected verifierInvalid client verifierServer rejected credentialInvalid client credentialAuthentication OKGMT/etc/localtime/usr/share/zoneinfo/mnposixrulesTZSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%.3s %.3s%3d %02d:%02d:%02d %d : 0808888888880888888888888088880888888888888888888888888888001234567890123456789abcdef0123456789ABCDEF[inet_ntoa error]$FreeBSD: src/lib/libc/string/strncpy.c,v 1.1.1.1.14.1 2001/07/09 23:30:07 obrien Exp $$FreeBSD: src/lib/libc/string/strerror.c,v 1.2.14.2 2001/12/20 06:31:26 wes Exp $Unknown error: 0123456789$FreeBSD: src/lib/libc/string/strdup.c,v 1.2.14.1 2001/07/09 23:30:06 obrien Exp $$FreeBSD: src/include/rpcsvc/yp.x,v 1.12 1999/08/27 23:45:12 peter Exp $xdr_reference: out of memory xdrrec_create: out of memory h@HPX`%u.%u.%u.%u%x$FreeBSD: src/lib/libc/string/strlcpy.c,v 1.2.4.1 2001/07/09 23:30:06 obrien Exp $xdr_bytes: out of memory xdr_string: out of memory H.LC_NUMERICLLLLMLLMMMMMMMMLC_MONETARYCPOSIX/union/usr/bin:/bin:/usr/sbin:/sbin:$ %$$%% %,%%%%%%%%%%$%,%%$sniglet^&TMPDIR/tmp%s/bt.XXXXXXXXXX0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzC!/dev/urandom$[[[[p[][J[7[[S\F\9\,\\\\8L8LL8 L $$mpool_new: page allocation overflow. InfNaN0123456789abcdef(null)0123456789ABCDEF0`ܫܫtܫܫܫܫܫܫܫܫDPPPPPPPPPܫܫܫܫܫܫܫܫܫܫdܫܫܫܫܫԟܫܫܫܫܫܫܫ,ܫܫܫܫܫܫܫܫܫܫܫܫkkܫܫܫxܫtܫ3ܫܫ׶׶׶׶P׶lHHDoHHHLoT\@Th|$FreeBSD: src/lib/libc/i386/gen/isinf.c,v 1.6 1999/08/27 23:59:21 peter Exp $@?5?55?5?InfinityNaN0?aCoc?`(?yPD?$@@@?4; error: warning: /etc/malloc.confMALLOC_OPTIONSunknown char in MALLOC_OPTIONS mmap(2) failed, check limits 4Ph$D\tjunk pointer, too low to make sense junk pointer, too high to make sense modified (page-) pointer modified (chunk-) pointer chunk is already free pointer to wrong page page is already free freelist is destroyed malloc() has never been called in malloc():recursive call out of memory in free(): in realloc():No address associated with nameUnknown server errorHost name lookup failureUnknown hostResolver Error 0 (no error): Resolver internal errorUnknown resolver error?res_send: %s ([%s].%s): %s res_send: %s: %s ;; res_send() kqueue;; Querying server (# %d) address = %s socket(vc)connect/vcwrite failedread failed;; response truncated ;; undersized: %d read(vc);; old answer (unexpected): socket(dg)connect(dg)sendsendtos out-of-boundskevent;; timeout recvfrom;; old answer: ;; not our server: ;; wrong query name: server rejected query: ;; truncated answer ;; got answer: P0 6$$$6;; res options: %s;; ns_parserr: %s ;; %s SECTION: .;; %s, type = %s, class = %s ;; ns_sprintrr: %s ;; ns_initparse: %s ;; ->>HEADER<<- opcode: %s, status: %s, id: %d ; flags: qr aa tc rd ra ?? ad cd; %s: %d, %s: %dNONEANYHESIODHSCHAOSIN4-#ADDITIONALAUTHORITYANSWERQUERYxUPDATEPREREQUISITEZONE` X U I F ( %                 i U  O > 8 $ !     U ~{gb@  `!L;"6#"any"URN Naming AuthorityNAPTRmail agent (deprecated)MAILAmailbox-related data (deprecated)MAILBzone transferAXFRincremental zone transferIXFRATM address (unimplemented)ATMAserver selectionSRVNIMROD locator (unimplemented)NIMLOCendpoint identifier (unimplemented)EIDnext valid name (unimplemented)NXTlocationLOCIPv6 addressAAAAgeographical position (withdrawn)GPOSmapping informationPXkeyKEYsignatureSIGNSAP_PTRnsap addressNSAProuterRTISDN addressISDNX25 addressX25DCE or AFS serverAFSDBresponsible personRPtextTXTmail exchangerMXmailbox informationMINFOhost informationHINFOdomain name pointerPTRwell-known service (deprecated)WKSnullNULLmail renameMRmail group memberMGmailboxMBstart of authoritySOAcanonical nameCNAMEmail forwarder (deprecated)MFmail destination (deprecated)MDname serverNSaddressA%dinitdebugaaonly(unimpl)usevcprimry(unimpl)igntcrecursdefnamstyopndnsrchinsecure1insecure2noaliasesinet6no-tld-queryedns0?0x%lx?%u%ld.%.2ld455555555455554555455555555555554555555554555545554(545454545454545455454545455454545(545454545454545454545454545(545454545454545455454545455454545(5?; error: unknown LOC RR version%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %sm%04d%02d%02d%02d%02d%02dZONEREFZONEINIT131211109876UPDATENOTIFYCQUERYUCQUERYMIQUERYQUERYNOCHANGE14ZONEERRNOTAUTHNXRRSETYXRRSETYXDOMAINREFUSEDNOTIMPNXDOMAINSERVFAILFORMERRNOERRORADDITIONALPREREQUISITESZONE. @ %s %s ( %lu; serial ; refresh ; retry ; expiry ); minimum %u %u %u %u %u %u %u ( %d )0x%04x %u %u ( %s %d %lu %s %sunknown RR typeRR format error\#( ; %s %02x ; \?x?OOx?@x?x?x?O4Ix??H0DEH0D\E?0DFOLJDODFFNOO(HOF" "\\len <= *buflen/usr/src/lib/libc/../libc/net/ns_print.c ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=assertion "%s" failed: file "%s", line %d Wbbbbabbbbbobbbbbb}bbbbLb%d%crhihiihhihHASH: Out of overflow pages. Increase page size d<Hdtd@ޚ֚ۚњ,̚ɚƚ\ -[3[0[-[(["[[[[ [[@ZZ Z@ZZZZZZZ^$^"^^^^^ ^ ^^^^^send account command to remote serverappend to a fileset ascii transfer typebeep when command completedset binary transfer typetoggle mget upper/lower case id mappingchange remote working directorychange remote working directory to parent directorychange file permissions of remote fileconnect to remote ftp servertoggle carriage return stripping on ascii getstoggle/set debugging modedelete remote filelist contents of remote directoryterminate ftp sessionexecute macrotoggle command line editingset file transfer formattoggle gate-ftp; specify host[:port] to change proxytoggle metacharacter expansion of local file namestoggle printing `#' marks; specify number to set sizeprint local help informationget (set) idle timer on remote sidechange local working directoryprint local working directorylist contents of remote directorydefine a macrodelete multiple fileslist contents of multiple remote directoriesget multiple filesmake directory on the remote machinelist contents of multiple remote directoriesset file transfer modeshow last modification time of remote filesend multiple filesget file if remote file is newer than local file nlist contents of remote directoryset templates for default file name mappingset translation table for default file name mappingview a remote file through your pagerenter passive transfer modetoggle use of PORT cmd for each data connectiontoggle preservation of modification time of retreived filestoggle transfer progress meterforce interactive prompting on multiple commandsissue command on alternate connectionprint working directory on remote machineterminate ftp session and exitsend arbitrary ftp commandreceive fileget file restarting at end of local fileget help from remote serverrename fileclear queued command repliesrestart file transfer at bytecounttoggle restriction of data port rangeremove directory on the remote machineshow status of remote machinetoggle store unique for local filessend one fileescape to the shellsend site specific command to remote server Try "rhelp site" or "site help" for more informationshow size of remote fileshow current statusset file transfer structuretoggle store unique on remote machineshow remote system typeset tenex file transfer typetoggle packet tracingset file transfer typeget (set) umask on remote sidesend new user informationtoggle verbose modeoCoLvo<oo9oDo:o8Xo:oW{o/:oitoK:o`WpoBo~ko:o ho:fonao:ö[o ;Xo4}Ro<o~Oo;o0Io;omBo;fop>o;;or0o<o~+o&<oi&oBo~!oB<oWoG;o o:B;o_o`<oko<oxm o<oio=on@=o~nK:o`Wn=non@@fon=o zn=;orn=on=nqn >nPtnM>nfoxzn>nPtn>oWn?fon@@fon+?nYn+?nYn@?fon?;orn?on@oTnG;o n@@fownf@oTnn@omen Aohk^n@AokXnAVnRnCo8XNnAoyInBo~CnBo{>n:B;o_8n`B;o^1nB.nLr(nBod nBo,n Co,nBoD~ n`Cfo{nCfomComCo8Xm@oDkm Do |mDfo\mDoemDoXmDomEomEoWm;EoimQEo\UmEo}mEoTxmEo km=oT~wog `݊يNJc,`@< ˉʼn`A  ӈ0/Έ0/ˈ,ƈ-8-X-`[ x]A[ 0˕0l1`/@E lt/oi_/ [@1`  <’@2Έ2 thmc@ ]oo_QXQd@YQPQooƚSQ`UQB ^QZQ™VQ`TQ>%\Q ]QQQژQQ˜bQ 9l9@(\: \:t:Ϡ\:ɠ\:àt:\:\:wt:oQ\:H\:? t:Έ:,9:h@)ΈXAXAEa@0FhFئFlFg@DGΈPBPBconnect to a siteclose current connectionforcibly logout remote user and close the connectionexit telnetprint status informationprint help informationtransmit special characters ('send ?' for more)set operating parameters ('set ?' for more)unset operating parameters ('unset ?' for more)toggle operating parameters ('toggle ?' for more)change state of special charaters ('slc ?' for more)display operating parameterssuspend telnetcompute response to OPIE challengeinvoke a subshellchange environment variables ('environ ?' for more)try to enter line or character mode ('mode ?' for more)U|@U8AW;`X:UIUIdVA`VX*V4ެV47!VG׬ W2Ӭ`WAѬW>XX?ɬ XB:VWĬW'deprecated command -- use 'toggle crmod' insteaddeprecated command -- use 'set escape' insteadΈW Z=EYp>""""ݸ׸Ӹи͸ɸƸød_[ID=1,'" ݹҹte^RJE>8/& ͺǺӸи͸ɸƸøĺ}yupk(standard output)/etc/gettytab\^:   }) 0/dev/ptyXXfv v v vP vt v v v v@ vx v v ?}A}G}B}}b}C}c}d}E}fn}lZ}LM}F?}F:}.}i"}n}x}}h|s|Z||z|q|r|e|v|q|a|U|u|V|Ht|w\  Ћ  Ћ  Ћ  Ћ Ȏ \  $FreeBSD: src/lib/msun/src/s_ilogb.c,v 1.6 1999/08/28 00:06:49 peter Exp $\]^7ba_`c8V9Mdefg:U;J<H=>LhW?O@NiAB CD  !"#$%E &'()*+,-./F 0123456789G :;<=>?@ABCH D E F GIJKjkLMKNIOP[lmcnoQRpqRSrZstuvwxSyz{|}~TPUQVTWDT  %%p%c%%{10}%%/%%{16}%%*%%p%c%%{10}%%m%%+@(#)history.c 8.1 (Berkeley) 6/4/93%_0 x  < ,  H D h      l 8    ,   h             $ @' ,# 4!  & # ' ' D" "  & ' # & (' & 0$ ! \   ē  ܘ    ,  ,  $   $ @  \  t М    `  |  Ԕ \ ܛ (  Ę ` vvF@vvGuuIuyuJ\uIuD uuEtt8txt9_tNt@ ttOssPs|sS@ssTrr:rr?rr6rdr7@rr<rq>qqUqZqXFq9qY%qq;ppZpp=`pEpBpoAooRooQloVoM onNnnCnlnH@n+nVnmWmmK`mDmLml'll&`lDl5 l l,kk-kpk%@kk)jj0j|j4@jj#ii.iai1Ji9i(ii3hh/hsh2@h!h$hg*gg+g}ghg^gDg0ggfff ff `fEf ffee eje@eeedddd_dDd6d"d dccccccwchcRc?c! cb bb bbbmb@b-bb baaaa`aPa2aa```\`K`>`+` ``w1 ' ""   !,-5/"""""""""""""""""""""""""""""""$""""""""""""""""""""""""#&"0"""""."""""4"%""""""""#&"0""""".""""""4"%"""""""B=   !A;""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" "" """   !"A""""/""" """ """"""L"RZK"""Q"7I: UH""@""NG"PTWY"D"""" ""6J9<>C"? "M"F"OSVX"E"""""8""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""_t; _ ~ xy) _D{ _T| _, ? fwdbck:j~W~T~G~D~4~1~~~~~}}}}}}}}}}}}x}u}i}f}U}R}@}=}.}+}}}}}|||||||||||||}|g|d|V|S|C|@|2|/|"|| ||{{{{{{{{{{|{y{h{~~~~~~~~~p~m~~[1~[4~OAOBOCODko(!@ (@!@ a(@!  = =,A"'B" """"܄Մ΄DŽ @ }w pi@c[TNG@ :@3( @܃@ԃ ̓ƃ ~ y@rlg`[ U@ME?84/@(#)tokenizer.c 8.1 (Berkeley) 6/4/93O4цve@҅E:9.!9`@` `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`??@$FreeBSD: src/lib/libc/stdio/asprintf.c,v 1.6 1999/08/28 00:00:55 peter Exp $qWL1$ ۭĭtiP E1 '   ݬϬ Ĭmb@"ݮ׮ѮˮŮ   ֱұαʱƱ±       x u e b_[WSOKGC?;840,)%" !"#ܰ$ϰ%Ű&'()*+~,w-j-c.Y.S/K/F0B1>28334.5*6$789: ;<=ܯ>ί?@[\\}]r^`^U_L_?`4{!{|}}~/dev/3)"ݸӸ̸¸@(#)getbsize.c 8.1 (Berkeley) 6/4/93idZPG@1*$ $OpenBSD: dirname.c,v 1.4 1999/05/30 17:10:30 espie Exp $@aHapa,b cCCCCCCC  d  `8 k@`? <?@* @ XxDl(0@(#)localtime.c 7.57WILDABBRqq@(#)asctime.c 7.7$FreeBSD: src/lib/libc/net/ns_netint.c,v 1.2 1999/08/28 00:00:14 peter Exp $$FreeBSD: src/lib/libc/net/ns_name.c,v 1.2 1999/08/28 00:00:14 peter Exp $0123456789X$|8lH0H0HRuneMagiNONEXBBBBB@(((((((((((((((          (((((((    ((((((    ((((  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~C[ 0000000000000000}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMD7yACnF?O8M20HwZ