<fjQPS1Pjf1ɎَѼ|}r,g|uuƀrIᾬ}R1҉ 5w ޿))0`duddu`ûDL Ss*}}0r4uRZr?tfFRff1fC0fZf=wD@(f8r^P[s Ot0FsF ^(Fw.yURAZoUd]BReadBoot error PUWEVfd1440P$@ ,WEV(i @ @ @ BTX@1мfjf9W_s uU}EEE Efh ( f"1ɱѱ8ٺ6 -)б3QPhj+5 QQQQRja 1f֐ юَH"1Ўػptr4!PP 栈!桰!桰!XX!j@j td>0tc>2tk> u~tEj$USm]]fEfE EfCe[]XPPPP`jr11t$PV^=1ɱ󥖋D$@t+rBR/=_D$HuKKf)8󥑉-w1)ثufȫd$aσuD$ `X6rtltŰ=Vtf\tGt3CRu fu6 Ж1t -t ^ u 뎪PXPX$< i/ u`1ɴPf 8cuf1< tPЀfBPr0ƀrf Pffag ?P}9m(t int@errDeflPeipHeax4ebx(ecx0edx,esiediebp espcsLds es fsgssscs:eipHss:espBTX halted'00b1001h01 51Çl$EMU ]$PXE(PD$E,D$Xu0}4l$UWVS0 0 ) *1Ҁ= *|$*(* )@,*`00Tj10j%001۾p00000tO00 ы0 у? C~h"vthh@*P@*=@*t&Sh"h" S t1@*tH@,=@,u:u#j h"S j7u Su jh"S h@,0*aP5(*$*# *Ph"x #tt jZtw@*j ƃ u ttA, t"u"@*vOj j 1"-@*=}GtV uj 1h@*t j h@, UUWVSEP8u =0 URh#n j4EP8PEf= t=ELFh#h$#, }+00uS8R|E%uS8PUqE%EË0ډ0jEPS E܅PS8P!]jS8R3VS8PlE裸0Dž41f}t=1j \/S8R;u 4FE9} 4~11\/+0D/0t/S8P8T F~ŋE%Ë0ډ0UMA9DE죸0jP0Z=0tCPh"!.K:Sut @A:uu:kCÍ9rhS6߃t=0tj 1ۅ~:/uB 1u[^_US]Su u#9u1h#h$#V] UWVS]=<*u}=*uh@7**jj5*{u+hd5*h$=\)TthE#80$ *<*u19*5*15$lj $$!=$=$15x$Ƌ `$> d$P5*f15x$)5* *0* *E E05))9uvuUU6 P$0  <)k)9*tI=*uh@*5* d$)P5*)*C=t$*:  C P$ )9wu;)w50$5)#58)5@)#5L$9= *t* P d$P5*S= *0#8));uvuV*PMQu50)uEe[^_ UWVS=<*U=*uhx*4*jj5* *þ,*ǃw=1ڀzu uw Fu t Fvڃ=,*u,*t#t\{t hN#C4*j4*@P5*(uy *9WEVu WEVt=0*tihT#E=8*ufyu $*8*0*9suhZ#h$#4#4*u4*E E Pue[^_ UWVS}u %Gst% ctut0xt+vvo^;tdPqC;uSEuuE F]1u#CȅuKE9rP&KE9sPGN1e[^_US] uj S]UVSuUM t ACJu[^ U=*u01%)У**U‰*UE000UWVS]} u##Phd#b00%0 0=0f0؃00 5 *50k00u1W0Phh#e[^_ UVSu=@0|21jt l+0u9r9r1e[^US]#t(0%00#tS؋]US]=@0|I#tjBt u&j3*#ttu t1]US]00u 0 04[fRf fZBB--uf1ɵ@ tD$ f1$Ðdafd wdad%s /boot.config%s: %s/boot/loader/kernel >> FreeBSD/i386 BOOT Default: %u:%s(%u,%c)%s boot: No %s formatInvalid %s yesnoKeyboard: %s Not ufs slicelabelpartition%cDisk error 0x%x (lba=0x%x) DhaCcdgnPrsv  """""0123456789abcdef/|\- 08Z=@   Z=]n:;`H/mnt///@@<@T 08Z=@   Z=]n:;`S}@@<@TU Z=@ H0(7 < h_&w3>}AZ=Z=Z=JnAZ=Z=Z=.T7Z=Z=Z=W.&n!Z=Z=Z=j/!Z=Z=Z=I!Z=Z=Z=;\!Z=Z=Z={$!Z=Z=Z= p!Z=Z=Z=7!Z=Z=Z= 9i&!Z=Z=Z=ZJdd!Z=Z=Z=74!Z=Z=Z=@pX*!Z=Z=Z=2 !Z=Z=Z=O*%!Z=Z=Z=!Z=Z=Z=N"aFmAZ=Z=Z=!Z=Z=Z=!Z=Z=Z=,{!Z=Z=Z=?_!Z=Z=Z=g !Z=Z=Z=&6!Z=Z=Z=O!Z=Z=Z=xRr!Z=Z=Z=(!Z=Z=Z=+o6!Z=Z=Z= YYf!Z=Z=Z= $d!Z=Z=Z= Qi!Z=Z=Z= d!Z=Z=Z= `!!Z=Z=Z= !Z=Z=Z= Z4R!Z=Z=Z= +P!Z=Z=Z= ~lK!Z=Z=Z= Qo.!Z=Z=Z= Fbu!Z=Z=Z= !<!Z=Z=Z= l?f!Z=Z=Z= n!Z=Z=Z= k !Z=Z=Z= tw!Z=Z=Z= #F!Z=Z=Z= h+!Z=Z=Z= >&@!Z=Z=Z= U=L!Z=Z=Z= eq!Z=Z=Z= YQH!Z=Z=Z=  T!Z=Z=Z= `l!Z=Z=Z= f(!Z=Z=Z= t^!Z=Z=Z= ҆-}!Z=Z=Z= bw!Z=Z=Z=  KP!Z=Z=Z= &!Z=Z=Z= +-!Z=Z=Z=  7!Z=Z=Z= &; !Z=Z=Z=t&!Z=Z=Z=t~=/!Z=Z=Z=t^"+!Z=Z=Z=t!Z=Z=Z=tdm!Z=Z=Z=t߂|!Z=Z=Z=t"+d!Z=Z=Z=t'!Z=Z=Z=tV&q!Z=Z=Z=tL!!Z=Z=Z=t!Z=Z=Z=tæ !Z=Z=Z=tA!Z=Z=Z=t$!Z=Z=Z=tpS!Z=Z=Z=tVm!Z=Z=Z=tñ\!Z=Z=Z=t !Z=Z=Z=t^!Z=Z=Z=t%!Z=Z=Z=t.t!Z=Z=Z=umK!Z=Z=Z=uM!Z=Z=Z=v7R!Z=Z=Z=v>H!Z=Z=Z=v~E!Z=Z=Z=vBL[#!Z=Z=Z=v o!Z=Z=Z=v4ts!Z=Z=Z=v2{Z!Z=Z=Z=vcDy!Z=Z=Z=vQ !Z=Z=Z=v.u!Z=Z=Z=v $!Z=Z=Z=vK$!Z=Z=Z=v3c!Z=Z=Z=vHc!!Z=Z=Z=vl !Z=Z=Z=v~!Z=Z=Z=vI!Z=Z=Z=v *!Z=Z=Z=v>!Z=Z=Z=v` !Z=Z=Z=vl!Z=Z=Z=w!Z=Z=Z=wOt!Z=Z=Z=Y!Z=Z=Z=}3z!Z=Z=Z=f!Z=Z=Z=]8!Z=Z=Z=!Z=Z=Z=C!Z=Z=Z=*"!Z=Z=Z=cm!Z=Z=Z=y[!Z=Z=Z=gM!Z=Z=Z=Al:3!Z=Z=Z=~!Z=Z=Z=-V<!Z=Z=Z=à&!Z=Z=Z=jY!Z=Z=Z=?d5!Z=Z=Z=j2!Z=Z=Z=O!Z=Z=Z=PKEZ!Z=Z=Z="V!Z=Z=Z= 6%2!Z=Z=Z=E6{!Z=Z=Z=E ߹`!Z=Z=Z=WF1!Z=Z=Z=W4H!Z=Z=Z=W2 !Z=Z=Z=W 1!Z=Z=Z=W/!Z=Z=Z=W˩8x!Z=Z=Z=WO!Z=Z=Z=WaP$!Z=Z=Z=WQ!Z=Z=Z=WDI!Z=Z=Z=W9!Z=Z=Z=W& !Z=Z=Z=WQyi!Z=Z=Z=W4LB!Z=Z=Z=W̅I!Z=Z=Z=Wj5W!Z=Z=Z=W-!Z=Z=Z=W3_[!Z=Z=Z=W!p !Z=Z=Z=Wf!Z=Z=Z=W_o~!Z=Z=Z=Zm1!Z=Z=Z=+Qv!Z=Z=Z=+L!Z=Z=Z=+Sc!Z=Z=Z=+뛝E!Z=Z=Z=+=''!Z=Z=Z=+v9!Z=Z=Z=+ w!Z=Z=Z=+0"!Z=Z=Z=+U!Z=Z=Z=+(!Z=Z=Z=+y1!Z=Z=Z=+=e&!Z=Z=Z=+Z!Z=Z=Z=+ya!Z=Z=Z=+!Z=Z=Z=+ K*!Z=Z=Z=+i!Z=Z=Z=+fp!Z=Z=Z=+s!Z=Z=Z=+@!Z=Z=Z=+,?z!Z=Z=Z=x]!Z=Z=Z=͞!Z=Z=Z=!Z=Z=Z= (4!Z=Z=Z= ȯ !Z=Z=Z=)5d!Z=Z=Z=?!Z=Z=Z=-u=!Z=Z=Z=M{!Z=Z=Z=>=p!Z=Z=Z=}q4!Z=Z=Z=uH!Z=Z=Z= \S!Z=Z=Z= gz!Z=Z=Z= o!Z=Z=Z= U\ !Z=Z=Z=q|q!Z=Z=Z= '!Z=Z=Z= C(Z=Z=Z=ttyv0F!Z=Z=Z=SDBD!Z=Z=Z=zNBD!Z=Z=Z=$fuBD!Z=Z=Z=#&!Z=Z=Z=m!Z=Z=Z=!Z=Z=Z=l,!Z=Z=Z=Gz]!Z=Z=Z=`!Z=Z=Z=eql!Z=Z=Z=r X!Z=Z=Z=nR*q!Z=Z=Z= 2o!Z=Z=Z=i~`!Z=Z=Z=%!Z=Z=Z=!Z=Z=Z=\E!Z=Z=Z=fd!Z=Z=Z=WM!Z=Z=Z=@!Z=Z=Z=M5U!Z=Z=Z= e7!Z=Z=Z= d !Z=Z=Z= ,(!Z=Z=Z= F|!Z=Z=Z= >#y!Z=Z=Z= P5!Z=Z=Z= gn!Z=Z=Z= ij !Z=Z=Z= -^!Z=Z=Z= !!Z=Z=Z=LeP!Z=Z=Z=,!Z=Z=Z=~!Z=Z=Z=n v!Z=Z=Z=k!Z=Z=Z=!Z=Z=Z=cw"!Z=Z=Z=aw!Z=Z=Z=G}1!Z=Z=Z=!Z=Z=Z=#$O!Z=Z=Z=J"!Z=Z=Z=}!Z=Z=Z=0!Z=Z=Z=IDH!Z=Z=Z= !Z=Z=Z= u!Z=Z=Z=y-!Z=Z=Z=3[!Z=Z=Z=35!Z=Z=Z=QT!Z=Z=Z=3]!Z=Z=Z=FS?!Z=Z=Z=@+!Z=Z=Z=)Z!Z=Z=Z=v8!Z=Z=Z=T/a!Z=Z=Z=51H!Z=Z=Z=*D!Z=Z=Z=03?!Z=Z=Z=:WP!Z=Z=Z=2!Z=Z=Z=Gk!Z=Z=Z=.O!Z=Z=Z=u< !Z=Z=Z=.J!Z=Z=Z=l!Z=Z=Z= ,!Z=Z=Z=@a|!Z=Z=Z=J!Z=Z=Z=p;!Z=Z=Z=ΫK!Z=Z=Z=@!Z=Z=Z= /9!Z=Z=Z=XE{!Z=Z=Z= Lt !Z=Z=Z=kG!Z=Z=Z=Rr;p!Z=Z=Z=iS6!Z=Z=Z=ja#!Z=Z=Z=oۜ&!Z=Z=Z=4ݧ9!Z=Z=Z=]E!Z=Z=Z=b"e!Z=Z=Z='(d!Z=Z=Z='Z!Z=Z=Z=2]g!Z=Z=Z=5, F!Z=Z=Z=hI<&#!Z=Z=Z=<b!Z=Z=Z=7]>!Z=Z=Z=; t!Z=Z=Z=; v!Z=Z=Z=8p!Z=Z=Z=@8 C!Z=Z=Z=9JAZ=Z=Z=:vm'Z=Z=Z=xhp &/m Z=Z=Z=;-AZ=Z=Z=OdrAZ=Z=Z= E#NAZ=Z=Z=PixZ=Z=Z= ">Z=Z=Z=MZ=Z=Z=    ( PB"Z=Z=Z= sU9AZ=Z=Z=~AZ=Z=Z=:RjAZ=Z=Z=]*AZ=Z=Z= wOAZ=Z=Z=`Y AZ=Z=Z=lPAZ=Z=Z= AZ=Z=Z=([5AZ=Z=Z=)6$v Z=Z=Z=08*ƾmZ=Z=Z=+b*iEQU3P ^D7H99t2\}.)*gCL/^d !{@s[]$)cA|F4#Q zP%i; Di_S05M|8R^?a*2,ACto=/Xիfzcd3IJUKex FQ(=(Bgr]aCzX]BL$gKc+-h36ͮ9V i iSON&XkQ'Z"hNc@k3aW#b[*Z+u@}J$p [&3LH& ... . .. 0z 1z 2z 3z 4z 5z 6z 7z 8z|9z# . ..$ fixit_crunch$ cat$chmod $chroot$ cp$ dd$ df$echo $expr $kill $ ln$ ls$mkdir $ mv$ rm$rmdir $sleep $sync $chown $clri $ disklabel $dmesg $fdisk $mknod $mount $reboot$restore$swapon$umount$ mount_msdos$ mount_cd9660$rrestore $chgrp $ ftp$telnet$ vi$grep $view $ ex%tar- .... .../ ... . .. dev#standz& bin'sbinz( etc- mnt.mnt1z/mnt2z0mnt3z1mnt4z2 tmp3 usr7@.profile z` chmod 444 meteor$unit ;; bktr?) unit=`expr $i : 'bktr\(.*\)'` mknod bktr$unit c 92 `unit2minor $unit` mknod tuner$unit c 92 `unit2minor $((16 + $unit))` mknod vbi$unit c 92 `unit2minor $((32 + $unit))` chmod 444 bktr$unit tuner$unit vbi$unit ;; tun*) ntun=`expr $i : 'tun\(.*\)$'` unit=0 while [ $unit -le $ntun ]; do mknod tun$unit c 52 `unit2minor $unit` unit=$(($unit + 1)) done ;; tap*) ntap=`expr $i : 'tap\(.*\)$'` unit=0 while [ $unit -le $ntap ]; do mknod tap$unit c 149 `unit2minor $unit` root:network unit=$(($unit + 1)) done ;; sysmouse) mknod sysmouse c 12 128 mknod consolectl c 12 255 ;; jogdial) mknod jogdial c 160 0 ;; snp?) unit=`expr $i : 'snp\(.*\)'` mknod snp$unit c 53 `unit2minor $unit` ;; # dufault@hda.com: If I do much more work on other A-D boards # then eventually we'll have a "ad" and "dio" interface and some of these # "labpcaio" ones will be gone. # labpcaio: D-A and A-D. # labpcdio: Digital in and Digital out. # labpc*) umask 7 case $i in labpcaio*) name=labpcaio unit=`expr $i : 'labpcaio\(.*\)'` all="0 1 2 3 4 5 6 7" offset=0 ;; labpcdio*) name=labpcdio unit=`expr $i : 'labpcdio\(.*\)'` all="0 1 2 3" offset=8 ;; *) die 3 "Don't know LabPC type $i" ;; esac if [ -z "${unit}" ]; then unit=all fi case $unit in 0|1|2|3|4|5|6|7) mknod $name$unit c 66 $(($offset + $unit)) ;; all) for i in $all do mknod $name$i c 66 $(($offset + $i)) done ;; *) echo "No such LabPC unit: $unit" ;; esac umask 77 ;; perfmon) mknod perfmon c 2 32 root:kmem chmod 640 perfmon ;; ipl) mknod ipl c 79 0 mknod ipnat c 79 1 mknod ipstate c 79 2 mknod ipauth c 79 3 ;; kbd*) unit=`expr $i : 'kbd\(.*\)'` chr=112 mknod kbd$unit c $chr `unit2minor $unit` ;; i4b) mknod i4b c 60 0 ;; i4bctl) mknod i4bctl c 55 0 ;; i4brbch*) unit=`expr $i : 'i4brbch\(.*\)'` mknod i4brbch$unit c 57 `unit2minor $unit` ;; i4bteld*) offset=64 unit=`expr $i : 'i4bteld\(.*\)'` mknod i4bteld$unit c 56 `unit2minor $(($offset + $unit))` ;; i4btel*) unit=`expr $i : 'i4btel\(.*\)'` mknod i4btel$unit c 56 `unit2minor $unit` ;; i4btrc*) unit=`expr $i : 'i4btrc\(.*\)'` mknod i4btrc$unit c 59 `unit2minor $unit` ;; aac*) unit=`expr $i : 'aac\(.*\)'` mknod aac$unit c 150 `unit2minor $unit` ln -fs aac$unit afa$unit ln -fs aac$unit hpn$unit ;; mlx*) unit=`expr $i : 'mlx\(.*\)'` mknod mlx$unit c 130 `unit2minor $unit` ;; amr*) unit=`expr $i : 'amr\(.*\)'` mknod amr$unit c 132 `unit2minor $unit` ;; ciss*) unit=`expr $i : 'ciss\(.*\)'` mknod ciss$unit c 166 `unit2minor $unit` ;; agpgart) mknod agpgart c 148 0 ;; twe*) unit=`expr $i : 'twe\(.*\)'` mknod twe$unit c 146 `unit2minor $unit` ;; tw*) unit=`expr $i : 'tw\(.*\)'` mknod tw$unit c 19 `unit2minor $unit` root:operator ;; cfs*) unit=`expr $i : 'cfs\(.*\)'` mknod cfs$unit c 93 $unit root:operator ;; nsmb*) unit=`expr $i : 'nsmb\(.*\)'` mknod nsmb$unit c 144 $unit ;; local) umask 0 # XXX should be elsewhere sh MAKEDEV.local umask 77 ;; *) echo $i - no such device name ;; esac done #!/bin/sh - # # Copyright (c) 1990 The Regents of the University of California. # All rights reserved. # # Written and contributed by W. Jolitz 12/90 # # Redistribution and use in source and binary forms are permitted provided # that: (1) source distributions retain this entire copyright notice and # comment, and (2) distributions including binaries display the following # acknowledgement: ``This product includes software developed by the # University of California, Berkeley and its contributors'' in the # documentation or other materials provided with the distribution and in # all advertising materials mentioning features or use of this software. # Neither the name of the University nor the names of its contributors may # be used to endorse or promote products derived from this software without # specific prior written permission. # THIS SOFTWARE IS PROVIDED ``AS IS'' AND WITHOUT ANY EXPRESS OR IMPLIED # WARRANTIES, INCLUDING, WITHOUT LIMITATION, THE IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. # # @(#)MAKEDEV 5.2 (Berkeley) 6/22/90 # $FreeBSD: src/etc/MAKEDEV,v 1.243.2.47 2002/04/21 19:47:06 will Exp $ # # Device "make" file. Valid arguments: # all makes all known devices, standard number of units (or close) # std standard devices # jail suitable for a jail(8) # local configuration specific devices # mach-4 mach4&lites+devices for Mach's XFree86 distribution # (see http://www.cs.hut.fi/lites.html for more info on LITES) # # Tapes: # wt* QIC-interfaced (e.g. not SCSI) 3M cartridge tape # sa* SCSI Sequential Access Devices # # Disks: # aac* Adaptec FSA RAID controllers # aacd* Adaptec FSA RAID # acd* ATAPI CD-ROM disks # amrd* AMI MegaRAID # cd* SCSI CD-ROM disks # da* SCSI Direct Access Devices # fd* floppy disk drives (3 1/2", 5 1/4") # fla* M-Systems DiskOnChip # idad* Compaq Smart-2 RAID arrays # matcd* Matsushita (Panasonic) CD-ROM disks # mcd* Mitsumi CD-ROM disks # md* Memory (or malloc) disk # mlx* Mylex DAC960 RAID controllers # mlxd* Mylex DAC960 RAID disk volumes # scd* Sony CD-ROM disks # vn* vnode disks # wd* "Winchester" disk drives (ST506,IDE,ESDI,RLL,...) # wfd* IDE floppy disk drives (LS-120) # # Console ports: # vty* virtual console devices for syscons/pcvt/codrv # # Pointing devices: # mse* Logitech and ATI Inport bus mouse # psm* PS/2 mouse # jogdial Sony VAIO Jogdial # sysmouse Mousesystems mouse emulator for syscons # # Time devices: # refclock-* serial ports used by xntpd parse refclocks # # Terminal ports: # tty* general purpose serial ports # cua* dialout serial ports # ttyA* Specialix SI/XIO dialin ports ('*' = number of devices) # cuaA* Specialix SI/XIO dialout ports # ttyD* Digiboard - 16 dialin ports # cuaD* Digiboard - 16 dialout ports # ttyE* Stallion EasyIO (stl) dialin ports # cuaE* Stallion EasyIO (stl) dialout ports # ttyF* Stallion Brumby (stli) dialin ports # cuaF* Stallion Brumby (stli) dialout ports # ttyR* Rocketport dialin ports # cuaR* Rocketport dialout ports # # stlN Stallion EasyIO board N dialin and dialout # stliN Stallion Brumby board N dialin and dialout # # Pseudo terminals: # pty* set of 32 master and slave pseudo terminals # vty* virtual terminals using syscons/pcvt/codrv console # # Parallel port: # lpt* Printer # ppi* Parallel port i/o # pps* Pulse per second timing interface # pcfclock* Parallel time sync interface # # I2C and SMBus: # iic* I2C devices # smb* SMBUS devices # # USB devices: # usb* USB bus control device # ugen* generic USB device # uhid* Human Interface Device (HID) # ulpt* printer # umodem* modems # ums* mouse # urio* Diamond Rio 500 # uscanner* USB scanners # usio* USB serial devices # # SCSI devices (other than CD-ROM, tape and disk): # ch* SCSI Media-Changer (juke box) driver # pt* Processor Type (HP scanner, as one example) # pass* CAM Passthrough device # ses* SES (SCSI Environmental Services) and # SAF-TE (Scsi Accessable Fault-Tolerant Enclosures) device # # PC-CARD (previously called PCMCIA) support # card* PC-CARD slots # # ISDN devices: # i4b isdnd call control device # i4bctl debugging control device # i4btrc* trace data interface(s), one per passive card # i4btel* telephony interface(s) # i4bteld* telephony dialout interface(s) # i4brbch* raw b channel access device(s) # # Special purpose devices: # apm Advanced Power Management BIOS # apmctl APM BIOS control device # bpf* packet filter # speaker pc speaker # tw* xten power controller # snd* various sound cards # pcaudio PCM audio driver # socksys iBCS2 socket system driver # vat VAT compatibility audio driver (requires snd*) # gsc Genius GS-4500 hand scanner # joy pc joystick # tun* Tunneling IP device # tap* Ethernet Tunneling device # snp* tty snoop devices # spigot Video Spigot video acquisition card # ctx* Cortex-I video acquisition card # meteor* Matrox Meteor video acquisition card (pci) # bktr* Bt848 based video acquisition card (pci) # labpc* National Instrument's Lab-PC and LAB-PC+ # perfmon CPU performance-monitoring counters # pci PCI configuration-space access from user mode # ipl ipfilter control devices (ipl, ipnat, ipstate, ipauth) # kbd keyboard devices # agpgart AGP interface # cfs* Coda Distributed Filesystem # nsmb* SMB/CIFS protocol interface # if [ -n "$MAKEDEVPATH" ]; then PATH="$MAKEDEVPATH" else PATH=/sbin:/bin fi umask 77 # Usage: die exitcode msg die() { echo $2 exit $1 } # Convert integer to partition name dkitop() { local p case $1 in 0) p=a;; 1) p=b;; 2) p=c;; 3) p=d;; 4) p=e;; 5) p=f;; 6) p=g;; 7) p=h;; *) p="?";; esac echo $p } # Convert integer to slice name dkitos() { local s case $1 in 0) s="";; 1) s="";; *) s=s$(($1-1));; esac echo $s } # Convert disk (type, unit, slice, partition) to minor number dkminor() { echo $(($1 << 25 | ($2 / 32) << 21 | ($2 % 32) << 3 | $3 << 16 | $4)) } # Override mknod(2) to add extra handling to it. mknod=/sbin/mknod for i in `IFS=':'; echo $PATH`; do if [ -x "${i}/mknod" ]; then mknod="${i}/mknod" break fi done mknod() { rm -f "$1" || exit 1 case $# in 4) "$mknod" "$@" root:wheel || die 2 "$mknod $@ failed";; 5) "$mknod" "$@" || die 2 "$mknod $@ failed";; *) die 2 "bad node: mknod $@";; esac } # Convert tape (ctrl, unit, mode, access) to minor number saminor() { echo $(($1 << 29 | ($2 / 16) << 16 | ($2 % 16) << 4 | $3 << 2 | $4)) } # Convert the last character of a tty name to a minor number. ttyminor() { case $1 in [0-9]) m=$1;; a) m=10;; b) m=11;; c) m=12;; d) m=13;; e) m=14;; f) m=15;; g) m=16;; h) m=17;; i) m=18;; j) m=19;; k) m=20;; l) m=21;; m) m=22;; n) m=23;; o) m=24;; p) m=25;; q) m=26;; r) m=27;; s) m=28;; t) m=29;; u) m=30;; v) m=31;; *) m="?";; esac echo $m } # Convert a unit number to a minor number. unit2minor() { echo $(((($1 >> 8) << 16) | ($1 % 256))) } # For the stallion devices tty[EF] # stallion major letter card iscallout stallion () { major=$1 letter=$2 card=$3 iscallout=$4 port=0 maxport=8 pref=tty owner= minorbase=0 if [ $iscallout -gt 0 ]; then pref=cua owner=uucp:dialer minorbase=128 fi case "$card" in [0-7]);; *) die 1 "Invalid stl card number $card";; esac # make the mem interface for extracting stats & loading microcode. # 0x1000000 + card number mknod staliomem$card c $major 0x0100000$card while [ $port -lt $maxport ]; do minor=$(($minorbase + $card * 1048576 + $port)) if [ $port -ge 32 ]; then minor=$(($minor + 65504)) fi unit=$(($card * 64 + $port)) mknod ${pref}${letter}$unit c $major $minor $owner mknod ${pref}i${letter}$unit c $major $(($minor + 32)) $owner mknod ${pref}l${letter}$unit c $major $(($minor + 64)) $owner port=$(($port + 1)) done } # Raw partition for disks dkrawpart=2 # Compatibility slice for disks dkcompatslice=0 # Raw slice for disks dkrawslice=1 # Standard umasks disk_umask=037 # allow group operator to read disks tape_umask=017 # allow group operator to read/write tapes for i in $*; do case $i in all) sh MAKEDEV std # standard sh MAKEDEV fd0 fd1 # bdev, floppy disk sh MAKEDEV da0 da1 da2 da3 # bdev, SCSI disk sh MAKEDEV ata # cdev, ATA control sh MAKEDEV ad0 ad1 ad2 ad3 # bdev, ATA disk sh MAKEDEV ar0 ar1 # bdev, ATA RAID disk sh MAKEDEV acd0 afd0 ast0 # bdev, ATAPI devices sh MAKEDEV wd0 wd1 wd2 wd3 # bdev, OLD disk sh MAKEDEV wcd0 wfd0 wst0 # bdev, OLD ATAPI devs sh MAKEDEV vn0 # bdev, virtual disk sh MAKEDEV cd0 matcd0 mcd0 scd0 # bdev, cdrom sh MAKEDEV sa0 wt0 # bdev, tape sh MAKEDEV vty12 # cdev, virtual tty sh MAKEDEV cuaa0 cuaa1 cuaa2 cuaa3 # cdev, serial tty sh MAKEDEV pty0 # cdev, pseudo tty sh MAKEDEV ttyd0 ttyd1 ttyd2 ttyd3 # cdev, serial tty sh MAKEDEV zs0 # big-Alpha serial tty sh MAKEDEV kbd0 kbd1 # cdev, keyboard sh MAKEDEV mse0 psm0 jogdial sysmouse # cdev, mouse sh MAKEDEV pcaudio speaker snd0 # cdev, noise sh MAKEDEV lpt0 lpt1 lpt2 # cdev, printer sh MAKEDEV ppi0 ppi1 ppi2 # cdev, parallel port sh MAKEDEV iic0 iic1 # cdev, I2C device sh MAKEDEV smb0 smb1 # cdev, SMBus device sh MAKEDEV usb usb0 uhid0 ums0 ulpt0 ugen0 # cdev, USB devices sh MAKEDEV urio0 uscanner0 umodem0 # cdev, USB devices too sh MAKEDEV bpf0 bpf1 bpf2 bpf3 # cdev, network sh MAKEDEV ipl tun0 tun1 tun2 tun3 # cdev, network sh MAKEDEV tap0 tap1 tap2 tap3 # cdev, network sh MAKEDEV ch0 perfmon tw0 # cdev, miscellaneous sh MAKEDEV apm apmctl card0 card1 card2 card3 # cdev, laptop sh MAKEDEV pass4 xpt2 # cdev, CAM sh MAKEDEV i4b i4bctl i4btrc0 i4btrc1 # cdev, ISDN sh MAKEDEV i4btel0 i4btel1 i4bteld0 i4bteld1 # cdev, ISDN sh MAKEDEV i4brbch0 i4brbch1 # cdev, ISDN sh MAKEDEV agpgart # cdev, AGP sh MAKEDEV nsmb0 # cdev, SMB/CIFS ;; # a much restricted set of the above, to save precious i-nodes on the # fixit floppy fixit) sh MAKEDEV std # standard sh MAKEDEV fd0 # bdev, floppy disk sh MAKEDEV da0 # bdev, SCSI disk sh MAKEDEV ad0 # bdev, ATA disk sh MAKEDEV acd0 afd0 ast0 # bdev, ATAPI devices sh MAKEDEV wd0 # bdev, OLD disk sh MAKEDEV wcd0 wfd0 wst0 # bdev, OLD ATAPI devs sh MAKEDEV vn0 # bdev, virtual disk sh MAKEDEV cd0 # bdev, cdrom sh MAKEDEV sa0 # bdev, tape sh MAKEDEV vty2 # cdev, virtual tty sh MAKEDEV cuaa0 # cdev, serial tty sh MAKEDEV pty0 # cdev, pseudo tty sh MAKEDEV ttyd0 # cdev, serial tty sh MAKEDEV zs0 # big-Alpha serial tty sh MAKEDEV kbd0 # cdev, keyboard sh MAKEDEV mse0 psm0 sysmouse # cdev, mouse sh MAKEDEV lpt0 # cdev, printer sh MAKEDEV ppi0 # cdev, parallel port sh MAKEDEV iic0 # cdev, I2C device sh MAKEDEV smb0 # cdev, SMBus device sh MAKEDEV ums0 # cdev, USB devices sh MAKEDEV tun0 # cdev, network sh MAKEDEV tap0 # cdev, network sh MAKEDEV ch0 # cdev, miscellaneous sh MAKEDEV apm apmctl card0 # cdev, laptop sh MAKEDEV pass1 xpt1 # cdev, CAM sh MAKEDEV i4b i4bctl i4btrc0 i4btrc1 # cdev, ISDN sh MAKEDEV i4btel0 i4bteld0 # cdev, ISDN sh MAKEDEV i4brbch0 # cdev, ISDN rm -f fd/[1-9]? ;; std) mknod console c 0 0; chmod 600 console mknod kmem c 2 1 root:kmem; chmod 640 kmem mknod mem c 2 0 root:kmem; chmod 640 mem mknod null c 2 2; chmod 666 null mknod random c 2 3; chmod 644 random mknod urandom c 2 4; chmod 644 urandom mknod zero c 2 12; chmod 666 zero mknod io c 2 14; chmod 600 io mknod tty c 1 0; chmod 666 tty mknod klog c 7 0; chmod 600 klog mknod stdin c 22 0; chmod 666 stdin mknod stdout c 22 1; chmod 666 stdout mknod stderr c 22 2; chmod 666 stderr mknod pci c 78 0; chmod 644 pci mkdir -p fd (cd fd && i=0 && while [ $i -lt 64 ]; do mknod $i c 22 $i i=$(($i + 1)) done ) chmod 555 fd chmod 666 fd/* ;; jail) sh MAKEDEV std pty0 rm mem kmem pci io klog console # for security ln -sf null mem # for libkvm (ab)users ln -sf null kmem # --//-- ln -sf null console ;; mach-4) mknod iopl c 22 0 mknod kbd c 23 0 mknod mouse c 24 0 mknod time c 25 0 mknod timezone c 26 0 ;; # Create device files for new Archive/Wangtek QIC-02 tape driver (vak) wt*) umask $tape_umask u=`expr $i : '..\(.*\)'` if [ -z "${u}" ]; then u=0; fi # default density, 512b blocks mknod rwt${u} c 10 $(( 0 + $u)) root:operator mknod nrwt${u} c 10 $(( 4 + $u)) root:operator # default density, 1024b blocks # mknod rWt${u} c 10 $((64 + $u)) root:operator # mknod nrWt${u} c 10 $((68 + $u)) root:operator mknod rwt${u}b c 10 $((16 + $u)) root:operator # 60 megabytes mknod nrwt${u}b c 10 $((20 + $u)) root:operator mknod rwt${u}c c 10 $((24 + $u)) root:operator # 120 megabytes mknod nrwt${u}c c 10 $((28 + $u)) root:operator mknod rwt${u}d c 10 $((32 + $u)) root:operator # 150 megabytes mknod nrwt${u}d c 10 $((36 + $u)) root:operator # mknod rwt${u}e c 10 $((40 + $u)) root:operator # 300 megabytes? # mknod nrwt${u}e c 10 $((44 + $u)) root:operator # mknod rwt${u}f c 10 $((48 + $u)) root:operator # 600 megabytes? # mknod nrwt${u}f c 10 $((52 + $u)) root:operator umask 77 ;; # Individual slices. aacd*s*|ad*s*|ar*s*|afd*s*|amrd*s*|da*s*|fla*s*|idad*s*|md*s*|mlxd*s*|twed*s*|vn*s*|wd*s*|wfd*s*) umask $disk_umask case $i in aacd*s*) name=aacd; chr=151;; ad*s*) name=ad; chr=116;; ar*s*) name=ar; chr=157;; afd*s*) name=afd; chr=118;; amrd*s*) name=amrd; chr=133;; da*s*) name=da; chr=13;; fla*s*) name=fla; chr=102;; idad*s*) name=idad; chr=109;; md*s*) name=md; chr=95;; mlxd*s*) name=mlxd; chr=131;; twed*s*) name=twed; chr=147;; vn*s*) name=vn; chr=43;; wd*s*) name=wd; chr=3;; wfd*s*) name=wfd; chr=87;; esac case $i in aacd*s*|amrd*s*|idad*s*|mlxd*s*|twed*s*) unit=`expr $i : '....\([0-9]*\)s'` slice=`expr $i : '....[0-9]*s\([0-9]*\)'` part=`expr $i : '....[0-9]*s[0-9]*\(.*\)'` ;; afd*s*|fla*s*|wfd*s*) unit=`expr $i : '...\([0-9]*\)s'` slice=`expr $i : '...[0-9]*s\([0-9]*\)'` part=`expr $i : '...[0-9]*s[0-9]*\(.*\)'` ;; *) unit=`expr $i : '..\([0-9]*\)s'` slice=`expr $i : '..[0-9]*s\([0-9]*\)'` part=`expr $i : '..[0-9]*s[0-9]*\(.*\)'` ;; esac case $unit in [0-9]|[0-9][0-9]|[0-4][0-9][0-9]|50[0-9]|51[0-1]) case $slice in [0-9]|[1-2][0-9]|30) oldslice=$slice slice=$(($slice+1)) slicename=`dkitos $slice` minor=`dkminor 0 $unit $slice $dkrawpart` mknod $name$unit$slicename c $chr $minor root:operator ln -f $name$unit$slicename r$name$unit$slicename case $part in [a-h]) case $oldslice in 0) slice=$oldslice ;; esac for part in 0 1 2 3 4 5 6 7 do minor=`dkminor 0 $unit $slice $part` partname=`dkitop $part` mknod $name$unit$slicename$partname \ c $chr $minor root:operator ln -f $name$unit$slicename$partname \ r$name$unit$slicename$partname done ;; "") ;; *) echo bad partition for disk in: $i ;; esac ;; *) echo bad slice for disk in: $i ;; esac ;; *) echo bad unit for disk in: $i "(unit=$unit, slice=$slice, part=$part)" ;; esac umask 77 ;; fd*) umask $disk_umask unit=`expr $i : '..\(.*\)'` name=fd; chr=9 case $unit in 0|1|2|3) mknod ${name}${unit} c $chr $(($unit * 64)) root:operator ln -f ${name}${unit} r${name}${unit} # Fake BSD partitions for i in a b c d e f g h do ln -f ${name}${unit} ${name}${unit}$i ln -f r${name}${unit} r${name}${unit}$i done # User-readable and programmer-readable name sets mknod ${name}${unit}.1720 c $chr $(($unit * 64 + 1)) \ root:operator ln -f ${name}${unit}.1720 r${name}${unit}.1720 # ln -f ${name}${unit}.1720 ${name}${unit}135hs21 # ln -f r${name}${unit}.1720 r${name}${unit}135hs21 mknod ${name}${unit}.1480 c $chr $(($unit * 64 + 2)) \ root:operator ln -f ${name}${unit}.1480 r${name}${unit}.1480 # ln -f ${name}${unit}.1480 ${name}${unit}135hs18 # ln -f r${name}${unit}.1480 r${name}${unit}135hs18 # ln -f ${name}${unit}.1480 ${name}${unit}96hs18 # ln -f r${name}${unit}.1480 r${name}${unit}96hs18 mknod ${name}${unit}.1440 c $chr $(($unit * 64 + 3)) \ root:operator ln -f ${name}${unit}.1440 r${name}${unit}.1440 # ln -f ${name}${unit}.1440 ${name}${unit}135 # ln -f r${name}${unit}.1440 r${name}${unit}135 # ln -f ${name}${unit}.1440 ${name}${unit}135ds18 # ln -f r${name}${unit}.1440 r${name}${unit}135ds18 # ln -f ${name}${unit}.1440 ${name}${unit}96ds18 # ln -f r${name}${unit}.1440 r${name}${unit}96ds18 mknod ${name}${unit}.1200 c $chr $(($unit * 64 + 4)) \ root:operator ln -f ${name}${unit}.1200 r${name}${unit}.1200 # ln -f ${name}${unit}.1200 ${name}${unit}96 # ln -f r${name}${unit}.1200 r${name}${unit}96 # ln -f ${name}${unit}.1200 ${name}${unit}96ds15 # ln -f r${name}${unit}.1200 r${name}${unit}96ds15 # ln -f ${name}${unit}.1200 ${name}${unit}135ds15 # ln -f r${name}${unit}.1200 r${name}${unit}135ds15 mknod ${name}${unit}.820 c $chr $(($unit * 64 + 5)) \ root:operator ln -f ${name}${unit}.820 r${name}${unit}.820 # ln -f ${name}${unit}.820 ${name}${unit}96hs10 # ln -f r${name}${unit}.820 r${name}${unit}96hs10 # ln -f ${name}${unit}.820 ${name}${unit}135hs10 # ln -f r${name}${unit}.820 r${name}${unit}135hs10 mknod ${name}${unit}.800 c $chr $(($unit * 64 + 6)) \ root:operator ln -f ${name}${unit}.800 r${name}${unit}.800 # ln -f ${name}${unit}.800 ${name}${unit}96ds10 # ln -f r${name}${unit}.800 r${name}${unit}96ds10 # ln -f ${name}${unit}.800 ${name}${unit}135ds10 # ln -f r${name}${unit}.800 r${name}${unit}135ds10 mknod ${name}${unit}.720 c $chr $(($unit * 64 + 7)) \ root:operator ln -f ${name}${unit}.720 r${name}${unit}.720 # ln -f ${name}${unit}.720 ${name}${unit}96ds9 # ln -f r${name}${unit}.720 r${name}${unit}96ds9 # ln -f ${name}${unit}.720 ${name}${unit}135ds9 # ln -f r${name}${unit}.720 r${name}${unit}135ds9 mknod ${name}${unit}.360 c $chr $(($unit * 64 + 8)) \ root:operator ln -f ${name}${unit}.360 r${name}${unit}.360 # ln -f ${name}${unit}.360 ${name}${unit}48 # ln -f r${name}${unit}.360 r${name}${unit}48 # ln -f ${name}${unit}.360 ${name}${unit}48ds9 # ln -f r${name}${unit}.360 r${name}${unit}48ds9 mknod ${name}${unit}.640 c $chr $(($unit * 64 + 9)) \ root:operator ln -f ${name}${unit}.640 r${name}${unit}.640 # ln -f ${name}${unit}.640 ${name}${unit}96ds8 # ln -f r${name}${unit}.640 r${name}${unit}96ds8 # ln -f ${name}${unit}.640 ${name}${unit}135ds8 # ln -f r${name}${unit}.640 r${name}${unit}135ds8 mknod ${name}${unit}.1232 c $chr $(($unit * 64 + 10)) \ root:operator ln -f ${name}${unit}.1232 r${name}${unit}.1232 # ln -f ${name}${unit}.1232 ${name}${unit}96ds8 # ln -f r${name}${unit}.1232 r${name}${unit}96ds8 # ln -f ${name}${unit}.1232 ${name}${unit}135ds8 # ln -f r${name}${unit}.1232 r${name}${unit}135ds8 ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; aacd*|ad*|ar*|afd*|amrd*|da*|fla*|idad*|md*|mlxd*|twed*|vn*|wd*|wfd*) umask $disk_umask case $i in aacd*) name=aacd; chr=151;; ad*) name=ad; chr=116;; ar*) name=ar; chr=157;; afd*) name=afd; chr=118;; amrd*) name=amrd; chr=133;; da*) name=da; chr=13;; fla*) name=fla; chr=102;; idad*) name=idad; chr=109;; md*) name=md; chr=95;; mlxd*) name=mlxd; chr=131;; twed*) name=twed; chr=147;; vn*) name=vn; chr=43;; wd*) name=wd; chr=3;; wfd*) name=wfd; chr=87;; esac case $i in aacd*|amrd*|idad*|mlxd*|twed*) unit=`expr $i : '....\(.*\)'` ;; afd*|fla*|wfd*) unit=`expr $i : '...\(.*\)'` ;; *) unit=`expr $i : '..\(.*\)'` ;; esac case $unit in [0-9]|[0-9][0-9]|[0-4][0-9][0-9]|50[0-9]|51[0-1]) for slicepartname in s0h s1h s2 s3 s4 do sh MAKEDEV $name$unit$slicepartname done ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; ccd*) umask $disk_umask name=ccd chr=74 unit=`expr $i : '...\(.*\)'` case $unit in [0-9]|[0-9][0-9]|[0-4][0-9][0-9]|50[0-9]|51[0-1]) for part in 0 1 2 3 4 5 6 7 do minor=`dkminor 0 $unit 0 $part` partname=`dkitop $part` mknod $name$unit$partname c $chr $minor root:operator ln -f $name$unit$partname r$name$unit$partname done ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; # SCSI processor type driver pt[0-9]*) chr=61 name=pt unit=`expr $i : 'pt\([0-9][0-9]*\)'` if [ -z "${unit}" ]; then unit=0 fi unit=$(($unit + 1 - 1)) mknod ${name}${unit} c $chr `unit2minor $unit` ;; # SCSI SES/SAF-TE type driver ses[0-9]*) chr=110 name=ses unit=`expr $i : 'ses\([0-9][0-9]*\)'` if [ -z "${unit}" ]; then unit=0 fi unit=$(($unit + 1 - 1)) mknod ${name}${unit} c $chr `unit2minor $unit` ;; # SCSI target mode sample driver targ[0-9]*) chr=65 name=targ unit=`expr $i : 'targ\([0-9][0-9]*\)'` if [ -z "${unit}" ]; then unit=0 fi unit=$(($unit + 1 - 1)) mknod ${name}${unit} c $chr `unit2minor $unit` mknod ${name}.ctl c $chr 0xffff00ff ;; # CAM transport layer device xpt*) # This major number is temporary chr=104 name=xpt units=`expr $i : 'xpt\(.*\)'` if [ -z "${units}" ]; then units=1 fi i=0 while [ $i -lt $units ]; do dname=$name$i rm -rf $dname r$dname mknod $dname c $chr `unit2minor $i` root:operator i=$(($i + 1)) done ;; # CAM passthrough device pass*) # This major number is temporary chr=31 name=pass units=`expr $i : 'pass\(.*\)'` if [ -z "${units}" ]; then units=1 fi i=0 while [ $i -lt $units ]; do dname=$name$i rm -rf $dname r$dname mknod $dname c $chr `unit2minor $i` root:operator i=$(($i + 1)) done ;; pty*) class=`expr $i : 'pty\(.*\)'` case $class in 0) offset=0 name=p;; 1) offset=32 name=q;; 2) offset=64 name=r;; 3) offset=96 name=s;; # Note that xterm (at least) only look at p-s. 4) offset=128 name=P;; 5) offset=160 name=Q;; 6) offset=192 name=R;; 7) offset=224 name=S;; # This still leaves [tuTU]. *) echo bad unit for pty in: $i;; esac umask 0 case $class in 0|1|2|3|4|5|6|7) i=0 while [ $i -lt 32 ]; do # This was an awk substr() before. c=$(echo 0123456789abcdefghijklmnopqrstuv | dd bs=1 skip=$i count=1 2>/dev/null) mknod tty$name$c c 5 $(($offset + $i)) mknod pty$name$c c 6 $(($offset + $i)) i=$(($i + 1)) done ;; esac umask 77 ;; sa*) umask $tape_umask unit=`expr $i : '..\(.*\)'` chr=14 case $unit in [0-9]|[1-9][0-9]|[1-9][0-9][0-9]|[1-9][0-9][0-9][0-9]) mknod sa${unit}.ctl c $chr `saminor 1 ${unit} 0 0` ln -f sa${unit}.ctl rsa${unit}.ctl for m in 0 1 2 3 do mknod sa${unit}.${m} c $chr \ `saminor 0 ${unit} ${m} 0` root:operator ln -f sa${unit}.${m} rsa${unit}.${m} mknod nsa${unit}.${m} c $chr \ `saminor 0 ${unit} ${m} 1` root:operator ln -f nsa${unit}.${m} nrsa${unit}.${m} mknod esa${unit}.${m} c $chr \ `saminor 0 ${unit} ${m} 2` root:operator ln -f esa${unit}.${m} ersa${unit}.${m} done ln -f sa${unit}.0 sa${unit} ln -f sa${unit}.0 rsa${unit}.0 ln -f sa${unit}.0 rsa${unit} ln -f nsa${unit}.0 nsa${unit} ln -f nsa${unit}.0 nrsa${unit}.0 ln -f nsa${unit}.0 nrsa${unit} ln -f esa${unit}.0 esa${unit} ln -f esa${unit}.0 ersa${unit}.0 ln -f esa${unit}.0 ersa${unit} ;; *) echo bad unit for tape in: $i ;; esac umask 77 ;; ch*) umask 37 unit=`expr $i : '..\(.*\)'` case $i in ch*) name=ch; chr=17;; esac case $unit in 0|1|2|3|4|5|6) mknod ${name}${unit} c $chr $unit root:operator ;; *) echo bad unit for media changer in: $i ;; esac umask 77 ;; ata) mknod ata c 159 0 root:operator ;; ast*) umask 2 ; unit=`expr $i : '...\(.*\)'` chr=119 case $unit in 0|1|2|3) mknod ast${unit} c $chr $(($unit * 8 + 0)) root:operator chmod 640 ast${unit} mknod nast${unit} c $chr $(($unit * 8 + 1)) root:operator chmod 640 nast${unit} ;; *) echo bad unit for tape in: $i ;; esac umask 77 ;; acd*t*) umask $disk_umask units=`expr $i : '...\(.*\)t'`; tracks=`expr $i : '.*t\(.*\)'`; name=acd; chr=117; if [ -z "${units}" -o "${units}" -le 0 ]; then units=1 fi if [ -z "${tracks}" -o "${tracks}" -le 0 ]; then tracks=100 fi if [ "${units}" -le 31 -a "${tracks}" -le 169 ]; then i=0 while [ $i -le $units ]; do dname=$name$i rm -rf ${dname}t* j=1 while [ $j -le ${tracks} ]; do mknod ${dname}t$j c $chr \ $((($i * 8) + (65536 * $j))) \ root:operator j=$(($j + 1)) done i=$(($i + 1)) done else echo "$i is invalid -- can't have more than 32 cd devices or 169 tracks" fi umask 77 ;; acd*|cd*|mcd*|scd*) umask $disk_umask case $i in acd*) units=`expr $i : '...\(.*\)'`; name=acd; chr=117;; cd*) units=`expr $i : '..\(.*\)'`; name=cd; chr=15;; mcd*) units=`expr $i : '...\(.*\)'`; name=mcd; chr=29;; scd*) units=`expr $i : '...\(.*\)'`; name=scd; chr=45;; esac if [ -z "${units}" -o "${units}" -le 0 ]; then units=1 fi if [ "${units}" -le 31 ]; then i=0 while [ $i -le $units ]; do dname=$name$i rm -rf ${dname}* r${dname}* mknod ${dname}a c $chr $(($i * 8)) root:operator case $name in acd) ln -f ${dname}a ${dname}c;; *) mknod ${dname}c c $chr $(($i * 8 + 2)) root:operator;; esac ln -f ${dname}a r${dname}a ln -f ${dname}c r${dname}c i=$(($i + 1)) done else echo "$i is invalid -- can't have more than 32 cd devices" fi umask 77 ;; matcd*) umask 2 case $i in matcd*) unit=`expr $i : '.....\(.*\)'`; name=matcd; chr=46;; esac case $unit in 0|1|2|3|4|5|6|7|8|9|10|11|12|13|14|15) mknod ${name}${unit}a c $chr $(($unit * 8 + 0)) \ root:operator mknod ${name}${unit}c c $chr $(($unit * 8 + 2)) \ root:operator ln -f ${name}${unit}a r${name}${unit}a ln -f ${name}${unit}c r${name}${unit}c chmod 640 ${name}${unit}[a-h] r${name}${unit}[a-h] mknod ${name}${unit}la c $chr $(($unit * 8 + 128)) \ root:operator mknod ${name}${unit}lc c $chr $(($unit * 8 + 130)) \ root:operator ln -f ${name}${unit}la r${name}${unit}la ln -f ${name}${unit}lc r${name}${unit}lc chmod 640 ${name}${unit}l[a-h] r${name}${unit}l[a-h] ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; wcd*) umask 2 ; unit=`expr $i : '...\(.*\)'` chr=69 case $unit in 0|1|2|3|4|5|6|7) mknod wcd${unit}a c $chr $(($unit * 8 + 0)) root:operator mknod wcd${unit}c c $chr $(($unit * 8 + 2)) root:operator ln -f wcd${unit}a rwcd${unit}a ln -f wcd${unit}c rwcd${unit}c chmod 640 wcd${unit}[a-h] rwcd${unit}[a-h] ;; *) echo bad unit for disk in: $i ;; esac umask 77 ;; wst*) umask 2 ; unit=`expr $i : '...\(.*\)'` chr=90 case $unit in 0|1|2|3) mknod rwst${unit} c $chr $(($unit * 8 + 0)) root:operator chmod 640 rwst${unit} ;; esac umask 77 ;; iic*) unit=`expr $i : 'iic\(.*\)'` mknod iic$unit c 105 `unit2minor $unit` ;; smb*) unit=`expr $i : 'smb\(.*\)'` mknod smb$unit c 106 `unit2minor $unit` ;; pcfclock*) unit=`expr $i : 'pcfclock\(.*\)'` mknod pcfclock$unit c 140 `unit2minor $unit` ;; ppi*) unit=`expr $i : 'ppi\(.*\)'` mknod ppi$unit c 82 `unit2minor $unit` ;; pps*) unit=`expr $i : 'pps\(.*\)'` mknod pps$unit c 89 `unit2minor $unit` ;; usb) mknod usb$unit c 108 255 root:operator chmod 0660 usb$unit ;; usb*) umask 7 unit=`expr $i : 'usb\(.*\)'` mknod usb$unit c 108 `unit2minor $unit` root:operator umask 77 ;; uhid*) umask 7 unit=`expr $i : 'uhid\(.*\)'` mknod uhid$unit c 122 `unit2minor $unit` root:operator umask 77 ;; ums*) umask 7 unit=`expr $i : 'ums\(.*\)'` mknod ums$unit c 111 `unit2minor $unit` root:operator umask 77 ;; ulpt*) unit=`expr $i : 'ulpt\(.*\)'` minor=`unit2minor $unit` mknod ulpt$unit c 113 $minor minor=`unit2minor $(($unit + 64))` mknod unlpt$unit c 113 $minor # and the 'no prime' version ;; ugen*) umask 7 unit=`expr $i : 'ugen\([0-9][0-9]*\)'` endpoint=`expr $i : 'ugen.*\.\([0-9][0-9]*\)'` if [ -z "${unit}" ]; then echo $i - Invalid unit number fi if [ -z "${endpoint}" ]; then # ugen0 & ugen0.1 - ugen0.15 mknod ugen$unit c 114 \ `unit2minor $(($unit * 16))` root:operator i=1 while [ $i -lt 16 ]; do mknod ugen$unit.$i c 114 \ `unit2minor $(($unit * 16 + $i))` root:operator i=$(($i + 1)) done else minor=`unit2minor $(($unit * 16 + $endpoint))` mknod ugen$unit.$endpoint c 114 $minor root:operator fi umask 77 ;; urio*) umask 7 unit=`expr $i : 'urio\(.*\)'` mknod urio$unit c 143 `unit2minor $unit` root:operator umask 77 ;; usio*) umask 7 unit=`expr $i : 'usio\(.*\)'` minor=$(($unit + 128)) minor=`unit2minor $(($unit + 128))` mknod usio$unit c 138 $minor uucp:dialer umask 77 ;; uscanner*) umask 7 unit=`expr $i : 'uscanner\(.*\)'` mknod uscanner$unit c 156 `unit2minor $unit` root:operator umask 77 ;; umodem*) umask 7 unit=`expr $i : 'umodem\(.*\)'` mknod umodem$unit c 124 `unit2minor $unit` uucp:dialer umask 77 ;; lpt*) unit=`expr $i : 'lpt\(.*\)'` mknod lpt$unit c 16 `unit2minor $unit` mknod lpctl$unit c 16 `unit2minor $(($unit + 128))` ;; # Use this to create virtual consoles for syscons, pcvt or codrv # ttyv0-b # use as MAKEDEV vtyNN to create NN entries vty*) chr=12 units=`expr $i : 'vty\(.*\)'` i=0 while [ $i -lt $units ]; do mknod ttyv$(printf %01x $i) c $chr `unit2minor $i` i=$(($i + 1)) done ln -fs ttyv0 vga # XXX X still needs this pccons relic ;; nmdm*) units=`expr $i : 'nmdm\(.*\)'` chr=18 i=0 while [ $i -lt $units ]; do minor=`unit2minor $i` minor=$(($minor + $minor)) mknod nmdm${i}A c $chr $minor mknod nmdm${i}B c $chr $(($minor + 1)) i=$(($i + 1)) done ;; bpf*) nbpf=`expr $i : 'bpf\(.*\)$'` unit=0 while [ $unit -le $nbpf ]; do mknod bpf$unit c 23 `unit2minor $unit` unit=$(($unit + 1)) done ;; speaker) mknod speaker c 26 0 ;; cua?|cuaa?|cuaa??) umask 7 unit_low=`expr $i : 'cua.*\(.\)$'` case $i in cua?|cuaa?) unit_high="" m_high=0 ;; cuaa??) unit_high=`expr $i : 'cuaa\(.\).$'` m_high=`ttyminor $unit_high` ;; esac unit=$unit_high$unit_low m=$(($m_high << 16 | `ttyminor $unit_low`)) mknod cuaa$unit c 28 $(($m | 128)) uucp:dialer mknod cuaia$unit c 28 $(($m | 32 | 128)) uucp:dialer mknod cuala$unit c 28 $(($m | 64 | 128)) uucp:dialer umask 77 ;; tty?|tty0?|ttyd?|ttyd??) unit_low=`expr $i : 'tty.*\(.\)$'` case $i in tty?|tty0?|ttyd?) unit_high="" m_high=0 ;; ttyd??) unit_high=`expr $i : 'ttyd\(.\).$'` m_high=`ttyminor $unit_high` ;; esac unit=$unit_high$unit_low m=$(($m_high << 16 | `ttyminor $unit_low`)) mknod ttyd$unit c 28 $m mknod ttyid$unit c 28 $(($m | 32)) mknod ttyld$unit c 28 $(($m | 64)) ;; cuac?) umask 7 portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q r s t u v" major=48 card=`expr $i : 'cua.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=$(($card * 65536 + $minor)) name=$card$unit mknod cuac$name c $major $(($minor + 128)) uucp:dialer mknod cuaic$name c $major $(($minor + 32 + 128)) uucp:dialer mknod cualc$name c $major $(($minor + 64 + 128)) uucp:dialer done umask 77 ;; ttyc?) portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q r s t u v" major=48 card=`expr $i : 'tty.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=$(($card * 65536 + $minor)) name=$card$unit mknod ttyc$name c $major $minor mknod ttyic$name c $major $(($minor + 32)) mknod ttylc$name c $major $(($minor + 64)) done ;; # RISCom8 'rc' driver entries cuam?) umask 7 unit=`expr $i : 'cua.*\(.\)$'` m=`ttyminor $unit` mknod cuam$unit c 63 $(($m + 128)) uucp:dialer umask 77 ;; ttym?) unit=`expr $i : 'tty.*\(.\)$'` m=`ttyminor $unit` mknod ttym$unit c 63 $m ;; # Specialix SI/XIO. # Note: these are 'base 1' to match the numbers on the panels, and to match # the manual that comes with the system. ttyA*) major=68 nports=`expr $i : 'ttyA\(.*\)$'` port=1 while [ $port -le $nports ]; do minor=$(($port - 1)) name=$(printf %02d $port) mknod ttyA$name c $major $minor mknod ttyiA$name c $major $(($minor + 65536)) mknod ttylA$name c $major $(($minor + 131072)) port=$(($port + 1)) done # For the user-mode control program, 'sicontrol' mknod si_control c 68 262144 ;; cuaA*) umask 7 major=68 nports=`expr $i : 'cuaA\(.*\)$'` port=1 while [ $port -le $nports ]; do minor=$(($port - 1)) name=$(printf %02d $port) mknod cuaA$name c $major $(($minor + 128)) uucp:dialer mknod cuaiA$name c $major $(($minor + 128 + 65536)) \ uucp:dialer mknod cualA$name c $major $(($minor + 128 + 131072)) \ uucp:dialer port=$(($port + 1)) done umask 77 ;; # Alpha AS8[24]00 (TurboLaser) console. zs?) unit=`expr $i : 'zs.*\(.\)$'` m=`ttyminor $unit` mknod zs$unit c 135 $m ;; # Digiboard PC/?? 16 port card. # The current scheme of minor numbering is: # # unused{14} CARD{2} major{8} CALLOUT{1} LOCK{1} INIT{1} PORT{5} # # CARD bitfield in future versions may be extended to 3 bits. # # See dgb(4) # ttyD?) portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" major=58 card=`expr $i : 'tty.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=$(($card * 65536 + $minor)) name=$card$unit mknod ttyD$name c $major $minor mknod ttyiD$name c $major $(($minor + 32)) mknod ttylD$name c $major $(($minor + 64)) done ;; cuaD?) umask 7 portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" major=58 card=`expr $i : 'cua.*\(.\)$'` for unit in $portlist do minor=`ttyminor $unit` minor=$(($card * 65536 + $minor)) name=$card$unit mknod cuaD$name c $major $(($minor + 128)) uucp:dialer mknod cuaiD$name c $major $(($minor + 32 + 128)) uucp:dialer mknod cualD$name c $major $(($minor + 64 + 128)) uucp:dialer done umask 77 ;; # Stallion multi serial cards (stl and stli drivers) # # These drivers reserve 64 minor devices per board, even if the board # supports only 4 devices. We default to creating only 8 of the 64 devices # to keep /dev from getting too large (which => slow). The last part of the # arg is the board number to create ports for. So: # ttyE0 will create 8 dialin ports ttyE0-ttyE7, plus ttyiE* and ttylE* # cuaE0 will create 8 dialout ports cuaE0-cuaE7, plus cuaiE* and cualE* # ttyE1 will create 8 dialin ports ttyE64-ttyE71, plus ttyiE* and ttylE* # etc # If you have EasyConnect 8/32 or 8/64 cards, you will need to change the # definition of "maxport" below to get nodes for the full 32 or 64 # ports per card. # # Note that the mapping of minor device numbers (with the hole between # 32-64k) is a bit odd to keep compatibility with ttyd? for # lock/initial devices. # Minor device field for the ports is # card{3} unused{4} unit-msb{1} unused{8} callout{1} lock{1} init{1} unit-lsbs{5} # for the mem device is # 0x1000000 + card # (For stl, there is only 1 mem device per system; for stli, one per board) ttyE*) stallion 72 E `expr $i : 'tty.*\(.\)$'` 0 ;; cuaE*) stallion 72 E `expr $i : 'cua.*\(.\)$'` 1 ;; stl*) card=`expr $i : 'stl\(.\)$'` stallion 72 E $card 0 stallion 72 E $card 1 ;; ttyF*) stallion 75 F `expr $i : 'tty.*\(.\)$'` 0 ;; cuaF*) stallion 75 F `expr $i : 'cua.*\(.\)$'` 1 ;; stli*) card=`expr $i : 'stl\(.\)$'` stallion 75 F $card 0 stallion 75 F $card 1 ;; ttyM*) portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" modulelist="a b c d" major=101 card=`expr $i : 'tty.*\(.\)$'` for unit in $modulelist do moduleminor=`ttyminor $unit` moduleminor=$(($moduleminor % 10 * 16)) modulename=$unit for unit in $portlist do minor=`ttyminor $unit` minor=$(($card * 65536 + $minor + $moduleminor)) name=$card$modulename$unit rm -f tty*M$name mknod ttyM$name c $major $minor mknod ttyiM$name c $major $(($minor + 64)) mknod ttylM$name c $major $(($minor + 128)) done done ;; cuaM?) umask 7 portlist="0 1 2 3 4 5 6 7 8 9 a b c d e f" modulelist="a b c d" major=101 card=`expr $i : 'cua.*\(.\)$'` for unit in $modulelist do moduleminor=`ttyminor $unit` moduleminor=$(($moduleminor % 10 * 16)) modulename=$unit for unit in $portlist do minor=`ttyminor $unit` minor=$(($card * 65536 + $minor + $moduleminor)) name=$card$modulename$unit rm -f cua*M$name mknod cuaM$name c $major $(($minor + 262144)) \ uucp:dialer mknod cuaiM$name c $major $(($minor + 64 + 262144)) \ uucp:dialer mknod cualM$name c $major $(($minor + 128 + 262144)) \ uucp:dialer done done umask 77 ;; ttyR?) major=81 BOARD=1; Rnum=0 MINOR=$(($BOARD * 65536)) controllers=$( dmesg | while read first rest; do case "$first" in RocketPort[0-4]) echo "$first" ;; esac done ) rm -f ttyR* ttyiR* ttylR* for i in $controllers; do ndevices=$( dmesg | while read first bar ports rest; do case "$first" in $i*) echo "$ports" ;; esac done ) echo -n "Creating $ndevices devices for $i: " dev=0 while [ $dev -lt $ndevices ]; do mknod ttyR$Rnum c $major $MINOR mknod ttyiR$Rnum c $major $(($MINOR + 32)) mknod ttylR$Rnum c $major $(($MINOR + 64)) Rnum=$(($Rnum + 1)) MINOR=$(($MINOR + 1)) dev=$(($dev + 1)) done BOARD=$(($BOARD + 1)) MINOR=$(($BOARD * 65536)) echo " " done ;; cuaR?) major=81 BOARD=1; Rnum=0 MINOR=$(($BOARD * 65536)) controllers=$( dmesg | while read first rest; do case "$first" in RocketPort[0-4]) echo "$first" ;; esac done ) rm -f cuaR* cuaiR* cualR* for i in $controllers; do ndevices=$( dmesg | while read first bar ports rest; do case "$first" in $i*) echo "$ports" ;; esac done ) echo -n "Creating $ndevices devices for $i: " dev=0 while [ $dev -lt $ndevices ]; do mknod cuaR$Rnum c $major $(($MINOR + 128)) uucp:dialer mknod cuaiR$Rnum c $major $(($MINOR + 128 + 32)) \ uucp:dialer mknod cualR$Rnum c $major $(($MINOR + 128 + 64)) \ uucp:dialer Rnum=$(($Rnum + 1)) MINOR=$(($MINOR + 1)) dev=$(($dev + 1)) done BOARD=$(($BOARD + 1)) MINOR=$(($BOARD * 65536)) echo " " done ;; mse*) unit=`expr $i : 'mse\(.*\)'` chr=27 # non-blocking for X11 mknod mse$unit c $chr `unit2minor $(($unit * 2 + 1))` ;; psm*) unit=`expr $i : 'psm\(.*\)'` chr=21 # non-blocking for X11 mknod psm$unit c $chr `unit2minor $(($unit * 2 + 1))` ;; mouse*) name=`expr $i : 'mouse\(.*\)'` if [ ! -c $name ]; then $0 $name # make the appropriate device fi ln -fs $name mouse ;; pcaudio) mknod pcaudio c 24 0 mknod pcaudioctl c 24 128 ;; socksys) mknod socksys c 41 0 mknod spx c 41 1 ln -fs socksys nfsd chmod 666 socksys nfsd spx ;; snd*) # # changes from Linux voxware # minor Linux FreeBSD # 8 sequencer2 (aka music0) music0 # 17 patmgr0 sequencer1 # 33 patmgr1 sequencer2 # unit=`expr $i : 'snd\(.*\)'` chr=30 # XXX write this less verbosely, like std snd_security_hole=0 # XXX umask $snd_security_hole ln -fs mixer$unit mixer ln -fs sequencer$unit sequencer ln -fs dsp$unit dsp ln -fs audio$unit audio ln -fs dspW$unit dspW ln -fs music$unit music ln -fs pss$unit pss ln -fs dsp$unit.0 dsp$unit ln -fs audio$unit.0 audio$unit ln -fs dspW$unit.0 dspW$unit mknod mixer$unit c $chr `unit2minor $(($unit * 16 + 0))` mknod sequencer$unit c $chr `unit2minor $(($unit * 16 + 1))` mknod midi$unit c $chr `unit2minor $(($unit * 16 + 2))` for chn in 0 1 2 3 do minor=$(($chn * 65536 + $unit * 16)) mknod dsp$unit.$chn c $chr $(($minor + 3)) mknod audio$unit.$chn c $chr $(($minor + 4)) mknod dspW$unit.$chn c $chr $(($minor + 5)) done mknod sndstat c $chr 6 # minor number 7 is unused mknod music$unit c $chr `unit2minor $(($unit * 16 + 8))` mknod pss$unit c $chr `unit2minor $(($unit * 16 + 9))` # minor numbers 10-15 are unused umask 77 ;; vat) mknod vatio c 25 128 chmod 660 vatio ;; gsc*) unit=`expr $i : 'gsc\(.*\)'` mknod gsc${unit} c 47 `unit2minor $unit` mknod gsc${unit}p c 47 `unit2minor $(($unit + 8))` mknod gsc${unit}d c 47 `unit2minor $(($unit + 32))` mknod gsc${unit}pd c 47 `unit2minor $(($unit + 40))` chmod 666 gsc${unit}* ;; apm) mknod apm c 39 0 root:operator chmod 664 apm ;; apmctl) mknod apmctl c 39 8 root:operator chmod 660 apmctl ;; card*) unit=`expr $i : 'card\(.*\)'` chr=50 mknod card$unit c $chr `unit2minor $unit` chmod 644 card$unit ;; ttyx?|ttyy?|ttyz?) case $i in *0) unit=0;; *1) unit=1;; *2) unit=2;; *3) unit=3;; *4) unit=4;; *5) unit=5;; *6) unit=6;; *7) unit=7;; *8) unit=8;; *9) unit=9;; *a) unit=10;; *b) unit=11;; *c) unit=12;; *d) unit=13;; *e) unit=14;; *f) unit=15;; esac case $i in ttyy?) unit=$(($unit + 16));; ttyz?) unit=$(($unit + 32));; esac mknod $i c 42 $unit ;; cronyx) mknod cronyx c 42 63 ;; joy) mknod joy0 c 51 0 root:operator mknod joy1 c 51 1 root:operator chmod 640 joy0 joy1 ;; spigot) mknod spigot c 11 0 chmod 444 spigot ;; ctx?) unit=`expr $i : 'ctx\(.*\)'` mknod ctx$unit c 40 `unit2minor $unit` chmod 444 ctx$unit ;; meteor?) unit=`expr $i : 'meteor\(.*\)'` mknod meteor$unit c 67 `unit2minor $unit . ..MAKEDEVconsolekmem6& memnull6& random urandom zero6& io ttyklog6&stdin&stdoutstderr pci fd fd0rfd0 fd0a rfd0a fd0b rfd0b fd0c rfd0c fd0d rfd0d fd0e rfd0e fd0f rfd0f fd0g rfd0g fd0h rfd0h fd0.1720: rfd0.1720 fd0.1480:  rfd0.1480 !fd0.1440:! rfd0.1440 "fd0.1200:" rfd0.1200 #fd0.820#rfd0.820 $fd0.800$rfd0.800 %fd0.720%rfd0.720 &fd0.360&rfd0.360 'fd0.640'rfd0.640 (fd0.1232:( rfd0.1232 ) da0)rda0 *da0a6&*rda0a +da0b6&+rda0b ,da0c6&,rda0c -da0d6&-rda0d .da0e6&.rda0e /da0f6&/rda0f 0da0g6&0rda0g 1da0h6&1rda0h 2da0s1&2rda0s13da0s1a3rda0s1a4da0s1b4rda0s1b5da0s1c5rda0s1c6da0s1d6rda0s1d7da0s1e7rda0s1e8da0s1f8rda0s1f9da0s1g9rda0s1g:da0s1h:rda0s1h;da0s2&;rda0s2<da0s3&<rda0s3=da0s4&=rda0s4> ad0>rad0 ?ad0a6&?rad0a @ad0b6&@rad0b Aad0c6&Arad0c Bad0d6&Brad0d Cad0e6&Crad0e Dad0f6&Drad0f Ead0g6&Erad0g Fad0h6&Frad0h Gad0s1&Grad0s1Had0s1aHrad0s1aIad0s1bIrad0s1bJad0s1cJrad0s1cKad0s1dKrad0s1dLad0s1eLrad0s1eMad0s1fMrad0s1fNad0s1gNrad0s1gOad0s1hOrad0s1hPad0s2&Prad0s2Qad0s3&Qrad0s3Rad0s4&Rrad0s4Sacd0a&Sacd0c Sracd0aSracd0cTacd1a&Tacd1c Tracd1aTracd1cUafd06&Urafd0 Vafd0a&Vrafd0aWafd0b&Wrafd0bXafd0c&Xrafd0cYafd0d&Yrafd0dZafd0e&Zrafd0e[afd0f&[rafd0f\afd0g&\rafd0g]afd0h&]rafd0h^afd0s1^rafd0s1_afd0s1a_rafd0s1a `afd0s1b`rafd0s1b aafd0s1carafd0s1c bafd0s1dbrafd0s1d cafd0s1ecrafd0s1e dafd0s1fdrafd0s1f eafd0s1gerafd0s1g fafd0s1hfrafd0s1h gafd0s2grafd0s2hafd0s3hrafd0s3iafd0s4irafd0s4jast06&knast0&l wd0lrwd0 mwd0a6&mrwd0a nwd0b6&nrwd0b owd0c6&orwd0c pwd0d6&prwd0d qwd0e6&qrwd0e rwd0f6&rrwd0f swd0g6&srwd0g twd0h6&trwd0h uwd0s1&urwd0s1vwd0s1avrwd0s1awwd0s1bwrwd0s1bxwd0s1cxrwd0s1cywd0s1dyrwd0s1dzwd0s1ezrwd0s1e{wd0s1f{rwd0s1f|wd0s1g|rwd0s1g}wd0s1h}rwd0s1h~wd0s2&~rwd0s2wd0s3&rwd0s3wd0s4&rwd0s4wcd0a&wcd0c&rwcd0arwcd0cwfd06&rwfd0 wfd0a&rwfd0awfd0b&rwfd0bwfd0c&rwfd0cwfd0d&rwfd0dwfd0e&rwfd0ewfd0f&rwfd0fwfd0g&rwfd0gwfd0h&rwfd0hwfd0s1rwfd0s1wfd0s1arwfd0s1a wfd0s1brwfd0s1b wfd0s1crwfd0s1c wfd0s1drwfd0s1d wfd0s1erwfd0s1e wfd0s1frwfd0s1f wfd0s1grwfd0s1g wfd0s1hrwfd0s1h wfd0s2rwfd0s2wfd0s3rwfd0s3wfd0s4rwfd0s4rwst0&vn0rvn0 vn0a6&rvn0a vn0b6&rvn0b vn0c6&rvn0c vn0d6&rvn0d vn0e6&rvn0e vn0f6&rvn0f vn0g6&rvn0g vn0h6&rvn0h vn0s1&rvn0s1vn0s1arvn0s1avn0s1brvn0s1bvn0s1crvn0s1cvn0s1drvn0s1dvn0s1ervn0s1evn0s1frvn0s1fvn0s1grvn0s1gvn0s1hrvn0s1hvn0s2&rvn0s2vn0s3&rvn0s3vn0s4&rvn0s4cd0a6&cd0c6&rcd0a rcd0c cd1a6&cd1c6&rcd1a rcd1c sa0.ctlrsa0.ctl sa0.0&rsa0.0nsa0.0nrsa0.0esa0.0ersa0.0sa0.1&rsa0.1nsa0.1nrsa0.1esa0.1ersa0.1 sa0sa0.2&rsa0.2nsa0.2nrsa0.2esa0.2ersa0.2sa0.3&rsa0.3nsa0.3nrsa0.3esa0.3ersa0.3rsa0 nsa0 nrsa0 esa0 ersa0 ttyv0&ttyv1& vgacuaa0&cuaia0cuala0ttyp0&ptyp0&ttyp1&ptyp1&ttyp2&ptyp2&ttyp3&ptyp3&ttyp4&ptyp4&ttyp5&ptyp5&ttyp6&ptyp6&ttyp7&ptyp7&ttyp8&ptyp8&ttyp9&ptyp9&ttypa&ptypa&ttypb&ptypb&ttypc&ptypc&ttypd&ptypd&ttype&ptype&ttypf&ptypf&ttypg&ptypg&ttyph&ptyph&ttypi&ptypi&ttypj&ptypj&ttypk&ptypk&ttypl&ptypl&ttypm&ptypm&ttypn&ptypn&ttypo&ptypo&ttypp&ptypp&ttypq&ptypq&ttypr&ptypr&ttyps&ptyps&ttypt&ptypt&ttypu&ptypu&ttypv&ptypv&ttyd0&ttyid0ttyld0 zs0 kbd06& mse06& psm06& sysmouse: lpt06& consolectllpctl0ppi06&iic06&smb06&ums06&tun06&tap06& ch0 apmapmctlcard0&pass0&xpt06& i4bi4bctli4btrc0i4btrc1 i4btel0!i4bteld0:"i4brbch0:' ...#!/bin/sh -p # # Simple replacement for tar(1), using cpio(1). # # Copyright (c) 1996 Joerg Wunsch # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # # THIS SOFTWARE IS PROVIDED BY THE DEVELOPERS ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE DEVELOPERS BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # # For use on the fixit floppy. External programs required: # cpio(1), find(1), test(1) # # # $FreeBSD: src/release/scripts/tar.sh,v 1.5.2.1 2000/05/19 16:03:36 joerg Exp $ # archive=${TAPE:-/dev/rsa0} blocksize="20" device="" mode="none" verbose="" usage() { echo "usage: tar -{c|t|x} [-v] [-b blocksize] [-f archive] [files...]" 1>&2 exit 64 # EX_USAGE } # # Prepend a hyphen to the first arg if necessary, so the traditional form # ``tar xvf /dev/foobar'' will work, too. More kludgy legacy forms are not # supported however. # if [ $# -lt 1 ] ; then usage fi case "$1" in -*) break ;; *) tmp="$1" shift set -- -$tmp "$@" ;; esac while getopts "ctxvb:f:" option do case $option in [ctx]) if [ $mode = "none" ] ; then mode=$option else usage fi ;; v) verbose="-v" ;; b) blocksize="${OPTARG}" ;; f) archive="${OPTARG## }" ;; *) usage ;; esac done shift $(($OPTIND - 1)) if [ "X${archive}" != "X-" ] ; then device="-F ${archive}" # else: use stdin or stdout, which is the default for cpio fi case $mode in none) usage ;; t) exec cpio -it $verbose $device --block-size="$blocksize" "$@" ;; x) exec cpio -idmu $verbose $device --block-size="$blocksize" "$@" ;; c) if [ $# -eq 0 ] ; then # use current dir -- slightly bogus set -- "." fi find "$@" -print |\ cpio -o -H ustar $verbose $device --block-size="$blocksize" exit $? ;; esac ( . ..) protocolsz*group +spwd.db,services z# $FreeBSD: src/etc/group,v 1.19.2.2.2.1 2002/07/16 12:33:21 des Exp $ # wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: news:*:8: man:*:9: games:*:13: staff:*:20:root sshd:*:22: smmsp:*:25: mailnull:*:26: guest:*:31:root bind:*:53: uucp:*:66: xten:*:67:xten dialer:*:68: network:*:69: www:*:80: nogroup:*:65533: nobody:*:65534: # # Internet protocols # # $FreeBSD: src/etc/protocols,v 1.13.2.3 2002/02/27 03:39:00 dd Exp $ # from: @(#)protocols 5.1 (Berkeley) 4/17/89 # # See also http://www.iana.org/assignments/protocol-numbers # ip 0 IP # internet protocol, pseudo protocol number #hopopt 0 HOPOPT # hop-by-hop options for ipv6 icmp 1 ICMP # internet control message protocol igmp 2 IGMP # internet group management protocol ggp 3 GGP # gateway-gateway protocol ipencap 4 IP-ENCAP # IP encapsulated in IP (officially ``IP'') st2 5 ST2 # ST2 datagram mode (RFC 1819) tcp 6 TCP # transmission control protocol cbt 7 CBT # CBT, Tony Ballardie egp 8 EGP # exterior gateway protocol igp 9 IGP # any private interior gateway (Cisco: for IGRP) bbn-rcc 10 BBN-RCC-MON # BBN RCC Monitoring nvp 11 NVP-II # Network Voice Protocol pup 12 PUP # PARC universal packet protocol argus 13 ARGUS # ARGUS emcon 14 EMCON # EMCON xnet 15 XNET # Cross Net Debugger chaos 16 CHAOS # Chaos udp 17 UDP # user datagram protocol mux 18 MUX # Multiplexing protocol dcn 19 DCN-MEAS # DCN Measurement Subsystems hmp 20 HMP # host monitoring protocol prm 21 PRM # packet radio measurement protocol xns-idp 22 XNS-IDP # Xerox NS IDP trunk-1 23 TRUNK-1 # Trunk-1 trunk-2 24 TRUNK-2 # Trunk-2 leaf-1 25 LEAF-1 # Leaf-1 leaf-2 26 LEAF-2 # Leaf-2 rdp 27 RDP # "reliable datagram" protocol irtp 28 IRTP # Internet Reliable Transaction Protocol iso-tp4 29 ISO-TP4 # ISO Transport Protocol Class 4 netblt 30 NETBLT # Bulk Data Transfer Protocol mfe-nsp 31 MFE-NSP # MFE Network Services Protocol merit-inp 32 MERIT-INP # MERIT Internodal Protocol sep 33 SEP # Sequential Exchange Protocol 3pc 34 3PC # Third Party Connect Protocol idpr 35 IDPR # Inter-Domain Policy Routing Protocol xtp 36 XTP # Xpress Tranfer Protocol ddp 37 DDP # Datagram Delivery Protocol idpr-cmtp 38 IDPR-CMTP # IDPR Control Message Transport Proto tp++ 39 TP++ # TP++ Transport Protocol il 40 IL # IL Transport Protocol ipv6 41 IPV6 # ipv6 sdrp 42 SDRP # Source Demand Routing Protocol ipv6-route 43 IPV6-ROUTE # routing header for ipv6 ipv6-frag 44 IPV6-FRAG # fragment header for ipv6 idrp 45 IDRP # Inter-Domain Routing Protocol rsvp 46 RSVP # Resource ReSerVation Protocol gre 47 GRE # Generic Routing Encapsulation mhrp 48 MHRP # Mobile Host Routing Protocol bna 49 BNA # BNA esp 50 ESP # encapsulating security payload ah 51 AH # authentication header i-nlsp 52 I-NLSP # Integrated Net Layer Security TUBA swipe 53 SWIPE # IP with Encryption narp 54 NARP # NBMA Address Resolution Protocol mobile 55 MOBILE # IP Mobility tlsp 56 TLSP # Transport Layer Security Protocol skip 57 SKIP # SKIP ipv6-icmp 58 IPV6-ICMP # ICMP for IPv6 ipv6-nonxt 59 IPV6-NONXT # no next header for ipv6 ipv6-opts 60 IPV6-OPTS # destination options for ipv6 # 61 # any host internal protocol cftp 62 CFTP # CFTP # 63 # any local network sat-expak 64 SAT-EXPAK # SATNET and Backroom EXPAK kryptolan 65 KRYPTOLAN # Kryptolan rvd 66 RVD # MIT Remote Virtual Disk Protocol ippc 67 IPPC # Internet Pluribus Packet Core # 68 # any distributed file system sat-mon 69 SAT-MON # SATNET Monitoring visa 70 VISA # VISA Protocol ipcv 71 IPCV # Internet Packet Core Utility cpnx 72 CPNX # Computer Protocol Network Executive cphb 73 CPHB # Computer Protocol Heart Beat wsn 74 WSN # Wang Span Network pvp 75 PVP # Packet Video Protocol br-sat-mon 76 BR-SAT-MON # Backroom SATNET Monitoring sun-nd 77 SUN-ND # SUN ND PROTOCOL-Temporary wb-mon 78 WB-MON # WIDEBAND Monitoring wb-expak 79 WB-EXPAK # WIDEBAND EXPAK iso-ip 80 ISO-IP # ISO Internet Protocol vmtp 81 VMTP # Versatile Message Transport secure-vmtp 82 SECURE-VMTP # SECURE-VMTP vines 83 VINES # VINES ttp 84 TTP # TTP nsfnet-igp 85 NSFNET-IGP # NSFNET-IGP dgp 86 DGP # Dissimilar Gateway Protocol tcf 87 TCF # TCF eigrp 88 EIGRP # Enhanced Interior Routing Protocol (Cisco) ospf 89 OSPFIGP # Open Shortest Path First IGP sprite-rpc 90 Sprite-RPC # Sprite RPC Protocol larp 91 LARP # Locus Address Resolution Protocol mtp 92 MTP # Multicast Transport Protocol ax.25 93 AX.25 # AX.25 Frames ipip 94 IPIP # Yet Another IP encapsulation micp 95 MICP # Mobile Internetworking Control Pro. scc-sp 96 SCC-SP # Semaphore Communications Sec. Pro. etherip 97 ETHERIP # Ethernet-within-IP Encapsulation encap 98 ENCAP # Yet Another IP encapsulation # 99 # any private encryption scheme gmtp 100 GMTP # GMTP ifmp 101 IFMP # Ipsilon Flow Management Protocol pnni 102 PNNI # PNNI over IP pim 103 PIM # Protocol Independent Multicast aris 104 ARIS # ARIS scps 105 SCPS # SCPS qnx 106 QNX # QNX a/n 107 A/N # Active Networks ipcomp 108 IPComp # IP Payload Compression Protocol snp 109 SNP # Sitara Networks Protocol compaq-peer 110 Compaq-Peer # Compaq Peer Protocol ipx-in-ip 111 IPX-in-IP # IPX in IP vrrp 112 VRRP # Virtual Router Redundancy Protocol pgm 113 PGM # PGM Reliable Transport Protocol # 114 # any 0-hop protocol l2tp 115 L2TP # Layer Two Tunneling Protocol ddx 116 DDX # D-II Data Exchange iatp 117 IATP # Interactive Agent Transfer Protocol st 118 ST # Schedule Transfer srp 119 SRP # SpectraLink Radio Protocol uti 120 UTI # UTI smp 121 SMP # Simple Message Protocol sm 122 SM # SM ptp 123 PTP # Performance Transparency Protocol isis 124 ISIS # ISIS over IPv4 fire 125 FIRE crtp 126 CRTP # Combat Radio Transport Protocol crudp 127 CRUDP # Combat Radio User Datagram sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS # Secure Packet Shield pipe 131 PIPE # Private IP Encapsulation within IP sctp 132 SCTP # Stream Control Transmission Protocol fc 133 FC # Fibre Channel # 134-254 # Unassigned divert 254 DIVERT # Divert pseudo-protocol [non IANA] # 255 # Reserved 0 ...1 ...2 ...3 . ..4sharez# # Network services, Internet style # # Stripped-down version. # # $FreeBSD: src/release/fixit.services,v 1.4 1999/08/28 01:33:10 peter Exp $ # # WELL KNOWN PORT NUMBERS # echo 7/tcp echo 7/udp discard 9/tcp sink null discard 9/udp sink null systat 11/tcp users #Active Users systat 11/udp users #Active Users daytime 13/tcp daytime 13/udp chargen 19/tcp ttytst source #Character Generator chargen 19/udp ttytst source #Character Generator ftp-data 20/tcp #File Transfer [Default Data] ftp-data 20/udp #File Transfer [Default Data] ftp 21/tcp #File Transfer [Control] ftp 21/udp #File Transfer [Control] ssh 22/tcp #Secure Shell Login ssh 22/udp #Secure Shell Login telnet 23/tcp telnet 23/udp # 24/tcp any private mail system # 24/udp any private mail system smtp 25/tcp mail #Simple Mail Transfer smtp 25/udp mail #Simple Mail Transfer time 37/tcp timserver time 37/udp timserver domain 53/tcp #Domain Name Server domain 53/udp #Domain Name Server bootps 67/tcp dhcps #Bootstrap Protocol Server bootps 67/udp dhcps #Bootstrap Protocol Server bootpc 68/tcp dhcpc #Bootstrap Protocol Client bootpc 68/udp dhcpc #Bootstrap Protocol Client tftp 69/tcp #Trivial File Transfer tftp 69/udp #Trivial File Transfer gopher 70/tcp gopher 70/udp finger 79/tcp finger 79/udp http 80/tcp www www-http #World Wide Web HTTP http 80/udp www www-http #World Wide Web HTTP sunrpc 111/tcp rpcbind #SUN Remote Procedure Call sunrpc 111/udp rpcbind #SUN Remote Procedure Call auth 113/tcp ident tap #Authentication Service auth 113/udp ident tap #Authentication Service nntp 119/tcp usenet #Network News Transfer Protocol nntp 119/udp usenet #Network News Transfer Protocol rmt 411/tcp #Remote MT Protocol rmt 411/udp #Remote MT Protocol https 443/tcp https 443/udp # # Berkeley-specific services # exec 512/tcp #remote process execution; # authentication performed using # passwords and UNIX loppgin names biff 512/udp comsat #used by mail system to notify users # of new mail received; currently # receives messages only from # processes on the same machine login 513/tcp #remote login a la telnet; # automatic authentication performed # based on priviledged port numbers # and distributed data bases which # identify "authentication domains" who 513/udp whod #maintains data bases showing who's # logged in to machines on a local # net and the load average of the # machine cmd 514/tcp shell #like exec, but automatic # authentication is performed as for # login server syslog 514/udp printer 515/tcp spooler printer 515/udp spooler talk 517/tcp #like tenex link, but across # machine - unfortunately, doesn't # use link protocol (this is actually # just a rendezvous port from which a # tcp connection is established) talk 517/udp #like tenex link, but across # machine - unfortunately, doesn't # use link protocol (this is actually # just a rendezvous port from which a # tcp connection is established) ntalk 518/tcp ntalk 518/udp utime 519/tcp unixtime utime 519/udp unixtime efs 520/tcp #extended file name server router 520/udp route routed #local routing process (on site); # uses variant of Xerox NS routing # information protocol uucp 540/tcp uucpd uucp 540/udp uucpd uucp-rlogin 541/tcp uucp-rlogin 541/udp klogin 543/tcp # Kerberos (v4/v5) klogin 543/udp # Kerberos (v4/v5) kshell 544/tcp krcmd # Kerberos (v4/v5) kshell 544/udp krcmd # Kerberos (v4/v5) 4 .3 ..5miscz5 .4 ..6 scsi_modes*t1 {Maximum Write Speed Supported (kBps)} i2 {Current Write Speed Supported (kBps)} i2 }; 0x00 "Vendor-Specific"; : # $FreeBSD: src/release/fixit.profile,v 1.8.2.1 2001/11/05 11:22:04 brian Exp $ export BLOCKSIZE=K export PS1="Fixit# " export EDITOR="/mnt2/stand/vi" export PAGER="/mnt2/stand/more" export SCSI_MODES="/mnt2/usr/share/misc/scsi_modes" # the root MFS doesn't have /dev/nrsa0, pick a better default for mt(1) export TAPE=/mnt2/dev/nrsa0 alias ls="ls -F" alias ll="ls -l" alias m="more -e" echo '+---------------------------------------------------------------+' echo '| You are now running from FreeBSD "fixit" media. |' echo '| ------------------------------------------------------------- |' echo "| When you're finished with this shell, please type exit. |" echo '| The fixit media is mounted as /mnt2. |' echo '| |' echo '| You might want to symlink /mnt/etc/*pwd.db and /mnt/etc/group |' echo '| to /etc after mounting a root filesystem from your disk. |' echo '| tar(1) will not restore all permissions correctly otherwise! |' echo '| |' echo '| Note: you might use the arrow keys to browse through the |' echo '| command history of this shell. |' echo '+---------------------------------------------------------------+' echo echo 'Good Luck!' echo # Make the arrow keys work; everybody will love this. set -o emacs 2>/dev/null cd / # SCSI mode page data base. # Copyright (c) 1995 HD Associates # Copyright (c) 2001 The FreeBSD Project # (contact: dufault@hda.com) # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. The name of HD Associates # may not be used to endorse or promote products derived from this software # without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY HD ASSOCIATES ``AS IS'' AND # ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE # IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE # ARE DISCLAIMED. IN NO EVENT SHALL HD ASSOCIATES BE LIABLE # FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL # DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS # OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) # HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT # LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY # OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF # SUCH DAMAGE. # # $FreeBSD: src/share/misc/scsi_modes,v 1.6.6.4 2002/03/14 16:18:48 joerg Exp $ # # The ordering is alphabetical by page name, as it appears in the SCSI spec. # 'i' is a byte-sized integral types, followed by a field width of # 1 through 4 (1 to 4 bytes). # # 'b' is a bit-sized integral type # 't' is a bitfield type- followed by a bit field width # # 'c' values are character arrays # 'z' values are null-padded strings # # # '*' suppresses assignment (for 'seeking'). # Bitfields are MSB to LSB. # ALL DEVICE TYPES 0x0a "Control Mode Page" { {Reserved} *t7 {RLEC} t1 {Queue Algorithm Modifier} t4 {Reserved} *t2 {QErr} t1 {DQue} t1 {EECA} t1 {Reserved} *t4 {RAENP} t1 {UAAENP} t1 {EAENP} t1 {Reserved} *i1 {Ready AEN Holdoff Period} i2 } 0x02 "Disconnect-Reconnect Page" { {Buffer Full Ratio} i1 {Buffer Empty Ratio} i1 {Bus Inactivity Limit} i2 {Disconnect Time Limit} i2 {Connect Time Limit} i2 {Maximum Burst Size} i2 {Reserved} *t6 {DTDC} t2 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 } 0x09 "Peripheral Device Page" { {Interface Identifier} i2 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 } 0x1a "Power Control" { {Reserved} *i1 {Reserved} *t6 {Idle} t1 {Standby} t1 {Idle Condition Timer} i4 {Standby Condition Timer} i4 } # DIRECT ACCESS DEVICES 0x08 "Caching Page" { {IC} t1 {ABPF} t1 {CAP} t1 {DISC} t1 {SIZE} t1 {WCE} t1 {MF} t1 {RCD} t1 {Demand Retention Priority} t4 {Write Retention Priority} t4 {Disable Pre-fetch Transfer Length} i2 {Minimum Pre-fetch} i2 {Maximum Pre-fetch} i2 {Maximum Pre-fetch Ceiling} i2 } 0x05 "Flexible Disk Page" { {Transfer rate} i2 {Number of heads} i1 {Sectors per track} i1 {Data bytes per sector} i2 {Number of cylinders} i2 {Starting cylinder-write precompensation} i2 {Starting cylinder-reduced write current} i2 {Drive step rate} i2 {Drive step pulse width} i1 {Head settle delay} i2 {Motor on delay} i1 {Motor off delay} i1 {TRDY} t1 {SSN} t1 {MO} t1 {Reserved} *t5 {Reserved} *t4 {SPC} t4 {Write Compensation} i1 {Head load delay} i1 {Head unload delay} i1 {Pin 34} t4 {Pin 2} t4 {Pin 4} t4 {Pin 1} t4 {Medium rotation rate} i2 {Reserved} *i1 {Reserved} *i1 } 0x03 "Format Device Page" { {Tracks per Zone} i2 {Alternate Sectors per Zone} i2 {Alternate Tracks per Zone} i2 {Alternate Tracks per Logical Unit} i2 {Sectors per Track} i2 {Data Bytes per Physical Sector} i2 {Interleave} i2 {Track Skew Factor} i2 {Cylinder Skew Factor} i2 {SSEC} t1 {HSEC} t1 {RMB} t1 {SURF} t1 {Reserved} *t4 } 0x0b "Medium Types Supported Page" { {Reserved} *i1 {Reserved} *i1 {Medium type one supported} i1 {Medium type two supported} i1 {Medium type three supported} i1 {Medium type four supported} i1 } # Notch page (0x0c) 0x0c "Notch and Partition Page"; 0x01 "Read-Write Error Recovery Page" { {AWRE (Auto Write Reallocation Enbld)} t1 {ARRE (Auto Read Reallocation Enbld)} t1 {TB (Transfer Block)} t1 {RC (Read Continuous)} t1 {EER (Enable Early Recovery)} t1 {PER (Post Error)} t1 {DTE (Disable Transfer on Error)} t1 {DCR (Disable Correction)} t1 {Read Retry Count} i1 {Correction Span} i1 {Head Offset Count} i1 {Data Strobe Offset Count} i1 {Reserved} *i1 {Write Retry Count} i1 {Reserved} *i1 {Recovery Time Limit} i2 } 0x04 "Rigid Disk Drive Geometry Page" { {Number of Cylinders} i3 {Number of Heads} i1 {Starting Cylinder-Write Precompensation} i3 {Starting Cylinder-Reduced Write Current} i3 {Drive Step Rate} i2 {Landing Zone Cylinder} i3 {Reserved} *t6 {RPL} t2 {Rotational Offset} i1 {Reserved} *i1 {Medium Rotation Rate} i2 {Reserved} *i1 {Reserved} *i1 } 0x07 "Verify Error Recovery Page" { {Reserved} *t4 {EER} t1 {PER} t1 {DTE} t1 {DCR} t1 {Verify Retry Count} i1 {Verify Correction Span} i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Verify Recovery Time Limit} i2 } 0x0E "CD-ROM Audio Control Parameters Page" { {Reserved} *t5 {Immed} t1 {SOTC} t1 {Reserved} *t1 {Reserved} *i2 {APRVal} t1 {Reserved} *t3 {Format of LBAs / sec.} t4 {Logical Blocks per Second of Audio Playback} i2 {Reserved} *t4 {Output Port 0 Channel Selection} t4 {Output Port 0 Volume} i1 {Reserved} *t4 {Output Port 1 Channel Selection} t4 {Output Port 1 Volume} i1 {Reserved} *t4 {Output Port 2 Channel Selection} t4 {Output Port 2 Volume} i1 {Reserved} *t4 {Output Port 3 Channel Selection} t4 {Output Port 3 Volume} i1 } # SEQUENTIAL ACCESS DEVICES 0x10 "Device Configuration Page" { {Reserved} *t1 {Change Active Partition} t1 {Change Active Format} t1 {Active Format} t5 {Active Partition} i1 {Write Buffer Full Ratio} i1 {Write Buffer Empty Ratio} i1 {Write Delay Time} i2 {Data Buffer Recovery} t1 {Block Identifiers Support} t1 {Report Setmarks} t1 {Automatic Velocity Control} t1 {Stop on Consecutive Filemarks} t2 {Recover Buffer Order} t1 {Report Early-Warning} t1 {Gap Size} i1 {EOD Defined} t3 {Enable EOD Generation} t1 {Synchronize at Early-Warning} t1 {Reserved} *t3 {Buffer Size at Early-Warning} i3 {Select Data Compression Algorithm} i1 {Reserved} *t5 {SCSI-3 Associated Write Protect} t1 {SCSI-3 Persistent Write Protect} t1 {SCSI-3 Permanent Write Protect} t1 } 0x0f "Data Compression Page" { {Data Compression Enabled} t1 {Date Compression Capable} t1 {Reserved} *t6 {Data Decompression Capable} t1 {Data Decompression Report on Exception} t2 {Reserved} *t5 {Compression Algorithm} i4 {Decompression Algorithm} i4 {Reserved} *i4 } # CD-ROM (and CD-R[W]) devices 0x2a "CD capabilities and mechanical status page" { {Reserved} *t4 {Method 2} t1 {CD-RW Read} t1 {CD-R Read} t1 {Reserved} *t4 {Test Write} t1 {CD-RW Write} t1 {CD-R Write} t1 {Reserved} *t1 {Multi Session} t1 {Mode 2 Form 2} t1 {Mode 2 Form 1} t1 {Digital Port (2)} t1 {Digital Port (1)} t1 {Composite} t1 {Audio Play} t1 {Read Bar Code} t1 {UPC} t1 {ISRC} t1 {C2 Pointers are supported} t1 {R-W De-interleaved & corrected} t1 {R-W Supported} t1 {CD-DA Stream is Accurate} t1 {CD-DA Commands Supported} t1 {Loading Mechanism Type} t3 {Reserved} *t1 {Eject} t1 {Prevent Jumper} t1 {Lock State} t1 {Lock} t1 {Reserved} *t4 {S/W Slot Selection} t1 {Changer Supports Disc Present reporting} t1 {Separate Channel Mute Supported} t1 {Separate volume levels per channel} t1 {Maximum Read Speed Supported (kBps)} i2 {Number of Volume Leves Supported} i2 {Buffer Size supported by Drive (KB)} i2 {Current Read Speed Selected (kBps)} i2 {Reserved} *i1 {Reserved} *t2 {Length} t2 {LSBF} t1 {RCK} t1 {BCK} t1 {Reserved}  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x ELF 4`4 (ll$$0 FreeBSD U WVSҍu^|=@~)}t#E$8t8/u H $@8ut R hx WVSP艎 U=$u@v$$@С$8ut h~$ÍvUUthhG~ÐUU WVS} ?t8uj/78 pu7$;t(3V襤 u;tWuCvVhhhP e[^_ÉUVS]j/S8 ޅtp$=$t$3V) u  v;u1e[^ÍvUVSu] SNVe[^ÍvU WVShhhPD 1$=$tS;׍7OhhP 3hhP ;uhhP j> Uuu uÍvUVSu] hɞjG v$40v,n4`8T >jhY (hhP jD hʞSVQ 1ĐÃ=0u-=,u$=4u=8u= u =t jjS9h thj1 v5$螊 U WVSEEvt޿du(f1[v(jS7 ƃ}> 8-ujSƃ} Shl2 $Hv} t*hoV ƃVQ Vէ VWV莉 tEUE'e[^_ÍvUWVS}EE   uj=8tM}u9 xڈvhSt ZE$=4t==0u4 =4t)EEPhqhZ @E u^=,}$ y ;|ʈvhj$s , = ^ y ;|ʈhj^s =I y ;|ʈhjI=ÀvSm  4%M y ;|ʈhjMr u- y ;|ʈvhj-r )vS=l  4%^ y ;|ʈhj^ r ?t @ y;| t ʈ/hQ: y;| tڈhSq t*OyWΡ  vPG @t$5(hl. $g @thj, e[^_UlWVS==%EPW趄 t5(hljf, E=sPy %uKhvj,, 1t6S%PW蹄 }hj+ v)ƅũ55%EP蔄 Ã}5(hlj- $e[^_U|WVSjjEEP jjjh ƃ Euhljh]S ߰ЃPEPV }V迃 |SE tt&DjV u1h}H= "jV u h}$= x[^_ÍvUuu uÍvUUrh7! jEPUR EE vt@UB<@ %Ph%F }Gh%hj3 vE%f=@t") h%hj v1=tutUB z=dt4PEp<GSUR6=dt4PEp<8SUR SEPtEE=`t!}uh%Urh/ EEP E& 8thʦj Eh[^_ÉUEP4t4 t/t*E @4t ttut1vÐUWVSjjEp9 EuUrh( <E@ UBPhh% E 0jhUBPhh% E}u+h%h( EPs vEUB%f= z4u z0jjEPjjUr0jRn ǃ uEpUZ0)ÃSVEP s 9}9th%h( EUr0W蜿 Ep{h%h( EN@v)ÃSVURzr 9}9uhh@EPir ǃ}Urh(= E=ttEPURtEEPq URq th%h( EEe[^_ÐUS]hPs踾 ushXfvƄ(} t&h% th%he2vh%Pl u1Php$ ÍvUS]} t$h% th%he'CPh%> th%h| =tu1vjS]US]} t$h%苿 th%he*sCPh%# th%h* v=tu1vjS]UlWVS]u EfcC@KMb)ȣDC HK$׉)ȣLh@h%诺 th%hv EtEPVn uEPh% t1eC ;EuC;Etbtss Vź uFss h%衽 t,9 8th%h Efct Cf;EtQtCPVB u6CPh%F th%ha EtCD;EtKtsDV u2sDh% th%h EEe[^_ÐUhh hYhPq j@m vUuu u ÍvU VSu0в5A u6hj j=5 Ãu5hj C;u5hjf Ehjj hEP ƒ uuhj' v#B tuh j B SBЃt8 t%tthP3 tLuhjj| =puhjd t0t`tK!t2t t0 t0hj tв1RP RP 9S-u2/2=w%v1u1Bt'H9rtU vEEe[^_UUHw r0 ÉU WVS}?tf?u_O j jw É1 8th@j w}0 _we[^_ÍvUVSuHvAj?/ Ãuh0j vFVRPhIS}2 ^e[^ÐUE8%ÐUWSt8u 1vtt߰uPhN8 tIW߰u3{=u-<u$SWe[_ÉUVS];uC C%,1C8tSщ‰ t C Cue[^ÐUS] h\jW t 8uPHQRh]phcC 5>]ÐUhgj vUVS]u S uV% Se[^ÉUVS]u SuVt&SV jjvV؍e[^ÉU WVSu} VuWt9VW wv 1RP>VSWJ F;GuF;G1QRÃVW؍e[^_ÉU WVS}u WuVt9WLVC vw+ 1RPBWV~ G;F uG;Fv QRÃWV؍e[^_ÉU WVSu} VuWt=V|Ws wv[ 1RP|à KVW G;F uG;Fv QR/ÃVIW@؍e[^_ÉU WVSu} V$uWtMVW wv Љ҉1RPà MvVW G;FuG;Fw QRKÃVeW\؍e[^_ÉU WVS}u W@uV0t9WV vw 1RPBWV G;FuG;Fw QR{ÃWV؍e[^_ÉU WVSu} VpuW`t9VW wv 1RP@V/W& F;GuF;Gt QRÃVW؍e[^_UWVSEU M]u}uvuv uv }}| v1[^_ÐU WVSu} Vhщƒ tWRщƒ uhtj FVGWRPÃCSRPGWRPFVRP(0th@jZ VW؍e[^_U WVSM] EUuu|1u}WV؃RPSQe[^_ÐU WVSu} V\щƒ tWFщƒ uhtj FV+GWRPÃCSRPGWRPFVRP(0th@jN VW؍e[^_UVSUM ]u tQREURPG 9u9t1e[^ÍvUWVS]u S`щƒ tVJщƒ uhtj KfEUCF‰UFCEEURPǃGWRPFVRPCSRP0th@j4 SVe[^_USEU M]uuuu v1[ÍvU WVS}] WTщƒ tS>щƒ uhtj C Cuhj} CSRPGWRP褎 RPƋCSRPGWRP+ th@j- WSe[^_U WVS}u Wщƒ tVnщƒ uhtj F Fuhj FVRPGWRP踋 RPÃW V؍e[^_ÐU<WVS}WhE P\ jE puV t&hSVPo Shj vjEPjwEP u>E Eu6}|WEEGP6E؋U+EURP!}ujj h\ÃWE P EPj ؍[^_ÐUVSdu v'ہ'~'5x)tPR# PX! tmpx=tP5" vP! t(pdDXl1ve[^U WVS|h=u xp1fuھ=}t} u$y]r;uix;lr Gxx4]f0pp=h? h4ujt0x( r;u=huhg|=hhxE$tcx[Sf<]ruG;lr > xx4]f0ppHx;xpd=<])pCe$Op@<p0pp0pp0pBp0pp0pp0pjp0p6p0pvp0pbp0pNp0p:p0p&p0pp0p"?x)‰Уx0)p<]udu`xxfpp=}} =v}t$x r9u  4} x;lr Zu*xxf0ppphs1e[^_ÉUuu uÍvUWVS] }EM3M}~b}=w%1u-j EP3% E8tE8t3hj v}~EEHv 3KE4`h} j% vhGj% 3uKM}h eָ!tRLE8-vR  4%t3 E}qb=w%1tj/EP uEv@PWhhSg ߃ EPWBj %=t tWn v=h WhhPߩ HyP9; ƃ t7t2KyS;  tuԃytYth+hP\ _Wm uWEPЃtWh4 #=tEPPWh9 1[^_ÍvUhDh`hhhP j0 Uuu uÍvUE @PE@PL ÉUE@PE @P, ÉUUE H } =tU=u=tDyv=t|av R=u=v=t(%v=t` v=t (#=,t vpt SWV Sh*j5 vU WVS]1=uTPSu ? ǃujjҾ jWnF Pjn =VE=%EC4t t`vt#tC@Ph sb PC@Ph  f{2t{@.u =ty=tsh! #v}~sh EPW\E ƃVSX =utjSWE WXA Ãv 8thjV e[^_UWVS} DžX=(u=,u =t DžXDžhh\ EEEEEDž|EDžtDžx;߰P ‰уu jj` ;:ufB$B{:u ;:u0BBBC;uz:u fEPEPEPEPEP|PxPtPhQl 0w[$<DžtDžxDž|EEEEEEt8tx$x | |uEU DždDžLU lDž\lfy4tfy4 uHlp Pl@Ph? lB  e}u"lfy4u9=u0A =lx@.u=u@ vlB&;EvE=u =t$lA&Pȃ@P;EvEXl@9t,fx2u#=uu u63Ѝe[^ÍvUWVS}19s!vȉډF9rȉ[^_ÍvUVSutPv{ t@vv S  xhj [ue[^UE=u =t P '= uPhi vPw ÐU,WVSUfx2t8=,u =t&UBH15Ph E8+UU w<=(tvEp h =t6 AF8V<SQRPk RPUrh EPFPn _sUr3r,F Pr$EPhR 0=$tsUrh0 F%f= tf=`u@F0=vPFPh mvF0PFPh PExt/F0V4RPEP(Rh)Ph F0V4RPUr(N=t v=t v( vv G@P= tFPF%f=u W xvhj e[^_ÍvU? u;PS; u$h3 mE PWhOEPW> tWh 4vE%f=uEPE PWvE PWCx[^_UWVS}jjEPY ƃ}EPh4;G@=8t58 w@ 8u-4h_ E G@4:C` 8uE PA tE Ph辛 VjhE PX E|S58EPy 9r5458Vm Ã}ZEPhE E PRA tE Phm V EP V _ww EP= t:ww E Ph迚  tPE Ph芛 fgGPEP4= tPE Phl ^ wDEP? t'^ 8-uDtwDE Ph$ GEG EEEEPE P< tE Ph2ߙ EP tE Ph"vEP? tEPhm蔙 !=DtE PEPh 1e[^_U] …uOju EPF=Dt@PhKhN hNh j9 jEPRm uhNhVvEthNhEtPhN#G …u=jEPhhKhx hhk j 9 jEPR uhhV:Ethh#vEu1EPhh Uhh hGhPqy j@ vUuu uÍvU WVS] j/3@ u@ƿ&u%}uCP~5hl K 1d~&wp$8TaP\KP\3d%H` h-SEPU eĐ)E}=Pt1cv{ S ; L;t0j2 XtS) vSS5h> e[^_U WVS1=Lt=Pu=\u=Xtu=`t jPuI ƃjj C4H $vs Pshj͔ =Pt {>sǿ Psh% h v=Pu3s Ã]\W 8thj< e[^_UlWVS}EEEPSK4 tH=`t fEkv=PtV 8Shw hp=`t+jμ PSh. h ?E%f=@u&=TuSh h=Pu'E%f=tEPSS1=Lu EtEuE$PSr6 ƃu`E%f=u S2 >E%f=@uS3 %v=dtEPSvSf7 ƃt.=Pt U 8tSh h=HtuSh脡 $e[^_U|WVSDž} u]SEPH2 !] U B%f=>jjEPM PR<2 =} Dž􋕜R uh'jT PhR E X0p4gv;u;w RPR~ 9)օuw􋅘P/p jjjR щƒ PjR E X0p4gv;u;w RPR 9)օuw􋅘P[o jjjR щƒ PhR E X0p4`;u;w RPR 9uO)օuw􋅘Pn u(􋕘R u􋅔PW 7ht􋕔R2 EPhR x[^_ÍvUWVS}u=\tWh.hPn =Xt8F%f=t)ju 1 u FFuFDt =Lu 2EPFPE vD à ujj vW<;t:P<;tPjv Pjv M P:} u<PEPh@hPm 0S hPE HyP ƃ t7t2KyS  tu1ytYue[^_ÍvUVS1];tnj/3J ƒBu:.uGzt z.u;zu5Fuh` hCu땃됍ve[^ÐUhhhhPl j@ vUuu uÍvU WVSu] 1?tpu vhSVI uСĐ9u1;tC3, }3h@ t3 ƃ;uV, UWS]߰ЍDH9v8/t@4H9v8/t@S, }Sh踉 j/S聋 u1e[_ÐUhhPk j Uuu uÍvUWVS]u vkhVS`H uĐ)Í4t@EvEvRq  4%@tE͐1E8-uG vE8+uEE=w%1t&j EPu ~ 1ɉMEE8.u[]gfffvEE=w%1t!EC)‰uu}}~jEP˱ j UhhPTi j Uuu uÍvU%, j vUuu uÍvUWVS}] j/310 Puzo%lE/v7w`$EOE1BE16x)|EvlshSWE xĐ)ǃD=xt5}t}uthj藅 vt}ttp=tDj:3dC uj.3QC t@P3( 3jWS4 ǃujj v1eC4H $v=x?jSW' +s¯ Psh  8s蚯 Psh  v}=pt S }Rhbj jjh Q }Phbjz h PR = tQhejE \Tt"hT\Phj S0E M 9vE 0W ƃU 2hj Vh ׉C!CS{xK`Kd t1 jRPQ@ }Phbj/~ vRPQ ;tPhbj} {x(VlB1 VljؙRPP }Rhbj} QPP ;tRhbjR} Q_ E E 8BR j Uuu uÍvU,WVSDž1v8$d d =+t++v}=+t++c=+tn++G=+tR+++@ !=+t.+++hE PUR< Đ)EM M =t@ =+u4+(=+u +}*U 8/tCjcPhh5+$ +D װУ+ D =+%P5D 9 @ 8ug8/t]Phh5D  D װ+=+%PR%9 }5D hjJz =++$v}tM)RZÃQS4ZvDžPhmdP hjy }t(RÃShn S/=t7}u1hjM q$EhhW\ }t](hE p֑ uU rhjy hPu j Qhh +É߾ESh P Nv}u U ZE}t'hSM q*Phh É߾E SDDžPhmdR hjw QÍE}uhjE pmRhh ÉߍES uSh P>R U WVS]uu/$EP uMQhjw ߉E=uD{t>C8/tPhhh@ sh@( @=uC{t=C8/tPhhh G sh   jsVIY } tjE PV e[^_ÐUVSu]=t!h$ShyS#WEVǃWEVfǃ1ɉ9s f3 9rf=@ ShfdVk }$k; 8ta; 8th6vjjjV( EEPhmdV }hv u V ;u)= t655 Vq ;thGav LEEPhmdV -ShgdV} }hM1e[^ÍvUS]Q: tRtmtSt`Sh^v hShv hhP @=u$hhh   j5/ ƃ}5hjp U r(Z Ãu5hjp M q(}WS E p(WVY }5hjp V v<%Bu vt}ǾS諾 j5. ƃ }5hjp EPV' t5hjo v} MЋ]O(19u9v5h"jp U B(ы)REPV: }5hjbo V M9s9th@j8p A9rEe[^_UWVSu} 5D hlVIR f wG4*hsGPh}VR GPjhVR GPjhVQ hVQ GXthVQ GXthVQ GXthVQ hVQ w(hVxQ w,hVdQ w0hVSQ w8hV?Q w4hV.Q w AQ}޿b1t u Dž *,+s-tRP  ,+rԃQ]  v'hgPhhPH O ޿DžS޿ 1t u Z޿u <޿u  SQhhPAH t ;]U BX ޿ u]1y ;p S  ‹E \FS Å? ;6 ~, PhS uOHv+QhhPbG E fǀ U f vu Džv޿ujQE PV z ޿ujPE P% I ޿ uUR ~ tQPhU B(v޿1uMQf SPRh?M A,v޿TuMP SRQh?U B8'v޿euMQ SPRh?VM A0v޿u uMPF SRQh?U B4gv޿ uMQ SPRh?M A<v޿uMP SRQh?6U fBH޿ uMQ& SPRh?M fAJF޿ uMP }SRQh?vU fBL޿ uMQf }SPRh?M fAN޿ uMP }SRQh?U BP'v޿uIQ }SPRh?YM ATv<{3ƟU 9r6S`PQhhPA kvU ` DžuQh (vSuj PS\ t$| u$*tSPh`DžuRh }S uj PS贵 t|u9<*t.<t(SQhhPm@  vGSh0+l+s$tSP tEl+r=w%1t"S -0+=Džv$SPhhP? DžG G  t SduSP GuRh nS S 1wG OvSuS GuQh SuuSa 1wG uPh SS fGlv@M 1q(9sG G fGHG@G fG@5-*U fB!SQh hP= EPhP`s !U R%[^_U,WVSEEx(u hF&Uz,u hUMy0uhfhP< vu~4uhyhP< EEfxHuh0Uz8u B,B0B8My<u A8A4Au"Et }E1BЃ M̍DBЉEt { t5!L5+hRZ h EZ h`5Z =0,uSgC~50,N=T,u =H,t50,{=@,tb=T,u=H,u =@,tg=\,uhY hY jo=\,uhtB h@OY jΟ UhhhhP1* j裟 vUS]h`X u,vShX S C~ S]ÉUWVSE+jh.Wu uh {X G 1҉EU+ÉEEUE‰UEEEUEUGPPGPh* X C?u9PPEURPw wh`W G$?%PGPWG$%RG$?%PGPWG$%RhW e[^_ÐUlWVS5L,ujV ǃtEPW6 uVhjD EЋUԣ++ +SQRPщ‰ tVhjE =+t5+ EЋUԣ++P +uVh@j\E 5+5+W ÃtW tVhjD ډ;+u +;HtVhcjD ve[^_U WVS] ,F ,=!\1߅u^!=!!)؉F V8e[^_UWVSE+EPhU EP =T,eh M=P,t;jV"& }u'jh&U jeEEFPEPhj tEFvEPhI tEFv EPh( tEF Vuh@D Fh /^F$%FEF$?SEPh t]EPEPh tEEWEPhm t}^?$ˆVEF^F$%FEF$?SEPh t]EPEPhtEEWEPht}^$?ЈFEF VEPthe[^_ÐUh R 5!5!5!5"h`R 0=!?=! =!~hR hR 5!5!5!5!h`fR U WVS1ۉ+}sVh 5R uC~у=H,t }t}hR "uh@thWEPhl8t]Cw߃hCt1ۉƀ+C~Gw ƀ+e[^_ÉUhtÍvUS8h ]5!ShU|tE!5!ShoYtE!5!Sh6tE!!!!h0i]UWVS]{u1{u+{ u%..BCBCB C K15!։15!C15!lj15!BC?$ˆSs N15!15!C15!15!BK?$ˆS[^_ÉUhEP5! u$[ 85!hvE u5!h? =H,u=D,u=@,u}t1P5! !u! 8uD5!h*jt !v5!h ? ÉUSEU ]j RP5!B =+uB+5+S5!ߔ ;+t5++=~v5+S5!觔 ]ÉUSEU ]j RP5!誕 5+S5!I ]Uh!hedA5!~ t^!"!!!!!!!!!!!"!!!s5!h = "!!!!!!!!UWV+++=+t5+ 5+އ +u h` X5+jjƃu h 2+fUu+1h < e^_ÍvU WVS=!t&jvh _; {v=+Ǿ+1+v++PRPÃtG+RP++RPӉ9u9w1e[^_UWVuhB LK hq hjdh!8R u j裑 v!װD=!tUֿJ t9ֿN t&ֿR tֿT u 1e^_ÍvU WVSu1ۉVEPh` nJ h q hjdh!ZQ u jŐ !װD=!t'!!vAt t tu1dAtBЃ w \Bv t uAt( t tth!h I E e[^_ÉUVSu41ɺh,9uB A9| [^ÍvU WVSu ]1vR u v4%@tCύv;;#CvRt v4%@uЀ;#vRt  4%t VD2C=w%1t6EjEPS< ‹FT0 ;]t ]F9e[^_U WVS}!!!1ۋu UDvW5d!h @4,=8,t5d!h ExS5d!h` 6 1e[^_UWVSuE@E+jS NKVSF$C <ujS EEC15!t_5!;=!r +!9vEP5d!h`5 !PsEPh5 5!sC C15!!;Cwh 5 1+s;s tVs EPhp5 s { uEP5d!hM5 fvS_EQ8,~t5d!h 5 *vF EHEP5d!h 4 Ee[^_ÉUSE1*+1ҐB~DG<,xt5d!h@}4 1 H AvQ5d!h Y4 ؋]ÉUdSEPuE?1 e[^_ÍvU WVS}jEP蒛 X|GWEPw tWELP^ u EKy1e[^_ÍvU WVS]u t>uth;tc߰҉‰URk ǃuhj vVShAEPW蔾 vVJ ǃt SUl e[^_ÍvU WVSEU EP8tI8-u"UCj=P t+@UƿtUGCChTEP艽 uE e[^_ÐUWVS}uhfI vhJE PhPE P uEEEEJJ߹u E P P߹u EPSEPEhTEP谼 ÃuEPj EPj 1EE v߰ЃPi ǃuhj XfZGSW,u;tFCFuN,hTEPI Ãue[^_ÐUh`hhh+hP% js U WVSEp0ƃVEnu~ou EEj=VZ t@] ;tdװЍxWRV uы<t<=uÃ;t*U{ tUE;Cu [ +vC!v=0uVhLj v1hJV0ƃEPc e[^_ÍvUSUM ˀ:tB:/uz/tBA:u)؃~ y/uA[ÉUtS] SuJt3EPSZ uE%f=@t1Shhj@ 0@ PSh|j@ v]ÍvUVSu] u#13"*3VE t;u="%e[^U WVS]u1;nu{ou "1؀8tv8,uF@8uPa ǃuh 11؉ @Fj,P ue[^_ÐUuu uÍvUWVShj/E 0 PuE R t"v11EE1W2wH$=d E.E$vE@ hE PEPu%=uhj { tjj tVjjk vtph$hh Ã~Ojh'Sj }HPEPSj jh0Sj Sj }ur Åu˸ Pe 3t="tj"jh Sh7j"jhD ShKj hZh[hd}u觷 jj臷 uhfj4 jjPi jjX uhsj j&b 1vG(Ã}u( ja 9uҿv?Pa Gj jض u 8t&~˃hhP Vi0< Pjj肶 ZuRhj/ vUD="tPh hPD jh UEjjEPEPh  uEh C 1ÍvUuu uÍvUVS!j? }h!_ Ãu"E PEPB+t$# 0j P5d 7g PR8t5d h"j v=PRh@"j $0(0d 40=H0tH0PRh"j^ H080<0j P5d Qf L08t5d h"j =L08h"j @0,000h "u uxƒZĐ)EE =H0uh #jh h|jye ujjee h|jSe ujj?e hPSH }uEE E J#H0&$$vIj)jD I=LR~z=,0thL#h VoDjQ) =,0thg#h h0jhJ#O,!i"jv=,0th#hE jCj( =,0th#h h0jhJ#+V" &j4 R'=(0t5=,0th#h hLjhJ#{+jV@oV7CX%+V" %j4&jVr@ (Hj'jB M}hVE 0E  Vsà thSV*M}uvGjY'jcB M}t`hVE 0E } Vrà t'=80t VihHSV'*M}uv"i$j2=(0t%j 8Uh@%h%h&h@&h&h&hP j7UWVSE 0UNM9-wPV ËE t(}@PV EEujj vEU:vMuUPh&C >ЃPV ujjr -MB6Pb '}uE-@EEUMAMEE80}tUM u؋U +HMe[^_ÉU@ WSEEE@EEPEpEEhPhu'h (P t7}tEEEP} T0P0(EPhPPPv 93$h+װHPhw'R WoÃ=80t WehHSP&װHPh{'R WnÃS3uWh~'hP; rPPb` UװHPh'R Pd5t@uPh'hP hdpPu%װHPh'Rj cj .=(0t P0jvװHPh'R h'h'h (h@(h`(h(h(h)h@)h)h)h)h)h *h@*h\*hx*h*hP PװHPh*Rb [PPxװHPh*R uh*hP 'vPh*hP װHPh*"װHPh*R~ wװHPh*RF ?=,0t"h*hP ,0Mh*hP ,0/vװHPh+R ju+װHPh+R JװHPh+RN uK=(0t"h+hP, (0Yh-+hP (0;vPh@+hP [_ÉU WVS] u~=T0vhP,hP hP: 5HRhh#j =# t#ЍP"" t " u H8 t8 t@Sh#_^48u$UREPURH, EUD"T0h#5T08u T0T0=#/u&EPURh#E**Ch#EPh[,hS覠 UREPSFFPjj@UR"j }v4ha,hP ~tSFFEPFV)‹F4UR?+ EUDN~uFPu [^_ÍvUVS]vC; t; tu n;\uC;uh,hPo L;'t;"t CF<C v CF8t;uCuPh,hP" K; t ; t;u؍e[^ÍvU WVS]޿,tjh,SѼ u,U +;/u,U f,U f,B} ҉ЍD;Erh,hPY jc,vSU R7Y ] ރ;t#C/u;/tF;uN>/u] ;tsCC;/t;u)u>.uNSVX )uƒjh,V費 uNE @9vN>/uSVW 뉐e[^_U<WVSuVÃ=(0uHDR=,0u ;V$DžEPSVV} ʉˉЉU9u13P1EǰHfE xvDžR#ÃuQk$RP^I uh,hP hV#uh,!eVh-hP DžhVS' hhu'SB ߰Hډv=(0uJDR=,0u5;s,s,t}C=~hCPRh-hP ?CPCPP` R SQ P !ÃR"u(h4-hP: Q[H h`j PRrU QPitCs.;sh4-hP RG [^_ÍvUVSu ]FP-Cƒ:t=,0u <^v?B:uf+SfS=(0t!HDRrC ^%u(t@tC *C Fw$d-FPh@-hP ;vC @6C =.C #&C %6j%u C /vC e[^ÐU,WVS} EEEME9s4;sC9E}E{ tE{ tE ;]r̃}tE}tE=,0t9Eօ~gfffvE)ƅUMTUEQ}EuEE|8}E19EU9UtM IM܋EE@U=,0t$3MQh-hPH C@EfC}tDS XyX;h| tPPhPR; fCsh-hP }tBS XyX;h| tPPhPR: fCU܍;Erh4-hPr `[;]}G Xy X;h|PPhPj 1: C;]|EE9EF;uoe[^_ÍvUVSuVÃtf=,0u;t=(0uJDRst2''C'C@PCPh' v1e[^ÍvUVSu urÃt1=(0uHDRs=,0u ;u!3!u fF@fF1e[^ÐUUE pr>d U=H0iu=(tjh (A= h-]u j"ÉUVSu =40؍FDRsB=,0t&6.}u1.Ph;.h" uVh>.h ؍e[^ÍvU|WVSu}=40ЉUE HDRr&=(0VhG.h } u=H0iu =,0=80u/E Ph\.]SD ރuU RVXE P!ÃtS#PVb t$WU RV#Ãu STKEx[^_ÍvUS=40؋E HDRs)u6"t`Hxt P%؋]ÐUVS=,0tha.ha j Ãtl=,0t_h~.h0 HvsCPJhRsDRsSVS\$ u;5TRV ÃVhRrq=(0tS!Ph.hw {uSSS#$SPs\ (C ( [uF;5TRSe[^UWVSEEE HDRЉUEP_ ǃt3Mwƃuh.Y9tEU RƃtM^[t9uEu^9tZ}uWRW" 7v=(0tW Ph.h WO1eEt"t F;EuUt G;EtM}E$/N=(0VVPUREP}uWQW! vWOURE PUR8 Ã}u S`PK=(0ASt}u Fuu25@RVh2h`03 =H0rt1=H0Rt(h2h`0= h`0虃 à hh h`0 Ãt&h3S!V D8u)S: h`0h 3 jm}5@RVhM3h`42 =H0rt0=H0Rt'h2h`4 = h`4؂ à hh h`4M Ãt&h3SaU H8u)S: h`4h`3 jDžƅƅ3ffDž XR3dR`Rt%f=@5D8W h`0 L8 u%ɦ0 Ph3hP =H8t5H8PW h`8Huih3IZ5@8R5\R ÃhP h. PMC@8)‰S [^ÉU-=`Rt`R%f=@tÐUWVS] S ujSEPUvjSEPU҃hEPS E߰Ҹ)Ph3S< ߰H rr5L85L8à t)s3u5L8vEPh 4hP t'sH4u5L8URh`4hP 5L8ǃ0C=v!hCPVh4hP] ?CPCPV UR3V pW5L8H5L8Ã5L8Gǃ Z[^_ÍvUVSuS8 ؀8/u8/t1vPV>Ãu1%3h3PN} t8uƉ؍[^ÉU WVSu u tbpp5L8FЍx5L8Ãt!C9uWVCPך ủ1e[^_ÉUWVS=$0t?}} ]9ff;tVSLVS 9r81;u -]=VtSh4:=Vt;t=VuCCC)CuS9C $9=,0th4hԾ Ct=,0th4h谾 SC $9s!=,0t6PCPh4h~ =,0th?5h` Cƃ;S[^_ÐUS]fC $fCCd8=~;h8Rf+h8fT5D8hjQ豫d8CPSd8RPK d8h8CУd8]ÍvUh8Rf+h8fT5D8j5d8Q75D8 @8d8U WVSU] 1BCjRsV^ ȈCfC $fCe[^_ÍvU WVS}] uW9tV)ySh`5hP蛼 j%RP7+3 %GthG P71 Ge[^_U WVS]{uBhC P31 C%=(0h5hP C;C| C맍vsD3 EfxtP)9~(=(0tFUBPh5hP詻 *vMAC9u΃3u1tsuuh6?ZvS7ƃ=<0uWK e[^_ÍvU WVSu} WÃuVWh 79>hhVO }NVhI7hPǷ hPR l0 PhN7hP蕷 1Iss5L8L80Ez Njs ~SPW, uL5XR5\Rh7hP ʙ0 Ph7hP 0j=<0ukSPP , uL5XR5\Rh7hP衶 V0o Ph7hP 0j W+ P+ [^_ÉUutÐU,WVS}u jj= Ãuh7<Mb)Ѝ)‰({EC=H8ti}܋FENMb)‰UFENMb)‰UfEFdEFpEFtE5H8j$jEP؍e[^_ÉUMMb)Ѝ)‰Ћ(t 9Htu1ÐU(=`4#th`4Ky =`0#th`02y u * US]t;TRr1'15d<ѡ`<t 9Xt @ u1[ÍvUVSu] t;5TRrVh.8t:15d<`<sC =(0t!9suhG8S6[ ue[^US]t;TRrShV8:15d<`<t9Xu@@ P @ uShr89]ÍvU WVS]jƃt]CB;/t ;t9r9t;vt(W6? utCu vu1[^_U WVS}j/W ÃtWH/u1~tWh88e[^_ÉUVS]^<C`89v7)ƃP3V j 9t#N/[S`89wʃVh8d8e[^ÍvU WVS=8t8C 81 'j$j$ Ãuh88E$CMQƃub} ujtEPh87MQ}ȈC[Sjj/MQw @PǰȈCsFC^ Mt6E PRƃu h87M KFC^9v} t0E Pth96SM Q6؍e[^_UVSuf~th'9Vp3~u.~th:9VS3~thW9V<3~tvvÃuhs9V39u)^S~t8vS'v[t9suFCuh9V2V68F 58e[^ÐU WVSu} WÃuh9Ve2;^tVx^CFsj/Wv X6% S‰߰ȈFRV;,P^; uN fߍe[^_UMQ9Ju AB/vRvRt9JuABuh9Q1ÉUWS]uh94߰H<9t 9)$Pb ǃuh9X4SWS% e[_ÉUWS]߰J< <[_ÉU\WVS=,0th:h諭 =<0Lh":EP Eu@50N Ph$:hP^ EPh@:3jTE` ;=TRwBWÃt's FEPC$Pj3ݚ[uG;=TRvuE;=TRvWÃtj$SVL EC$EC@ F{t C@ F{t C@ F{t C@ F{ t C @ F EPjj$V%[uG;=TRb1;=d<s?`<<u E`<@ EEPjjEPљG;=d<rE ETREԡd<EȋEEġLRE̡@REСPRE؋EPjjEP耙E@ @t9I0b Phm:hPr EPh:1EP> e[^_ÍvUWVS=,0th:h }u\TR%H<d<jP5 `<uh:1jjh:IzjjEP Ã}9T0m Ph:hP} EPh;0EPSA }90 Ph";hP0 EPh@;X0uVjL ǃuh;.0VWST |jEPS> }9|0 Ph;hP襩 EPh;/H0)‰`<]܉1;d<}" `<<t B;d<|ߍK$9s]9AAyt AAyt AAyt AAy t A A $9rh[^_U WVS]PRP== 0t Pvj VHRj:S讃 t;8j:S薃 C58^. j޿<h<h< HRuw'0@ Ph<h<hPK h<h< HRu20 Ph<h<hP j 8j Pj S_ = uh<hP车 jve[^_US]PR;8~V==t5=  P =uh =hPJ jT8]ÐUh=,0th`=h =8tj5=0+=8t8vjj5=2 8=8}5q0 P5=h=hP蔥 jvP0 PR@==8u= 0uh@N6uX = A$0h@Nuh=hP jh=hP =8tBl=$0tk===1 HuI)ȣ==,0u =H0tu HNLRDN@REPh=ld }10' Ph=hP7 j>EH=w 8U=w88B!t Rh=hPݣ jv=LNth >hP赣 jvh@Nu4=(0t5Ah`>hs h>)h@N=@Nth>hP5 j?vN @TR=(0tPh>h TRPj) Auh>)AhRdRh, h : =@Nth?hP舢 jTRPj誡 Auh?(ADRdRh, h  =VuDR=H0ru AÐUWVS}uA88 A=8t^}t0h@?'=00u HR@ `t j=P0w=8t jq=H0Rt=H0rt =dRt]1ۅb=Au?h?h?h?h@h$@h`@h@h@hP 0h@hPҠ @f@1ۃ@v#At.CPVh@hP臠 @fGC~h@hPU h@hP> hP 5HRhV u j tV"Y Ãh AhP۟ v;P0uK AvkShFAhP蘟 h`AhP膟 5=hAhPk hP 5HRhPA u jDAu v t3P5=2 =װD=8tj5=)jj5= z 8=8u-5=hAhPy P0vP0 PRA =P-u.=(0t5Ah`>h hA ;P0t&PhAhP P0e;@Ru;LRtXP Ph BhP薝 h@R Ph#BhPs P0 P0I AA=(0tQh@Bh x=dRt2=P0~~V Kd9UH)Ã=(0t#fB~dBPShBhP~ KxVw Ky=dRu=P0uOhB~"@h@N#h@N =8t8jhA [^_ÐU=8t$=dRu5XRhBhB XRBdR`RTR\R=8t8jhA ÉU=L0=P0=8th ChP9 jCvfEL0HE=8tL0HPjG(AEPhm58] }"}0 PhJChP ÉUhDN Ph[Ch薚 =HNthHNv kCPhvCh_ =xQtAh8QhxQhP5PhChP, hPhChP UWVSu5XRdR `RAEyMb)‰UAEy)‰Uyd%=`(&=  =N/=@ti&v== =tPVhChPA w=,0VhCh |=80t3Vt @YVhCCv=,0tVhDh輘 5\RVzBFhh=Fu%=,0Vh@DhU jVhBL}v=,0tVhiDh =<0t=@0t=<0u Vq\ PVX }z0 PVhzDv`RptppV[ PV[ EPVX WVZ =,0tVhDh\ =<0=@0t V[ `Rp(PVf[ }y0 PVhD.`RptppV[ PV[ EPVSW WVY (=,0tVhDh褖 =<0t=@0t VZ hhVq ‰A|i`RptppRaW P5A;W hh5AP EPV|V WVY Vx0 PVhDhPȕ 01e[^_ÉU=@Nt=@NtÍvUdRhP hP ÍvU VSDžhNlN=@NuhEf=XNlthEJ=8uhA]R81;5N= Fu N P8} 9 u wH 8PSUDž~Kuv H PSEDž|u r Ph=U ҃Hu w=F;5N}A= Fu Nt SeF;5N|vF;5Ngh@NuH u=v4=@N=(0t5A5XRh@Ehݒ ~" PPEЃh@Nj 8[^ÉU=<0uJu u5A u.u0/ P5XR5\RhEhP3 ÐUE jRP5A uCu>t0 P5XR5\RhEhPܑ 0jvÉUUFE F=~/PRhB5XRhFhP茑 jvRhBf U5XRh@FhPN jXUS] Su5Aȉ A]ÐUS] hgFAA]ÉUÍvU WVS=;=}h =P=61;PR} =PR DC9|==u PR=5PR 1=8tV=PvV=P58 Ã=8uB=;PR},~(=(0thtFh PR==8tu%~iPR 9t]=8t)ޅKDvt%=,0tPR PShFh莏 ؅} =+hFhP] dR<t5<t<t hF,hF 5XRhG5\RhGhP =00u h4Gou jPR Sj5= =8tjSc&jؙRP582 1Ƀu ȅt/(q0A Ph=GhPQ jX=,0thVGh! =8u1P0@P0=PEPrtPR PWhGhh==PB h5==EP A8e[^_ÉUS1;PR}!= PRv DB9|==8tPR P5=pPR P5=58[ ƒ2o0 PhGhP jvt,hhGRhHhP苌 jЅ} PR==,0tPhHhH ]ÍvU=8|=8tW58Z U WVS]=$0S{ltJs=l=Vu(=,0th7Hh袋 VS\=V_ShRHPhZH xPh\HvV11󫋅CC C CCCC fC "fC"$&(C(C,,CHTC0XC8\C@`hdPP kuVu 1TClC(S,u uG=v@C %f=@u1=Fu1C(S,uth_H軸 F=FtC(S,щ‰ȉC(S, FHwy$HC C(C,~ FQv1;}DA;|0xu VC3hHE=VtC$C&C8=(0t S[^_ÍvUVSu>upH=VtHPhHhP膈 |t|hHhPb h@hPM 8=8=wT$IhH6hI*58h(I58h@IhaIhP· AH9=tP5=hIhP觇 h@hP蒇 1҃>t+1;}! Fu<tB@;|=A=F8e[^ÉU WVSXRBdR`R\RvExlt'8URtUB;@RuًEH$DJ1ۋU;}5ׁǤ<;t VCE;|8URVtUB;@Ru~E `RUB\RfA@#AtjITR\R>XRI2XRI&hI# 5@NhI =8~58h JhP蠅 8[^_ÍvU WVS]1=Vu ;Nu3_ǃNuIu!5XR5\RWh`JhP 1e[^_ÍvUE PuhP USM] KxvAQKy[ÍvUSU] Kxv BJJBBJKy[ÍvUS]M ht89e0|`st# lt4NwtETPCEvuRQ=vuRQM uC1Ҁ;u]UEPhZHEEU WVS}j/W_ tXƀ>tQv>/uCW+Ãu'jW0WaÃS K/F>ue[^_ÉU WVSuF thKV9N VPSY 6V@PjǰȈF0VDPSu[^_ÉUVS]1svF@t9uuh KSsVh0Kh7Kh F Fe[^UVSu] =<0u9SV/C }(d0 PSVh@KhP =,0tSVheKh e[^ÍvUVSu~thvKVV)Ã=<0uGhSEB }2=@0u)N@=d0V PShKhPe v=,0tShKhD e[^ÐUS]{thKS"{thKS Kc߃SgÃ=<0u5StA }%c0 PShKhP赀 v=,0tShKh蔀 ]ÍvUS]{thKSrKc߃SÃ=<0u4SD }$b0 PShKhP =,0tShLh ]ÍvUlWVSu} =@0t=<0u WJD }uA=<0WV6B Tb0m PVWh L}=<0WVC ÃEPVQ? u3}t-jVYB uWVC ÃuV:B }Ca0 PVWh`LhP~ 1NvEPhL16v=,0t%VWL}uLPhLh~ e[^_ÐUS]=<0u=jhSB }&a0/ PShLhP>~ 1#=,0tShMh~ ]ÉUS]{thMSKc߃SRÃ=<0u4S= }$x`0 PSh@MhP} =,0tShhMh} ]ÍvUS];TRs'St xt@u C;TRrۉ؋]US]v#S{t xt@uKwމ؋]ÍvUS]u h|MhP| SEPhMhP| 0s$PhMhP| {t!sPhMhPy| {t!sPhMhPR| {t!sPhMhP+| { t!s PhMhP| M{uMPhNhP{ shNhP{ SPh&N]ÉUS] J1N J5NB JCth6NRd C th?Nh JI CthHNh J. CthQNh J CthVNh J C@th\Nh J !J]ÍvUVSuV1ۅttCDRrVheNhPz ؍e[^ÍvUVSuVh|NhP]z hP HRHyP vHRtG t/HRHyPs  uHR uǃytniyt1e[^UE PuhP| =00u>hNu)hNu vjvÉUWS]߰Ph $NtSPf $Nhd!j = N| 1e[_ÍvUShO=8h]Sxx 8 Džxx@PjjS8@P: 0tQhS58 ~0"O| u!ORP5$Nh$Oj U VS=8h0O;O=D0t4OP* 8u.;O=D0t4OPhAOj v0; PR 8uhZO]j vj@5$NS Ãt/5$NVu j C$N v80hhO$ ÃulOh!Oh8SV808@Ph$N, N0}V5$NhuOv5$NhOhPv PR E=~EE vE}~%jEPhh5 N7 |˃jEPhh5 Ni7 E jEPjj5 NG7 }hOߤ EjEPjj5 N7 } hO詤 e[^ÉU WVSu>t[Àu5vSH v4%u_t-tWhO"1 F>ue[^_ÐUVSuu VhPhS92 8 SVn[^U=8uhPhPC8ÍvU,WVSu h%Pj]S1 Sh*P ƃ |819}0v)PEP5 N ÃU9|Ӊe[^_ÐU,WVSu Vh/Pj]SW1 ߰HPS5 NF VEP5 N0 h4Pe[^_ÍvU0WSuh/Pj]S0 ߰HPS5 N e[_ÐUu u5 N Uh4PAÍvUdSu uh:PjP]Sp0 ShBP]ÉUVS=8t12vhGPhJPz1VCFKvVe[^ÉUSE |3PuhQPhS/ ShYPvÍvUWS] ߰HPS5 N ‰߰H9t9u e[_ÍvU,WVSjEP}Et}FuWhSSuh_P rTÃEP* }Fu 8Vv}AtA]ډ߰ΉЍ\9v K; uEPhP9`EPa* [^_ÉUjEP5 N~ tEÍvU WVS}u ~< u C0vCNhPWhP e[^_ÍvUuu uÍvU WVSu1U* WEEEEEfEA vPB0]EPa] DžDžDžPRPjhS\ Ã0uhSU q vW- DžDžCQRjhQhT=jSЃ thbUS}o .tT5WPR3 5W uQPhU  R P PBЃ CS@1[^_ÉU WVS}]=8uhW'8=8uJj8@P]b 8tj8@P@b 8uhUj $U8Kv}uNWWP u+8<t }tW!v3/WEPD3PU De[^_UhE Pu~ UhUh VhCVhP\ j+ vUVSu] u#13W*3V t;u=W%e[^U WVS]u1;nu{ou W1؀8tv8,uF@8uP4 ǃuhV:{ 11؉ @Fj,P7 ue[^_ÐUShWhW Ãt6u ujC Ph-WSl[ S 1]ÐUWVSh8WhW螐 uU=8u1hWh:Wj- 1hZWj- 􋅈PR 1vDžWc=8#\8 S8 JhHWPP Ã;hHWP& t8uPhQWcvhHWP ǃt?uWhVW3vj PS覣 ƒt 8tShLW|փh Ã3hPCPR ƃhWPQ ƃǃ PhcP X􋅈Pu h[^_ÐUWVShaWhW= EuhWhcWE5Wv~t8CPFP u߃PP u…u<W^S6h-WEP(X }tWShuW\w E`EPh }u/hWZ uhWhWjv* 1e[^_ÍvU WVS} u ƋWt|VCP u\tWP uA}t'PCPWuWPhWsv hCPV uV- e[^_ÐUWWR WuUE uWPuhWjZ) Uuu uÍvU,WVS]u DžDžDžDž|Dž#vǃ< $HY5d 2Dž5d Dž5d ZfDžt5d |P Sv5d |P/vPPh85d Z 3vhXVS2Đ9tĐPt| SS& |Dž tDž Džtt urPWY uWhXjGp u (u ,u$fPhYuǃtlhY3tBhY+th YjGQp PhYǃth YjG'q v|PPP( }ShBYjGo j US]SmK t@Qڀ:t.=w%1tC;u؀;u R Rh[SĆ XuShBYjBm vDžPDžTELvPtPP0 jj\PjXPGÉP u\TPh@[jAun vR舫 v4%@tCύv;cEPEPEPEPEPEPEPLPhi[S 0t\TPh[jAm 1ɋTuƄ]9fVA~TTDžTEHPP jj\PjXPFÉP0u\TPh[jAAm vRT v4%@tCύv;oEPEPEPEPEPEPEPHPhi[S~ 0t\TPh\jAl 1ɋTuƄ]92A~TTDžTEDvPPŹ jj\PjXPyEÉP0u\TPh@\jA l vR v4%@tCύv;oEPEPEPEPEPEPEPDPhi[SJ 0t\TPh\jA}k 1ɋTu]92A~TTPP觸 XP ([^_ÐUVSu] Sj uShBYjNi 1ۉڀʀvR莔 43ڀʀvR& 43C~e[^ÍvUWVSu( EujjBi u>nu~ou EEj=V"( t@] ;tdװЍxWRV% uы<t<=uÃ;t*U{ tUE;Cu [ +vC!v=(:uVh ]ji v1h ]V"ƃEPǶ e[^_ÍvUSUM ˀ:tB:/uz/tBA:u)؃~ y/uA[ÉUtS] Su&t3EPS" uE%f=@t1Sh(]j@h -0 PSh<]j@h v]ÍvUuu uÍvUWVSu] DžXDž`Dž\}XEv7$_`|v`pv`dv`Xv`P\Ph:5d 2`(v5d  EXhH^SVL'LĐ)ƍth;PsWW\E}E`E }uTW;Eu$Xth`^x EXtuh^w dPh^|ǃtkh^:tAh^2th^jGXe dPh^#ǃth^j/f vEP\PhP3 }uh_jd j誽 Uh`hPH j@膽 U<WVSjuW# ƃPhc@V ÃuV X@)Cdƅƅ PPhcV ǃtV菼 K|8uIx%Dt|Ȇ[^_UWVSuh Eujjc u>nu~ou EEj=Vb" t@] ;tdװЍxWRV uы<t<=uÃ;t*U{ tUE;Cu [ +vC!v= <uVh`jc v1h`V8ƃEP e[^_ÍvUSUM ˀ:tB:/uz/tBA:u)؃~ y/uA[ÉUtS] SuR t3EPSb uE%f=@t1Sh`j@b '0 PSh`j@b v]ÍvUuu u)ÍvUVSEu ~a6h*as 6aD<=D<t 3Ph8as =a;uhAa1#hh`aQs D<;t3v u;uvhas Sv{ tC 8tPsha sha]u3h Ce[^ÐUVS]5u;=lu} u D<=D<t;Xt8t ;Xu8uShab Ku#=thpha)]vpha]u5e[^U<ah<jÍvU<$ah<jÍvU<ah<jÍvUhhbTq Uhh@b0q Uh`hb q U WVS1}uEU BBG}hbE PEPt(}hbE PURt}~$E 0hbp vE XHMP(uU 9Zt 9ZuBBE 8atb= tbbtH=tE p)‹E Pt"=tE p2+‹E P1ҋE 9XuM9HtRE ppV`bE ;Xt p辫 e[^_ÉU<WVS}>hbE PEP襹u"E 0hc4o E hTbj h@f = >u=VE 0艼u=;t;vRh v4%uC;ù;uxtdvvR v4%t)vR肆 4CGu=tSo'Ã=tS)Ã19u =uPSVb= tbP?`=u>=(t5hchctjju Jƃ5Q;uz=$=TE 40袺9=tE 4P&E =tS'1ҋE ;u =uRSE 4b= tbP_==(hchctmv1 󫍅Pjh E 4u u+E 4h+c[ P =7E 0<=t7$v=tS&19u =uPS7b= tbP]=u>=(t5hchc蓸tt ?PF;uPjO [^_ÉUh9cju u4ÉUħ ȧ=ct9cRju uÐUWVS1Dž}uEU BB}hbE PEP t(}hbE PURt}~E 0h@cqi +vE HPPu1BvE H)=X;t@vvR v4%uC;ù;E XtdvvR茔 v4%t)vR 4CFuE PtH=tE p!‹E Pt"=tE pj#‹E P}PE p}u;}E phfc(W 04ħȧ3vu,jE p踷tf9 | DžRW1ҋE 9Hu 9HtRuE pphpcgħȧ 9t P7 [^_ÉUVSj" x hj 轘 h9 =tm=(td55hc)t5jh@Ӝv5jh@諜vUWVS}>hucE PEP-u"E 0hce E hTbju h@ :un=_PE 0@=gGӁvR  4%t*ӁvRN} 4؋Fu=tV/ƃ=tVƃj1;u =uPh=cPVhpcd =u>=(t5hchcױtj5 u TRj蛩 [^_ÉU帢c}tcÍvUS=t,5a=ucPhcIc vhc!= uHj=t5hcc hdG!j讁5 d8tR5,%Ph@db 5Phcdb 0h`hhhhdob 5$P5P5P5Phdb 05nP5 _Phea 5=Ph@ea 5P5Phbea =thhheva he=thhheDa he5ܧP55huPhe` 5SPhf` 54Ph2f` =~AhMf1ۃ;}'v@PhUf` C;|]ÐU WVS]} u>%buChcw+ u<uhcw u7hZf_ &}t61PEPhrf_ e[^_Uhzfhu u1ÉUhfhu u ÐUhfhu uÉUSE] u=h%ht3hflvhcs tkhcs uhRj EPs跤 ƒ~E8tshf^ gh5hPhgX^ =ht5hg9^ h-g}h]ÉUh/ghu uÉUh=(t5hnihctjju GÃZEPj ]ÐU}hviE PEP#t(}hiE PEPt}~ E 0hiV 0E phiAuE phirAUWVSE] @C@Ci~3hiV 3i1t EiuEiCEƿit"CP肤uCEƿit;8|t6CPBtshi;u .jjh=cssEPU h{ E9CtsG E9Et EP0 e[^_U WV}hucE PEPt"}@hbE PURu$E 0h jT vUE DEEE Duit2E8|t*EPtuhitE ƿCj1tҀU𣴧hTbjř Eh@A uEwEajjEPE 4ui}tiPS =u>=(t55E 0hc+t5G=t EH9fEPj U9Ut u4 e^_ÐUWVSjj jj讘 ǃ pÅZS C~jjv jjj hGj螐 u DžMjj/PC Ãuƅ-hCSPk E޺Uj1t tƅ+=ltP+hrx }~)j5̧hXjPW ; jPP: Wh[j@ j ~VC9uPj Wj uh^j{@  v[^_ÍvU\WVS1}hnjE PEPEv$E 0hjP vE phj;}hj芛‹E PEE phj];us}VhhjU hv hjO]SW ߰DE X EE p hj:Fthj)u}uE p hj:e[^_ÐUShjx:u&=uhk h)kJ:]ÍvUShS! tSh.kN vhBkG> ÐU}hIkE PEPt}~E 0hXkN SE phrk9u8=u,=thk E phkE9ÍvU}hIkE PEPSt}~E 0hXkM SE phk8u8=u,=thk E phk8ÍvU}M u uhaeÍvU}lu[jP)S.P |9vPh[jL7 j8t[^_ÍvU}hBlE PEP;t(}hGlE PEPt}~ E 0hQlK E pphkl6USUE plu|lPh6]ÐUSUE plulP$6]ÐUSUE plulP5]ÐU=tjj5jPi=tjjj vU=tXhlh5=t5貮 `O= u ÍvUUE ~0hlI *u@hlߔPhj4Ujܥ= u j>h=t jhjhU WVS}=hlE PEPlu!E 0hlH E pBEu+hlhao Uvv}u h mEx u+hmho 1h~t hj ƃjf Uz tM=uDhcWhn jfVjʍ vh6mhÃ~-)RRh7 E PEHPUBЃ=t  jfVj! e[^_ÐUh9mhu uÉUhFmhu uÉUVS]u u%h`mWjvh_ u jvh_ e[^U WVSXE=tEU<t~];tav11Ҁ=tB:u;U}.$B<t:uG;U} FuFC;uX[^_ÐUS}u'hlm}hvmE PEP譏t}~$E 0h}m6E vj 5̧ Ã= tC; ţj S Ãh5̧h%^ C; thSh^ ]ÉUWVSM1E1U@~<$t<\uRF:tX~0~>@95F:Ft(>ύD(L(A9tF:uE F:tE}t,9tA}t >tF}t9t >k}u9t E\\=E<[t' <$`<\X~SFHF>$F=w%1tfF>0uU:XBA:uH>ύ|+T+܉߉}E;BAE;8u>>,>]}}v>\uF>$u{F=w%1tVF>0uU:tSBA:uFv>ύ|(t/T(܉lj}];tvBAE;u >tFA>t>,t >]V>uhm@vEN}t& >\u~tFF>tɀ>]u>빉F<,E<]N7vF=w%v1tVF>0uU:tMBA:u@v>ύ|+t)T+܉߉}E;tBAE;8uAF>u=\t \Eh[^_ÉU1=tmPhu uYÉUhmh u u5ÉUhmhu uÉUhm}+u2=u&=thmh nC+u $ÉUSE] ~3hn? uGj EPsW щƒ|E8tsh*n? ħ ȧħ ȧuhHnħȧRPhnZ? ]ÐUhne*ÍvU WVS=uhn}hnE PEPYt}~E 0hn> =th ojE p@PX HuTL@ch`oRPN4P%vDP@L4L@tjOyWr vQ؈< u$;LJ~HF@uvNyV v tuЃt2HyP̟  t뮉 uhote[^_ÉU1=toPhu uÉUVS}hoE PEPt}~ E 0ho< ;jE pԋÉփutVSE phoY< e[^U}hoE PEP胆t}~E 0ho < LjE p,Et)EP. P: PE php; EÉUE pp}~ pP&ÐUS] h=cjSuntssh pT; ]ÍvU WVS}hoE PEP者t}~#E 0ho ; E PUP賉uhQpx ÃuWp߰@Pu ǃuh`pjK) vShpWy h5hjjh9cE pWhpc:0Wdv h5E U;Pt p?v e[^_ÍvUUE 02M ÉUWVS}HUzMy11ۋ8t[vUvR\e v4%@t;\CM;CF<uP5اG}} }ǰHU;r װH9s< :u.}CװH9s :t;sF};wr9vSRQSQ S5ا/|u bvX x vhj i hDjEp0 UR&[^_ÉU WVS uE}ЍpH=HtFװH9w&VREP7 u3EPu;uEPu EPÃjEP8uÍe[^_ÐUWVS]j/S( uƅ.ƅAv9uƅ/ƅ )VSSO P+ u ssrsrtHS9wbHPSP u2S6P uhrjX$ PPxsP Ã9P Pu P]à jPssÍ[^_ÐU,WVSuDžrDžDžrDžj/V & uƅ.ƅ4K;/u9w)CSVVM 3=$uh`Pȑ =`tj5`xrq`Džk=ta;uPj/S)% t@v؃PUN uhsjw" vP5`qPjP~Ãqt h%sU3 vPh`{ $p1`;ps{JH9w@HPSP uSPpF`;rrPu PÃjPpÍ[^_ÐU WVSu@Nj_)ÃS7hK ƃ)ljičih=čEi;u5i;ču(P4hd u E&5č4hdJ dč=uEPR0gƃV װЍX9vC~3TvR\  4%t9V D/wr$`svEPhd%U=th@s8vEPhd?%EPhd%e[^_ÍvUWVSDž0Dž,}.h tE PEP=zuE 0h+tavDž444;}"j @PE p uʋ4;u$E phAti/ h8Pw 4L;P0vR[ v4%@tC;}̾;<$t<\CC=w%v1tZ1C=w%v1t|PΉKE9|nE tVv E |7{iuJDž,C0;U}9E 4Vqv E 0<ЍtF;t C;d0/dǃuhXt=uhlt t&=uh~t=th05ԧGЃ=tDt> y ;|vhj^ 8Phu cԧEE 4P;t C;,t00;E1[^_ÍvUWVSDž|DžX1DžTEPF duhtj jhtdR ud`NjhtdP ud`dQhtjb j/`P[ ƃt>u URhu Ft>u MQh@u j/V} \t\\\t \8ub URhu } M QbE Xuhuj~ jhtXPj u X9jhtXQB tE PhuX``t `9uE PhuF/j/`R ƃt>td`9[u)j]Q2 ÃtC`;:t#1 j:`P ÃtC=lt \RVS`Qhv) tڀ:uD}1lOEEtPEPR`P ËtTtWSc P`Qh(va 0B P`Ph(v1 t}tvStp ppO| |u't@tuh/v =tt[t C;Buuss|P螺uBt@tudj"jjj]WssI WhCvK vtpp|PM}Ft@tt|Pm `RhTv vTQ DžTXuEPhhvU RMQhwv' VvXtvPhvh|SJ h PS|P@m ;hshv0 [v|1󫍽|G|9s(jW|Pl ? tӀ? uƅ{j |P) ǃGjhvWC tWhv|1|G|9s-jW|Pal e? tӀ? uˀ uƅ{||vR$> v4cujhvW> tG?u?ttj W& pj pPW,k ==p8}vhh\Q3 l}\Phv 9Džxh Zt&xxPjCj hTj-j xÉjAv h| )hǃht'hQWlP0j 0uȃ=htu=ܧulH# y ;|vhj#U ;5 u;vhI h|P|Pi h=h=ܧ==; uF;v> y ;|#hj#T  x hj mT hH hthw vjFt=thwQxPjg |P2h lR h XtXQ] dP] 1h@w)\Rhv `Qhw |t|Pg XtXPd] dRR] TtTQ_ 8[^_ÍvUj$}hw h_G jh TWULWVSEhWt!=t jj E@vhdj=f hj .f hwb^ hwO^ Dž mvDžDž1DžEU 4g: uhwj vjhtPn u'RPjhtR(  t(PRo`j/S ƃhxS ta8/t\9t 8@uEU 4h xv@hxPf t8/uDžtt8t8:t@t;tÃj:S. ǃt=G7v;[uj]S t Cj:@Pj:S ƃK;Bt3Ft->t(j/V5 t@ 1=lt(RVWSPRh x hiS { Shie =tjj$E]Et?t}E=t EPR`==t'=uAPRS2du#Sh`x E@vjjExEvEEPj"=$Dž1=$tUt>thxV t*8thxP t Džt8>t3u/ExuEEPj|=$t :uDž=u#PuvPhxo t*RVhxhS裩 ExEEu t.ExEPjEPj记 Q)ƒt E@RV E@Eu&E;E}j:EU 4N g=tt jj[^_U$S]jhtS tkjhtS tT;[u#j]SD tx:%4vEPSj- tj:S u1]ÉUlWVS];[uSj]S tA߰ЃPCPhj2 ߰ƀj:v߰HPShj2 ߰ƀjj}1ElOEEEEPEPu Vz ÃtMSy PVhx ub0{2 PVhx ]{thshj1 juSBs ssҪǃ }%[uփhx} =tcvRt B;CuurrW@u([tW] \hxvssWtv{tdj"jjj-Vss!9 Vhx [j"jjj-Vss8 0Vhx Wl] hxKsshW uJx E EPh`W*}hx& <=au1EjEPjjW }h y h$yWw h&yWw  =tuh(y 3=t5h7y j~C=t5\z =t5Bz GvEjEPhhW }=lt hIy  W[ 1e[^_ÐUjq x hj -G h; dO=hOtjhKÉU WVS}dO=lhhTy; u jWhZy uhh`y 7jWhjyx uhhpy VW> x hj -F h: =u!hyD 1vhjY Íu VW5 5hy. 54: ( y%P5ƃ=dOtt jӃSj!Y e[^_ÍvU,WVSDžDžDžDžhjX DžDž1CvHyP u ~6HyPt Sh2HyPt Shhhy5 5q8 UGuF}C=thyh08  ==~z5uq~l=t)tu=u5hz  y;| thSB 5=w%1tDCУtjt%dv!=DždDž=w%1t^Dž t#)ts@-Džv~(u Džu-ut uE9sFHyPq  ==~V5uM y;| tvhSA h~5 u6)ÁvSPh ( ƃt'9t1t (Pj)T =t ui@=dOt"tt jЋ,v PjS 1[^_UEU UUBRjjPj GÐUjidOh z h3 jhCUWVSEURzDžܧ=t?}t9} tU :-tRhWz }tMQhbz = tEPU RMQ.~ v;tj5諙DžDžDž|DžDžx&yhB=(tj=(u=`O|5`OR `OtPjQ |t|Rj oQ gQjNQ Qhj9Q hj$Q u nz1t  uDžܧE 8|jj P |h$y] CSW u?Shpz!RjP |Qj tP PiܧDž\vh$yU R uFM QhszPj P RjO  Dž-EPAPO |E%f=tJE Ph}z RjO Qj|O 􋅐P n pEЋUԣJtRRj=O Qj,O |t|Pj O h{?ħ ȧuztuzuj5ħP 1|-(|#jħ ȧQRAPP }E Phsz"ħȧRPhzNt&􋕐RDžxz}t|EPURhzQjM PjM |t|Rj xM o􋍐QrMQhpztgPj2M Rj!M |t|Qj M 􋅐PxQ$jXjj L | KV1)~VSBPL ǃڃ=h=ܧt =E;|E;uE;wfEv# y ;|vhj#7 EUډEUzh+, hPAPK ƃ=h=ܧt ===; uG;v? y ;|#vhj#6  x hj 6 h)+ }E PhszsD kE# y ;|hj#!6 h* EUډEU=ht;=ܧt =})E;E;dE;R@ @ JyB;B| Rj u5 JyB;B| t  RV65 Oy􋅐Pue  0=h=ܧt =E;E;uQE;wEAv y ;|#hj#q4  x hj A4 h( B @tM Qhszi@ @t.豵8 thzCjSt􋕐Rу􋅌Pf jL RjLG Qj;G |t|Pj G ==jXRjF QjF |t|Pj F =(u=`O|5`OF `Ot􋕌Rd j7tt􋍐Q҃= u=v jW ܧħȧX[^_ÉUj \dOhz hG& jh@<6UWVSE lDžhDždDž\EUzEܧtpuz%EEtZ=tQ}tKlt(}u l:-tlPhWz }tURhbz = t&EtEPlREP 0vDž`DžXDžT1=u E%Eh@4=(tj=(u=`O|5`O#D `OXtXRjC \t\PjsC tܧp:hXj=C Xhj(C \ }u&lƿnz8|jlRFoj/lP*裰8t7薰8 t-lRhsz!XPjB tj;lt{tlv{P豐ƃt/}9lPhszXRjB \Pf=uhگ8 uUhlR1}:lPhszJXRjA \Pv=tsr8 uilRN#luM=t?lP$#lu#XRj2A \PvEu=tLjjx;;tj5WjUR>J t3XPj@ \Rj@ w h@1 Et3ħ ȧt&ħȧRPhzz# }t@UREPhzSt@XRj@ \P vURhpz h$yd] }lnzu$Džhܧ}url8|ugjj S? Th&yl@P8Fh ul@PhpzPܧDž`\FURlPu hulRhszLd Dž`-EPhBP> |}uEE;kvX=kt5k4 u3 kuh{kẸkE%f=tܧj wxPU P PlPh{q EtܧpTtTRj '5 jj5 =(u4XPj4 \Rj4 vdP=`O|5`O5 `O`ththR`҃dtdPR = u=v jFXRj$4 \Pj4 8[^_UWVSDžXDž|=au&hf=tf=uh|,= `jj PF`O}hx =tWt 9Bt Rt 9Buurr5`Ouhxt5j|Pjh5`Oe }h)|U t=to5=lu >|S55gfff)ƒu$th`|說|]>|S>5gfff)ƒuth`|6t-|Sth|b޿| gfff)ƒuth|xPtPUEPEPEPRh|h觉ƃ 1UE% ‹E% ‹E% †v޿| gfff)ƒuth}O t+xPtPpPUEPEPEPRlPhPh&}h諈ƃ0 hlp1UE% ‹E% ‹E% †mxPtPpPUEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPRlPhPh`}hÇƃ`hlp1UE% ‹E% ‹E% †UE% ‹E% ‹E% †QUE% ‹E% ‹E% †QUE% ‹E% ‹E% †Q v޿>|Džt gfff)ƒut h}gPxPfPePdPh}h#ƃ uRdd:BuA:Bu<:Bu7 󥍅tPtP҉P!th}薥ftfx Іf Ph 5`Oy$hx `=t f=`Ot5`O- jj PBy`O}hx=u3j|Pjh5`Ox }h~>= uG=%`j`Pjj5`Osx }h@~c= uG=%`j`Pjj)5`O#x }h@~ Ph 5`Ox} hxqt5j|Pjh5`Ow }h)|Dž\\Ph 5`Ory}hxnjj5`O|:t =u'h|th-j=u&h5jo9tjSihhLu[hh j-" xEPEPhzJ t"xPj! jjjE@E E PtPhzujhOjjl joxPjr! jAhOEPE PhTZ tjj4! hOuz1t t= u j%vuzu= t j=(u6Eu&E PtPhze=(t ju= %PF=(Eu{E PtPhzst[j=(t jj=t xPj =(t j= %P=(h|Sv P@ j S *}hj=t  j j = t jj=t xPj X[^_ÉUVShEP蔩 u@ jVÃ}hp tj*h[^ÐUWVS}j/WyEE1tj9t {t {PAlƃt/})WhszG1h1Wh  Hƀ .!}0u{.uC1CKu7E}dtEC<9uE0Ejh kƃ} e[^_UWVS}=u0h[=t 0 vhhhhySe jjS@P thjhh5肧 5 hS) P@ tGWу j PM*}hj[=t tBGبt#vhSGP  jTu=(u j6j)h[^_ÉU$S]{uu{uoSzufz u`9BuOEEEEEEBEBfECEjPRn EC]ÉU\WVSEU DžDžhjGxD h | à tShh = uhh $ܧ,ا h# u *j/1Ãu vCÃh0V thAP} t ޿Du ޿I u ,hR t8u =,t$8uh`,h Ãt޿u 1ۃPv (tu PB ܧ̃B$ȀlOlO l$}qeYd M d 5) hPRp Đ)( =1lODžPPjP2 ÃtRSf1 PRhd u Ń0 Ph? jb ;ÅtS1{uOdP{t @<qP jr+hL%j; j:0| tN􋕼2,u7QPGPg vh7t j: hdj hj z $ ~BP)P*h؅t"hdj hj  S7Uj*jhaUj)=tv=t/j@PK_51  =`O|+j5`O_5`O `O j=tB=t/j@P^5i1  j~UԁÉUWS}Q=D x $hj u  ME< uu}hځfKySz. EE} }uEP5اHǃt}ujjME<8 t=v!hځ‰}uWS EWj5 $=ԧ0nÃu h)u h { t=uh~v05ԧCЃ=tC{t= y ;|hjq {=p=(t#hnP h hhh ujj2HErhdj hj  e[_ÐUWVSuu1}E1EH HtHA8uv:tCBA8t:u );E~ E] );EuG u E v[^_ÉUWS@ԧԧyÃS5u݁=uč7v=t+ԧ|Hče[_ÐUVS1ۋ5:!t:$uuttWe;u ԧ+  č-:! +v̧< t 2< u,B;uߡԧ+č뼡tt  ̧< 6,< $b<"t0<\uXB;uSԧ+č0B;ukԧ+čH AB;u!ԧ+č;vtr<"u6B;!ԧ+čvAB;u!ԧ+č늉tA t*tt ̧1[^ÉU WVS}6Ã7= t/Ph@{ H&>t= t~ t6SMTOH9rȃSjSxSE E Srƃu Shou Sh v6j h Oe[^_ÍvU$PPPPhhP賕 j" U|WVSDžh Ãu߰Ѓ=v!j?, PSh茴1QShhSmR hS| uw8tShP몉hPlC }ƅj.P}p 0Dž!t tDž h@URBm h@5$m j.5o ƃtLPVl u5)Ph@Rm u+@1j.URzo ƃ1PVl +]Sh@UR3m @ t vrCE 8u/h@ U chj藯vh@E 0> O/U :t2΃ t-P @Pp | ?\E8h@ UhSjvP @P | ?cE8Wh@] U:hjn= _v HyP#  t t̓ tȃt uhƄ5=@A16Àu*vS  4%@u8FG/ HyPR" v u t8 HyP"  V uɃH=u/L@>vVPvDP@L4L@tY HyPe!   u ~iF@u@u"hoh@hޮt: t5$*h裮hJ5 " h h@c|hWh J 5 e" x[^_ÐUS @ `? HyP!   Bvǃ tƒ,t@"/\u' HyP  C HyP v tx"uq\u' HyP\  C HyP2 v t t t t,u=@u1>vC6vpO=pOt h@3 t҃;u ]UVS=t5h9v}hE PEPIEv#E 0hѻ =,t   v}~E p& ƒ=,t0=t 8uh j.R5 RE p衡=,t>E phJBn=t5h` fBABfA@BfABA`dfЧ=tjjE pp5=lu huetaEj hf Ãuj hf Ãt{.uKEhh肹 tEjhĆhre uc= t $ֆֆBfABAt`Qh P= t v$t(j hhd u h v5e[^ÐU|WVSDžDž} u8PEPE PEP}1} t }=1Df@#E u$LPAdu E mE hPk7 u hwhSF ]E m } uK#Åu1LPcttSEPh{vMQhG hjOVD D}u] MM } hu h ƒup}uhEuh١ƒu=uhh藡ƒu-u8t/hhth苦= ue1һԇB;}Iχ<@uܡԇCf05ԧ蚅x[^_ÉU WVSuЍXvhڇsuhY ƃ Ch)PPE uUЍ\~C< uԧ;ȉE ȍe[^_UWVSu}=uE=$u=O5O  O=$u7=u5v=Oh5hhS[B SB }Sh R1vP# t  hh} t= %P7C>t,jjP6ShE賳 J>uۋ Q)ƒt t} t= %PhhLS< OSBH =Ou"uh`p`5Ohh| u5O Ojj h_ t[^_ÉUS]==u Sh h hhPϸ u1yvR( v4ntat#9pu3hoSh@ ÍvU@WS]=$tg}1 EPjh 3u}u 3h=EP 1!E0W EPe[_ÐU WVS==lu uh萛upj h-] ƒttBj EPR\É֋E8tUvR v4%@u*} t=lu h,n=؉e[^_ÉUlWVSE ME=luEuh覚}1 ]ShhM1߰ЍxEu&jh S&[ u E u(tcEPEPEPEPEPEPVEPHM u9EMIM}tE vEEEP= E}u%} u =lt:EPhAi 'vMM} t=lu hlE}u M Ee[^_ÉU=Ou AOEPhwt@jAtE;Ou jÐU<WVSDž}u>jhԇ?ԇ؇ćȇħȧ̇ЇjP?=ܧ==5=5ħ=ȧ SQRPRÅ}1ۃd~dShe+PP;  ~WٺQ)Ãhm)PhSh+PP:  1ۉ vC  u vvB^ u P^PQRh%+P*P,:  ć)ȇ)É؉B}B@Bv;=Ї uV;5̇vNćȇ5̇=Ї~ԇ؇Džԇ)‰؇)ȉB} B@Bۅۅ5h==;=u ;5~*؃h>+P)+ħȧ߭-ٽff f٭߽٭uC?~v;؃h1+P*P8 jhVSOt#PhK+P)#hP+P*P7 jhVS&MÃ<֙R)PhT+P*PD7  QPj3 }uhj j B}u E؋U;Br1 xwhj bЍx;}}BGǃ y;| ̓hj - F;u6E9]e[^_ÉUEPhht@P7t E PUEEEEUEUjEPj}6ÍvU==ا=hh5$?اjdjP 5h j 5اhj5اw hj5ا_hhh&j 5ا@0jh&h3j5ا! j5اjj5اP=uE=t5=اt5ااU,WVSu1ۍ}EEEEPEPh6V uu* =ltVSh8觡 %e[^_Uuu u6ÍvUS] }t3h] Wv Utu*Shj h? EPEu E1]ÐUWVSE@  = !Vh  hI @ED ! EӁvRl v4%@tF͐E0E Wv"u E"C'u E'3ӁvR v4%@u.GFt$}t;EuE␀\uFut FEe[^_ÐUE8^u@€o 1v{{0/s []F;ui=u }thA hOivh99}lh`距 h誝 h蚝 hU 4hE 4hm 1W11;ujhOU 4/Ãuh@hP(n {t2G1{ ~U DP1{ ~U DPCEs Jjh-8Cjh8 shhm/|F;u:;}%e[^_ÍvUHjh7ÍvUuhˋhseÍvUuhƋh|tEÍvUuhhu%ÍvUuhhuÍvU WVSu1h΋VxuhVcE Phs hf hV ^=^tL;Ѝx7A~hԐ 3hא ;uhݐvjh^VЏÃS tE PVhhPk t߁^[v|BA< v9tE PVh hPpk KvE PVh`hPPk +=tjWEиhA 1e[^_ÐUSO=Ot&v{ts3hؙ ;u1]ÉU\U=~,5]jh5!w} h葙 ÉU= thP h? UE(| <$ < u  u =%u9$ < uh@ Nvh诘 jqs2v uh芘 h{ jqsÉUE(u%4u5th@# Lh jr2vuh hߗ jrÉUE(u%4u6th@舗 Mhw j9r2vuhR hC j9rÉUSR=Rt7v{t&C8tP3h hݐ ;ũhݐז hhh 1]ÐUVSuR=RtCv{t2C8tPКtɚP3hؚ hݐg ;ue[^ÐU WVS}E4hVh@ VhhP!g 1E E 0E jhRVيÃS& ut{ t:C 8҉{t&sC 8tRh芕 {tjC!EpEe[^_ÐUjhLTu@ÉUE=tBt8tPvPPh  >t8tPBHHPFPh`诔 ÐU WVSuFhE pLuh΋U r2t_LT=LTts3h6 ;uhݐ j\ hhh'E pÃjhRU rĈÃuE phStU r{ tNE xuC 0vU zt h`dvC {t&sC 8tRh {jCЃvthΒ 1vSt E ph hPc 1{tU rCЃs 3hQU BǹtPƒvC C PP3h #Se[^_ÉU WVS} }hhw訅uh΋w葅LT=LTts3h蒑 ;uhݐz j hhhV 1:vVh Vh@hP=b 1E}v7VÃuyjhRVÃtS+u{ t5C {t&sC 8tRh蘐 {tkjCЃ\S˅,{tjCЃs 3hp!C C PP3h' m e[^_ÐU^jj"d<jj(; jj;ÉU=^tjj:jj"~;jj:ÍvU=^tjj:vjj";jj9ÉUUuh) h΢ 18} t EU E EjjEP IÉUjuÍvUjuiÍvUSh@蘎 U=Ut7v{t&C8tP3h hݐ[ ;u1]ÐUVSu }t hhjhUvÃu vhSOtvhhP^ A{ t&=uhA h΢賍 {tsC1e[^ÍvU WVS}R=RtNv~ t=~t7F 8t h h*? vh0, >uhݐ LT=LTtJ8 tB{u'C PiP3h6Ќ vs 3hB趌 ;u5;}%E 4*ÃjhRE 4kƃ S赁uV襁tE 4hNu u E 4hi 1tC~ t=~t7F 8t h h* vh0Ћ tN;tI8 tB{u'C P1P3h6蘋 vs 3hB~ G;}\le[^_ÍvU@VS]u ~FP~oPh# ~F'hߦ hj2]S ؃ 8tHh~ e[^ÉU=L%Lh衊 =LtPh@} h ÐU$SpgEPEP<-؃jj5EPEP- t"=tuE;EuE;Etc(jf]ÍvU$SfEPEP,ЉU't tvhc诉 hp Ãuvj/Szuv@}~jh!h~PSr jPSrh4 j.jEPEP+ t$=t}uE;EuE;Etb]ÐUWV=tJj5kh莈 5+^h}uE p tjhe^_Ujhhh|@j{Ujj2!ÉUSW=Wt7v{t&C8tP3h hݐ蟇 ;ű]ÍvUjhWup|ÉUVSu }t hXvÃuvh6vS{|us C8EvhhPX 1e[^ÉUSW=Wt7v{t&C8tP3h hݐ视 ;ű]ÍvUjhWux{ÉU WVS}u  hAvÃuvhvS{tvh@hPW 1bvC 9tB3{ uPs G9C }rRhhPV 1vv vCиe[^_ÐUVSut!vVs u u1e[^ÐUWVS@;ts 趿 .j覾 áC;tXVICCV軝 C u 誝 C ؍e[^ÉUSuVÃtES;tCB{ts { ts S ]ÍvUut@ÉUut@ÉUVSuu VhVÃuVh@hP+S FsFjNIe[^ÍvUSt-vs s {t*Phh迁 u֋]ÐUU }tX4@1v=Xt#Xxt9PtܡXXu1Uuu1v@ ÍvUWV=35hu }~E p _]t\hӀ ƬtPhɬ谀 ƬtPhڬ荀 >D=^tu h!h [ =thDB ^tPhe t/ƬtPhx h HP]Ph h^ e^_ÉUjhhhG ÉUUBt u B Bv1j.hPBP ÍvUWVS] Dž\DžXDžPDžLDžHDžDDž@Dž<=t(5h~ uP }x խ ٭fChۭ~ h߰Ҹ)P߰P\ H M@;TM3΋h3q3uMHw3uM]m3uMt;D&Pu PLu;LMvTPh^}PtكD}1E]EEpPuVjDWÃuEpPVjWÃtZSPDPh9hPM B00[ PDQh9hPdM p!ÃDžHtHHt$HQh٫h٫ jhhhGh  uHWMH5jhg @t@P<tCt5Sh9uht1e[^ÍvUWVSuU 1ۉEFVV‰V [^_ÐUUBH;Bs B@J)ȉBÐUUB;t1vÐUE@ÐUUBE ;B r+BB]]BÐUSUM t`zt+Z)É؅|9|Z)ÉB9}B;B r+B] ]J;Bu ;JrBB[ÍvUU;BuB;BrBB )ȅ}BÉUU;Br uB;Br BJ B )ȅ}BÉUUztB;uB;uB;BvBJJ)ȅ}BÉUUztB;u!B;r uB;BvJ JB;s J J)ȅ}BÉU WVS} utSEP9|EPSWEpR SEP )߃ ue[^_ÉU 5ÐUu u5 讨 Uu u5覨 UÉUU8T9u _919T9u=^t9ސ7:֐0T9uth;뺐:T9u :막?T9u 7듉u/5T9u K7s3T9u 7\vÐUjhtPÐUWVh]j T] e^_UEHwx$ȵ8Tk9Tc0T[3TS5TKT BT1UWV0T]^_ÐU1tjSjB/@jS]ÍvUS]@<t tu @t tJtA=^t7%=@t @$$T$tjSja."vu=@t @]ÐUS]`<t tt `'w{$@jS%%h8gt@D^jjR jSp  Q zv1tjSDjN-L`jS9"u3^jj  jj v]US]`<t tu `u?t6"u  $tjSj,]ÉUWVS} t8} H(wU ^Rx,vE ^^E] v;|uEC;t;:uU PB EEƃE}U}|t}:u|C}uK))B} tPWE Piu U: vVEPW?t>}:E<|u CU|tE} t}} EZvUvR z  4%t)UvR= 4CEEU9Bu,ǰuB9rU^E8u6} tU U9sB9rE8u^Ee[^_ÐU WVSu}׋] 9s#WEP3u19rݸe[^_UWS=^^=^t=^^t5^ h2ÃtYEPjSuShl^Bt(߰H(w^S[) ^^^^^@@8u ^@@@e[_ÐU|WVS`d)‰ЃPh`j<]/`ƒ`$dvt`;dc`8T~É߰׍whH9}MhhSjjhhh]S軉 0VShGPEjhu>`;d`8EPEPOhhuujj hhh&uV }а׍_@hP9}!SVh:GPEvh@J `;d`t4 t:t t"D D&jw&o``;dO`=t2&=tI|+=t\v`d)PR`d)PRa`d)PRa`d)PR`d)PRj`d)PRc`;dPt' t=4$`d)PRE `;d`8h8nƒtװH+vjj#hhRjj#hhhj2uV }׍_0hT9}%SVh>GPEPj>*h@G x[^_U} hF ^^E^h~*jh^hjh^j>A*vh@F ÐU}  hsF ÐU} hԸWF ^^E^h>~*jh^h"jh^j>)vhE ÐU}  h"E ÐUM}  9tuz  #^}u #^h~,jh^hpjh!^j>( h@CE j&"USsCC C r㻬jCtC C jCtC  vC jCtC  vC jZCtC b vC j*CtC  vC  j Ct C B vC j CtC  vC $j Ct$C  vC 0j jCt0C  vC <j :Ct<C  vC Hj CtHC  vC TjCtTC  vC `jCt`C  vC ljzCtlC  vC xjJCtxC  vC jCtC b vC =(^u' j]ÐU=(^tj=(^u dqPhA ÉU(^tUEu(^ v(^t PÉUh5 ~Q}t#j h5^hjh7^!vj h,^hjh.^j>w$h@ ÐUS@csr{ t_;u C vC C{tCPCP-ЉЉ%P rj]ÍvU WVSu} >~FjjVڊV:u؃Q9t~ufA$ 9uFFAWvA $9 F AFuA $<t A AAPAP%PE } ft je[^_ÍvUSsrv{t^S:tU h= ]ÉUS1ۺs.z}bztJ:t  rӉ[ÉU WVS11E8} ujbY;] }NUt,t%u tW'EtCt UFC;] |tWjoe[^_ÍvU=th5x h#w =u.h; $J$$$$$'$$$ÐU9=$t $@ÐU WVS]=t;ufjjZ Sjj@Ãu߃jj+ SjjÃunSGƉ߰ЍPt'$D;w$;)׃WR w u2h : $$ )щʉ)щ $St $C$7…|'~=u$ v$$$$Cut$$1e[^_UWVEƿBt_ƿ8tLƿGt9ƿO t&ƿZtƿ^u v1^_ÉUS$)Ã}u~r$$$$hm9~2S5hRCPPj> h8 =t,5Et $]ÉUWVSE1EhFOE=hQh$vh0 u9u0=Lu'=` =@d uh OBu/FOE=`=@d (vu3 u.FOE=`f=@Yd =`u#=@ud jh`=L=`=@d h=`u#=@ud jh`}=L=`=@d "=`u=@hdjh`J$h#hhhhhhc`j %`v``hv=`o=@bdjh`Shhc9-ShhcSShhcS$h ShhcS u !D jShhcqSP jhEvuh+=````tt=``s'``=``s ```d``Shhhh4=````=``s(``=``s```d``|hh`U~P}}t"EPhEE5hǃ5}tEPhr1}u}te[^_ÍvU=D^u1+D^@^jhjUWVSE1EuH}t"EPhEE5hǃFuOE==@^t(@^9D^E=D^D^.t 0T9u!@^jhj:T9u!@^jhjμH9u!WVj豼@^}v9t GNM‰Ӄ t u|@^p=Ht[H9uPt,u$%9t 9u FOE"WVj @^}@^=^t|T9uq~-u$%9t v9u OFEB=(%(j PtRu@^j tv tvt jh jhP@^= u# jh! jhm jhV P@^Vu4jhjh jhhv}tEPh1}u}te[^_U WVS1ht2=Pu$u=^tu th`>1h t =]1Ƀ=,uhȃ=`Ѓ}%PSVRWQOà ht ÃhtJ É؍e[^_ÉUI=jjjj jjjj jj!jj" jj'jjG h8+tjj#T=]t 5]* ub(juju8ÉUÍvUjhgjhP jh6P@jH jhh5 ÍvUjhjh hhh =]tÍvUjh{jhd hhh~ Ujh+jh hhh. Uajhjh hhhÐU$Suh) 1cvEEEEEE]hU)Ӄ9|!SRhCPEPj>S H^]ÍvUjhjh hhhP=]t=Xt jÉUjhojhX hhhrP=]t=Xt jÉUjhjh hhhP=]t=Xt jÉUjhojhX hhhrP=]t=Xt jÉUjhjh hhhUjhjh hhhU$SEPEPEEEEˆE]uE]EC]US]tjjt jj]US]tjj)t jjE]Uhhh`藿t j)k hhhmt jj vG]U WVSh`ǃh`Éރ ~}t vS5`Ã~W=tS5`j>Z9u(9~$)ރ}uV5hrƃ~Sh`I|9ut 1)@e[^_ÍvU1u=Dttt=^t(u.=(t";~t  ÐUS]utP]UjÉUVSuSvvSN  4%t%vS 4Fue[^ÉUjEPuu u軴ÐU WVS]=_t=_t5_衆 tQ޿Ͻt>hѽSm( _tSh`+j 2ShӽhP _`fe[^_ÍvUWVS} uEEEEPEPh5_k =tM~9s.P ;u*Ph5_$ C9rԃE=v ~ 9s!Ph5_ C9rE =_uh hvh5_ 5_$G 5_G e[^_ÉUSMU ]=.u+w4`^QhSQht4t$t1uvt[PQh$5_ 'w4^h+u h. Sh45_ vSRQh75_j =_u#h hI 5_E h5_% ]US1ۍv@<'wP4^h@7w@P4`^h@@PShU tJ'w4^hjw4`^hjShx'w4^how4`^hQShFtD'w4^h&w4`^h Sh `<'wP4^h6w`P4`^h`PShվV tJ'w4^hw4`^hSh'w4^how4`^hQShFtD'w4^h$&w4`^h$ Sh2v Cb]ÐULWVSE}E=u!9=H^{E 8o}E}u uEEUvR7  4%t.UvRI$ Ã4]UvR7  4%t.UvR#  49t E9u}tFEG&>uE)?t +E1e[^_ÉU WVS}u1<811] ;t$3Wt|ԅuԉ];uމe[^_U}%UVSE EEEaP% ƃVEPho ؃VF ؍e[^ÉUVSu$ ƃEPV5@à VFF 1~Ee[^ÉUUE =at5aF aÉUVSu] ~Ph FKe[^ÐUuu u ÍvUVS]1=@nt @nuASHC@;C4s 9t.vC4D9u C9u9Ct@n@uu 5@nut @n@1e[^ÍvUVSuM UFX$tKvt\ ǃ u%Ph(VOhj ǃ u!Ph.Vthj蒓hf. ItSu qvthjhj7h . -t@n@@n@ F v1e[^ÍvUSE] @@$PJ =tDwKt=w2t6Dnt/=t(6=,tw =t"=Xt =t X%1]ÍvUUtjh4jL 8vt@R8<u tV1ÍvU5@nt%ÍvUM =@nt @nv=@nt @nPEE@H)1ÉUVSMA9u 9A=@nt @n0=@nt@nXvjQHA@;A4s vA4DP5@ntjjjj5@n SV5@nj5@ne%e[^ÍvUVSEU @X$t`thj4whjlPjP/tW y ;| hj A6 hjя1۾ y ;|hj5 C~1۾ y ;|hj 5 C~ y ;| hj Y5 h) vwB v1e[^ÍvUj5@nn%ÐUSEU M]@@$trtt3v<%1[ÐU WVS]} uVCHP5@nt1sHVWh@jSze[^_ÉUE@@$t12} tj5Dn2k5@nY%USE@X$@\}tGtijh_P辭uRu he h+( ,t"Pheb h' 1]ÉU vE 0ÉPSƃ hHH= ǃuMW3W C\C` uj3MjEPEPjjl t j?E vECHCDECVhhPM jB vSVhhP/ jB e[^ÐUP@$ ǀÉUP@$@UP@$ǀÉUP@$U WVS}u _$h@C jh@NC h,Pj=jh@C hLPjujjh@B uTh`Pju7jh@B u!hPjj7th,jjkuHhLjjSu0h`jj;uhjj#thjVq1e[^_ÉU,WVS}u EE]EPLB EVSWe[^_ÉUSEX$PjjPjj݉ PjjljSjj贉]ÍvUEǀXܿǀ\ǀ`ǀdǀhǀlǀp$ǀttǀxǀ|Xǀ4ǀ$ǀHǀǀǀHǀǀXǀǀǀÉUS] uhhP tShhPg 02 PhhPB j> U,WVSu }UBX$Eu @t(@tFTF H tF#v}F vtWEPEPEPjUR t }tuuEPF u1%PRSN@>tjjS%{ tC xtjpSl1e[^ÍvUlWVSu} jSÃuhpEPSv}ShwquEt}t'E %PSy}@t5Sh%E$%PSy}tShjVG\1e[^_ÉUWVS]}t E11EPhht@jwtu}} tlthQ t@S8;4t-;!`tX@S8;NEU;VjjSW BCM;vVUM;uBQ)‰@v1PMq1W ECU;s%vVjjSW CM;rދUM;tVB@PjSWx 1ۋG }tlE14t/UvR4vUG@6t8VuE}tw$E1FPxFFe[^_USE1ۋ@@t_vBσwJ$$B2taF>:t>uF9sWRhhPZ  URQx]uDžt^@Pr ƃujjEPC;@PRV U r* M qE1[^_UWVS]CLCPEs tC @uvCLPS%(w{LuCLCPjj HP hS7 *dž t'CLPS'{LS BtBCLBCPHltd@S8<u dtSjCLEEPjjsLSZ! tCLCPXv}uCP;EvE}tCPCPPsLSrCPCTCLEUCPBjRj'S@e[^_ÍvU WVS}u uw_ GLCGPCKC{ s <_ths jWEs  C {}VWB09u CB4 CBWB09Cu B0 S{tsp Sd G Fxt5P@Ѓt%}uhsjWEvVW'VW= FX uV~Lt%vL>^thvLjWD~Pt%vP^thvPjWD~HtvH ~TtvT ~LtvLp ~PtvP\ VP 1e[^_ÉULWVSu}FV trWP% uDžx DžUuRtIt@V8<u )t`U Et@V8<t @t2EPW XuUtPWjvEuEtEPWWt DžftSEuM@XtE;BjV@v3EECCEC ECt F|@;EwE1e[^_ÍvUu h`ju,ÉU WVSuuF~?t8FX)v9t9{uEPE PS*uF9uӃ}u 1EPE PVe[^_ÍvUS] CC C,C0C(C$jjhhj C t1hju6KX]US] {tCP@C{tsU CC C,C0C(C$1]UMQBXt11z,tALB,APB01ALB,APB0jQÍvU VSu^{ wj C PsV)tuCSE jC,PC@Pj C(EMACEE@ SjPQsBЃ t C(C(C$1hhVe[^ÐU,WVSu}^CXt1IcX{,tjV#C,uDEPEPju Vn tH} tu V EE!EPEPju V* E;C vPC PsVրCCjE PC@Ph uuCPh C(EMACEEUP SjPQsBЃt C(C(C$1hhVye[^_U VSu^CXt1{,tjVC,{ wjC PsVttCCju C@Pg C(EMACEE@SjPQsBЃ tC(C(C$1hWhVe[^ÐUEEE;EvbPEPjURbEBE;CxvPCxPstMQanCtCtECxEUuUB X;tv;w@MQ]BvPEPE;w@MQBXPEPuPV0 uC;uu:F FUtmz$tg1ҋMA$8t B8u~@Rjhd]SPVͽЍt:F FU1ɋ]C @t6`EPhySÃuSVm u UB @t,EPhRNÃuSV/ u t,F FMA@XtEPhQEPh]SÃuSVվ uUB @t;t,F FEPhMQÃuSV莾 u ]t@S8<uGEt;t,F FEPhURCÃuSV$ u t:F FMEP]S}u,EPhSÃuSV追 uvEPhEPÃU 1uPuM QSV~Ѝt0=EPhUR[ÃM QSV?Ѝt  F+UU]Mt\ЋM;A8vRE9s$;/tvC;]s;/u)ڋMA89w;]u]C8)K K.K.K.)މuEPIUBuSjRЃ 1}tMAt];Xtu UEP e[^_U,WVSu j/VlÃtY{uSh覹 t8uh荹 t&8t!PVhhS jjjjS u=ahSj@DžjRPP‹B Ѓu utFP‹BЃ=ataKh@SjEPk3aUBxht @hP@ЋUBPh1[^_ÉUExht @hP@ÍvUMU E$LPhiQuovPhQa[vPhQMGvPhQ93vPhQ%vPh Q v裸 vÉUWVS}] u=w%1C=w%1C=w%1tu{|uoEEESE1ɅtOtCyht=QhjEPEPqhB Ѕu$Extt@HUEDEt߰H؍e[^_UWVS}u >t;vR v4%tF>ù>u E zvE@v}t&1}tUBtM;Htu UvEPȳ 1E}u"UR課 Ev1ۃ}tMYt Ut5EEE;Ev_PEPjURXt@ECvM;KxvQCxPstEPXtCtStUCxEUdp]}Ou D>w@MQBX PEPBC:t9rF>t9r9Ee[^_ÐU<WVSEEEEUMjjjj?EP  UjjjjRz  M jjjjQT  E`jjjj3P.  Udh蘳 tRhhS ߰HEjPURk tDž$ h# tRhhS* ߰HEjPUR tDž = t+  BBB HEjPUR{ tDž 4 =t$BBfHEjPUR tDž=$t"$$BBHEjPURtDžMh0hGhSi ߰HEjPUR5tDž v=Qt"QQBBHEjPURtDž.y=`tǾ`󥍽HEjPUR_tDž&hhhS5 ߰HEjPURtDž'vhhhS߰HEjPURtDž+Zv=tǾfHEjPUR=tDž2vh tRhhS߰HEjPURtDž4=tǾ󥤍HEjPURftDž5=t+BBB HEjPURtDž6=t-BBB fHEjPURmtDž9&v=t$BBfHEjPURtDž<h"hhS߰HEjPURtDž>RvM t@Q8HEJѭu DžhhS"߰HEjPURtDž0MARQ`ЃXw DžLw Dž4E t@MQ8 UHh!hS<߰HEjPURtDžI1ۃ=-uvGtt-ttvjjjSMQ j6v[Ut0@ыQ8 v[PjjSEP v[Ut0@ыQ8<u_v[<tSj[Ut0@ыQ8[Pj SEP! 迪 vC?U :tgM 90t40S胳HEjPURSuE M 9u1/E h@jUR[^_ÉUu jh>vhh@jS&6jjjS >ǃltd@S8 dltd@S<; t= v;ht0ltd@S89 w9djjjjIS/ jjjjISH艃ltd@S8 dltd@S<; t9 v;ht,ltd@S89 w 4v9dv)HPjjjIS} HPjjjISg1e[^ÉUhju|1Uuu1UW}Шt1hju.}US]S襘 1]ÍvUUE8t  1ÐUS]@t􍃰PtP1]ÉUE 1ÍvUW}Шt1hjuB}UE8ujjjju1ÍvUS]CURS`Ѓt}wuuu S1]ÐUS]CURS`Ѓt#EP=wuuu SZ1]ÐUS]CURS`Ѓt}vuuu S 1]ÐUVSMu t@Q8H9s:H9r. t@Q8Hu1[^ÐU,WVSE} u&UB E hjӁvRnx  4%t.ӁvRd4vڋMA@E E t 8Pu} uMwÍ@MQBXvPEPPhjURpM YE8unEPUR>uσ}uQ,vssujMQ葤 uEE@\E 9u͋UB1M AtUE}uME@M0vssujUR .EMA\E 9uɋE@EPU2MQ -1jUEEPEPjuMQ 1}tEpt Ut=EEEC@;EvaPEPjUR+tEAvEC@;FxvPFxPvtMQ+DFtFtEFxEUu}t)Uz}tGtWuMQx }{tssV[ s}tUB}t }O) v})1EM}t1}t {%UBP1MAE 9uVtWuV +EPEPuURbMAX;EwEAXA`iE @ E+uu1}tUrtM;NtuKUUB;FxvPFxPvtMQZ*FtFtEFxEU0vUB;Ev PEPMQEP*EuuUrrV tMAWuPLj Ex+EPURuMQDuqUBX;Et5EBXB`*vssujMQ u:EE@\E 9u̓WVujUR負 u MA\11}tUBtM;Htu U EP蔃 ؍e[^_ÉU WVS}u Ehju ÃujjVEGGCC {C,CxCxC|uǃtEa f}%t&SH)t&S )t"S(tMt|W ujjShujjVO~W SV~u; SVjuSVqu E1Se[^_ÉU WVSuN t1>t6VB9u FB FBVB9Fu B VV)rVit u3~$t-^$;t3r ;uv$\ ~xtFxPgt- t @t􍆰Pt tP_t t V?Vz e[^_USUZKC 9t9tC9tavC9CtTK9u AC ABC9AuCQCCA9C uK CHKv1[ÍvU WVSu]ExLw4EPURum}uEt`jUR^PE t*u}tFU2:Fuy}tE0UujR E@UuPEPjjE>Fv:\u B9uBKBAKt9uB}tE)Uu}} Ut PEPEPEPSVEPbU@t U E1e[^_UwӋMAS< t%MvUB:Rw u )<~ N9w F)SWRn 9u9)u} tAPMQ Pn thjUR10} u ATtPEn [^_ÐU|WVSjj+EPHt vUt@ыQ84 EVuhBxuhVjUR\Džjh Sh)Sr-ǃsjGPjjMQ.n v ?WhS-tpjheSuYj S[ƃtEWhSu-t)jhQS^uj Su%h@PjEP3vEPPt!8u􋅜PYBEPGPkPEPPh`%Dž W􋕘R.uhk@%􋍘Qz1x[^_ÐU WVSjj+EPt vUt@ыQ8 E||Ruuh|QjEPU RDžDžDžtDžxDžDžpvjh S#S|PhhpRC jjpQIǃjWjjEP k trMvDž DžWhS trjheSfu[j SƃtGWhSt+jhQSuj SÃu hpRjMQEPPƳt'n8u􋅜P/vPP EPW@hxt;UxtpQ<xu!jjEPљxv􍅠Pi<tu0jjUR蔙xQ] xt HtV] S] Et􋕄Rg vWg 􋍘Q赁􋅘Pvxu!hRjMQ tC~hjEP蟘9~h@jMQ{jtPE PURLt8xQ\ tP\ 􋕄Rf /MAxPPHTuU JHX@1X[^_ÍvU WVSjjEPdtZ,1t&S>PE P+f |4)ƅuh PPf Ãu1hEPju艛[^_ÐUVS]uE HPSVe t'j Stj)@RPVf v1e[^ÍvUVSu VحÃuhujuEPV؍e[^ÐUSEPhm软thhmju螚-u hmhhS迬 SxÍvU WVS] }Et 9rn=s7u VOY VSZ Åujjuƕt)PjR] 7 1e[^_U VSMU uEPEPEPRQst}%Bv}t7;]s2U)U vBEM}t E8 t8 tЃ}uH1e[^ÉUS]j/Sgt@؋]ÐUVSuFP1X Ãujju赔tVu Sm] 1e[^ÍvU WVS} u]iSVWh7UN8u !v78"uE8u v1e[^_ÉU WVS} u]SVW bU8u 5v8"u&E8uU:u 1e[^_ÉU WVSE0~VtKss sVЃ;tCBSs W SW _luTtLJLJ# Wt@%PjV QWVUV t!ujvLVV<t4@V8<u 4t@t@V8<u t@FTSj:FxPV: FTujjjVWiu,FTt h*V誟V- jtjPY VxzuLJ,LJvBBLJVt TFTujjjVhu)FTtFTh.jVT|E01e[^_ÍvULWVSE@E܋UUM܋I|MăytA ]܉Au@t,ELP}W/uGPEtU@ Mċj3jȃQPjX u V}W9 EF1~%vUċB uMB /vSC  4%tuFNuEăx:u"vUJBB:tMăy"u4]Kt CC8 uuċF8 hFNVEăxtIvUċBvSB  4%t MAIuË]ă{uJtuu }t.EPb&U܋R|zMf}ytyuA8t ]ĀEPuV}WT}A~tDUċBvSB  4%u:u MAIuE]ă{C8|8 Ph>tsuCKz}ċ}EăxtCUċBvRbA  4%tMIAyuuċ^+]uhIj}W&U$M8EΊ:uAEE:t9lt9pt9+t9-t 9^t9#uk}ċG)ȉOG$8ljE@0bEMvR-4uS}W'UĉB uSu}ăt!GEH@xt UċB9tMċA+EP]SQuVH3&}ā u E@(/Uāz Xu MA(]ā{ u uF(}ĀKE@ UR( x`u#Mu@`YLCXdAPuĉFh}ĀEt@MQ8<u]tuĀN} }ĀEt2UċB @ u}t MċA 0hj]S܈vuċF @ }uEE}ċGG ht t t   |Eăx@8!uUBJJ}BBMăyv]ċCvR><  4%tuNF~u}ăG8+wGOGEEȃUċBt tA[vwӋMAS<t#=uF:Rw.SV[u}ăvEOGG,vS_;  4%uE@EUJBzFMċA+]ȉ]؉Auā~ t~ t ~ un}ċ}vE@EUJBMăyBA\u*yv$x uEIAAuA 뭐 u}ā t  H EEăxvUċBvS>:  4%tEMIAyuuă~|!s~ t }`}ăSG8 GEH@x2UċB8 u"Māy 8 ytC]ċCvRv9  4%tuNF~u}ċGvR59  4%u UċB8|u+}ă$8 }G({ $G cUăztXBBJ]ă{t>uċF8\u~v FNv}ċG9uJEH@xtuEUăztB8 ȉM̋]ċ[]uă~}ċGt tAvwӋMAS<t#auF:RwRSVHXu@}ăv7G@E t|uCEUB EԋMIA] t|u ]ĀuN}G}EH@x,UċJAMJJ]ZBB)ʋE@)‰ЋuĉF~ h uMt}?\uEHuUċw tV=MċA`: t/]C` tBEPuVBg}uCd}GLUĉBdMAL]ĉCduFP}ĉGhvE@`MċAlQpˉCdShuă~`t}ă`G`Exu Gl!vEălPURyfM tyluAd ]CduFpFh}ċG`G`ExLuX tOEPURe5}uGlGd&vMAL]ĉClCdvuFL}ĉGlGdUBPMĉApAh)]C`CdShuĉFlVp}ă`6Eāx @`UJLAHdJL@t8@]S8 ȋu8}ĉGlUBPGpGhEPRd<}tUM;QLv Gl9vWl]C\C @ E8u>!u(}ăG8!GOO}Eăx.vUċBvR3  4%tMIAyu]ă{uF$0}ăUvUċB<^t8<+t* <#t45v<-t )v]K\6uĀN}}O)EĀH}UJ)MĀI}]K)uNF~k}ăvUċB<.t,<+t2<-t<=t<<^t,}vMĀI| :v]ĀK|@.vuĀN}"v}ĀO|vE83>UĀJ|MIAyu#]ċC8+t8-t 8^t8#uj1uVȲ}ċG=w%v1UċBBQBJJ|EMċA=w%v1u ];+luċF8+t 8-X}ċG8-uO|UċB8+uJ|j EPMqEP }u ];0 uċF})lj)FEFE8auFlVpMĉAdQhEAdHAl E]ĉCXuĀN|v}wwWEP'EPEPEPURMQ w }d }% }tu]ST` EuĉFT1v}ăt+ %PwwWEP% 9UrrRMQ]CKuċFEE~}ċGt tA_vwӋMAS<t#AuF:Rw2SVOu }ăvOGGUBU8vS/  4%2MAM]KC{>E+EPuuV}W#~IUċBvS.  4%tMIAyu]ă{CEE{vuċFt tA[vwӋ}GS<t#=UB:Rw.SRLNuMăyvIAA]u}OGEqE+EPuEPUR"NMqqQ]S'Eu>NЉE~ou }$UB$;EvM9w@]SBXuP}WKPUċB 0hjMQx E];uă~tI}ċGGvS,  4%tEHu‹Uăzuh)MQHt!]ċC ph,juV@xav}ċG`lu2uyEu udjjUr MQ ]sluV\u7C|u jjjVEP}Wl\EUĉBlMăydu3uR]u u=jjuv }WEpdUR[ujjjMQU]uu@}}G`tNUBLlt ;Glu ~twMċQlu]SLCP؃PPRSFuFL}ădt ;Gdu 6t/EċPduMQLAPȃPPRQ]ċCCCCut/}GLEUGPBjRj'WPt6Et@,Uztu R#]Mf}Q]{t>t5uTu)u y uj}WU܋|ЃMĀ]ċC SuV@Ѓu+FTujjjVLu-FTt!}TVEGUt RyMy]ă{\} C\9ALwjh@jQtuFLЋ};G\s jjjVUċB\MALPQXuhj]S|tvuċF\}GLExxLUĀz|}fb|Mtfa|]C|%6uLuu@t@V8<u v}tE@tt&UBLEE@QPPMQR[{ }]tu؋}Ȁ|7tZgvE؋UȀ|wT]CS<t0=uV}؋MȊD9:Rw$PVGu]KCCuċF+E؉F}~WURP; @MċAAAA]11ۋuF@|aUBPwH$LuDhjMQvu(hjuVhr v9 vEċEąu/'UhuvhjMQr5vh]sjuV2vjjj}W PjjEP UăzzMċAAtt>PwӋuFS<t#5}G:Rw&SWEuEăxv H@v t|uUăzvB MIl]ă{uE܃耋u9F|th@j}WqWe jEPlNthjURpEEMǁ]Ee[^_ÍvUWVSu] EC`{C2'$~ ClPVT{l%CdCpChC`15~tPC`t5t @t8FLCdFPChC`"vClSpCdShFLClFPCpC`C8;u9C`tt )t!6 vCdFLCh ClFLCpFPCKEPEPEPSVz E8Y}tqC`t)t Qt3IEUCdShC`3vEUClSpC`vClSpCdShEUClSp1C` tvtgFLCdFPChC`jvjjjV wjjjV gjjjV WYjjjV ?ClSpCdShFLClFPCpC`{`u!Cl;CdshjVmE1e[^_UWVS] EUMyu:CPhZtjjjEP UC8$ ME@PURQCMj EPsEPƒtRj]EMACU)‰)CECM{uhjEP_ljMQC@PEPaiCC{vCx/t)x?t#hjMQlECKCh8/u<hMALMMAPMAptpPEPssEPPMQ҃ uCU)‰)CECMEUBPMAzLu-QROt E8t UBLM{vaC@=w%v1t8C+6CvR  4%t CK{u1{C=w%v1uC8+t8-t 8^E8uUBLMBPA{CvR  4%tCKuʃ{TC=w%1uC8+t8-t 8^C=w%1uBC@=w%1uC8+uFvNKCC8-t8^uCK1j EPsEPƒuC}}}4);E(!~}~);Ert Rj\vt+uvuCM))CECaE8tEtA}؋U;v/hSU9sjjjMQ=U21e[^_ÐU WVSEPUvEp|9u'UTvL, F=~3FP^tFBVVE+ FHFVL RQP/ FLFCUBLFDCFP t1e[^_ÐU WVSExvCPtVKƉ91uAC@AB9quC<QQ* K<9uƃsH* ;tCBCSk* _|9sG|@1e[^_ÍvU WVS}1ۅt_t Ut.1EE@;EvMPEPjWs1E@;CxvPCxPstWMt_CtstCxEUE0Pu V. hVjWui 1tGt;ptu U vVs) e[^_ÍvUS1ۃu u]t=xt= u؋]ÍvUSUE |!t1H1ۃPRt = ؉؋]ÐUWVS=t0U:%M:uΉ׋M u ;u1[^_ÐUS]U MEt4rtt&jj}vhnh)b{uj1tPSgwb$4h`.EPSwHu;}t uhhjSc* v2hjSuc]U WVSU Bxu5jjEPѶhjUR/ct* U BtPTvR  4%u*U BtP|_thjEPUvU Bt;t9vR v4%C;uȋU BtxpEvRM  4%u;_uE1SvR  4%u{_u9}u^CNzjjE PtBpB0p0jjUR`u7UBT1+vhvh@jURaae[^_UVSuE @tFTtjs3VHth3jVNev1e[^ÍvUju u2Uju uUju uUWVSUE@E]{ujU B 0Smv] {dExLBwtOuHU zdt?jփlVӃdSjEP! !jVSUR  ] {S[vօt > tFKu9uuIEt)Ѓu:.u Ft`KS)PRWGjUR@ t"FKujhWGjEP@ uhstU rE XUEjPU􋂠Ѓt#j] C 0EPbvU4thRljh]SmPSl hSlSm E @}u5U t@ӋS8<uEtU<t4@ӋS8<uE4t@EE@E@QjPUR5]$ssWGjEP? E9u֋UzLujRAt ]CL1e[^_ÐU WVSE xxu&Uz(t B(xuhGjM'E thxxuJMQ(zHPrU RMQiE PUR<M QEPvjU B|%%PMQ*E xxU u6z$t0Z$;t3 ;uMq$ E@(jU Bx@P˴MA$ujjQ9\vEX$U rt&p0MQ#tŃxuUB$B(0Rt1ۋM3UB(pRjM@tH  M A}t$RjPEP-tUB(M1e[^_ÍvUVS]u EPSst juS.uHFt0u ƒt F}$%PjRuOt jusu1jVS‹EP$P(EEC1e[^ÐU WVS]u C(;C$uhajSEZt3S(zHPrVSWupVS9ijF|%%PS.'uCC(pS t- F}t$RjPS7uC(1e[^_ÍvUVS]u {$uhjSlYjjF|%%PS&uGC$C(0SV t/ F}t$RjPS u1ve[^UWVSu~$uhjVXEEE^$;v;HM;^(uUF8H9ErUEh}tEhV1fE;^(uP3;^(uPhVeF Tu+jjjVl/u FTu ;5hVe1e[^_ÐU WVS] tCxj@PEujjEPWut4u4}HPEPEPqt:1=[t'vp0EPCtփxuEe[^_ÍvUVSEu C$jPf CFtC$Fx1e[^ÐU WVSE}uVP. S$CVW0U S$CS$CpC$CU BtC$Bx1e[^_ÉUWVS}1ۅt_t Ut:EE}w[hEPuWݿE9{xwhCxPstW豿tuCtCtECxEUEuEPEPEPuuuE PW0t91҅tWtE;Btu Uvu v}tX]u9s5vR@ v4%tC9r9tuuE PW51҅tWtE;Btu U u- 1e[^_ÍvUWVS}1ۅt_t Ut6EE}wahEPuWIt(EC{xw&hCxPstW!u yCtCtECxEUE EP]EjEPEPEPSuuE PW0jj4Wpzijj5WXzQ|tt@W8tE];tcvvRt v4%u2vRF  4%uC;uEXuxt&NCPEPއt~vR v4%uCvR  4%uPEPbuCNutt0]EuSF;*uEPE PW 2EPEPEPWF tuuE PW<Ã1҅tWtE;Btu U u% ؍e[^_ÍvUWVS}EEUvS  4%tEOu̅UuEME t tAKvwӋMAS<t#-UB:RwSR\%u vEO+vS  4%u EEOeMQEP1MQ$AMHMA}tgvE t>tGF>wMAS<t+*EP:RwPUR$uFFCMuMA$oUBM AtB$Ax1e[^_ÍvU,WVS]E 0U$EEE}kU<# lu8EPVF#t }uGlGdSE0EPGlPGdPWV/!UVL tFPFPPRV脨 vEFPuhDVK1e[^_ÉU WVS] UB@Xt)C}u#B @8/thjR=vCxt thvh ubFZPqƒtztB8uhjMQ>=hRCt  vPZu 1+v{xCt:/xu :.xv!8.ux.ux/xUHt@@ыQ8 E@vF>t>:uF9sjQRh+hWR WYu/hW- h1WjEP5@V>xhORjMQ @[^_ÐU WVS}8u!E PW(t  v8U Btp~4vRpv4%@tNC̅]~7vvR,v4%@uNC̀;t;0vRv4%@tC;ũEPuh%jW:SU RW@Ѝe[^_ÉUWVSuh% E }ЍX1t~t Ut/EE;]vVSEPjVףt"E=v;_xv"SGxPwtV赣u GtWtUGxEUCPEPURn EE8tPU RVQh%EPOu1tFtU;Ptu U EP1e[^_ÉU|WVSuEU ZxHPVRUR7E 9Xxuhv%URCU 9BxtjVEPbU Bt0EPVQtVjEPz8fE%f=@uVh%Vh%hWN EPWwQtWjUR!8 Dž%!j/Vyt ЍX7PjFǃujjUR7G4G_ SVPh EGWEP ujRWEP.uOBtBxxGWURtjWEP1Wsx[^_ÍvUlWVS} h%wh%hSLM EPSO uЃFPG,ujjEP63vjjP kÃ|Vw,S 9t0h%PjEPu:S S G,1ҋG,8tv8:uxtB@8ujBPXG(tnÃh%w,vh%j,fu1ZwQG,jj‰W(t G,1,tw,G,[^_U$SDžBRzp|Pdp}h%jEP/ZU Bt;vh%jMQ4t xtp t xt p vj Ojs O jsNs b EPU rh%hSCJ0jSh&h&h&6 h&SjMQ7jK  PM Q$ h&pU B Bh&M A1U,WVSE~uh &jP2vEE96urj jBEÃXUZ j,jEHMAUZ9Y uQ MAUPEMAAEPuUR9ǃMI ME@LEURPUEy}M ЉUE^trv MGPuhB&s s  EPWSEP_t(}tUR WMQl]u}uhH&jEPp11IGGU B|%%t,PwMQE@EPwUR96u%M1q9vuN vUPMEw9vu~x>wWUR) }t/MQMA BEPALB MQMAPBUBMHBUP MAUP}tMQ}t EPe[^_U WVSu ]JvRv4%tFύv> VvR 4%Ea&=a&t'a&:tvEE8t:uU:uQha&>w@MQBXvPEPDPh&jUR /vNM~tAEvR 4%t EU:uNjM9uhB%EP51U:"zzu}RvR 4%t2MQvR4 vEPMA@t8Put@PUxv}ЍxG#PjFÃujjUR-tBCCC SSCB OKCWURPHCD8K1e[^_ÉU<WVS8j V=btVE ph&jUR- M qhV4PPh&VxSuvE phVj VauCvU BHyrvM A5 u+1\vtS t Kvt+AװHvRF!h&PAuzmϰЍXPPPRM QEP u& u Dž1ۃD0PjqǃG(Gt+PW/BGRRP]GOt#WBW _$CPPRUMA G9QuyUB 8My EBU RMQ1ZjjEP)AU B@ t eM qh%jEP-jU RMQ[^_ÐUlWVSuE x(?trUR7h%hS? EPSBu4U?HEU ;B%U?u[^_ÍvUuuÉU WVS}u tQ>tLVÃuVh&W6fs3h'W6s h'W5Ah$'W5"="t!s3jh6'W5 ;u1e[^_ÉUS]ut:PjS]ÉUVSu] Uu9~Yv@t9uuRh`'jV'{tsK{ ts 7jEPs;tCBS{,ts,{(ts(S1e[^ÉU WVSu} {th'WVt1e[^_ÉU WVS}xuh'W64+XtssVh'W4 Fu1e[^_ÍvUWVS]} u~ u(vS u wj@vFEWEE@jjv$v PPSBm twjS2u ǃUSLCPCPPRS:1e[^_U WVS]߰Ѝp"="t#vV7SYu ?u1e[^_ÉUVSu] CHys Ct >uЃujSVl>CHys>uC9u CHysj bC9N1e[^ÐUVSu] ~ujC 0V,ejClPCdP1C|tCQPV5 ujClPCdPVuCdFLEPVuFL;EvEFL1e[^ÐU WVS]U BtctV btstktBtx0*(HSBtx wm02(Hu\SgBtxwE0>(Hu4S9?Btxw0F(Hu SGj B pS軭e[^_ÉUVSuF@u! uhK(jV"!vF@tyvC=w%v1uJC9CtjSVFTjjjVuFTuF@toC=w%v1tBC9CtjSVZFTuAjjjVGu FTu"uF thi(SV 1e[^ÐU WVS(U Btx(PEu7M ywA@MQBXU BPMQdPh(EP.U z_wNtw;w@MQBXvPEPPUR.MATuLjjjQ%uUBTu*Csh(MQl.?E 9Ye[^_ÐU WVS}U Bxt tA_ t{}jWRÃ1ENU Bt0WÃ1EU Bt0W v?vE t VSPWgZU B|%%PWu2E%U B}t PjSWu1ve[^_ÍvUVS]uEPSs`t juS2u6}uEE @}$%PjVuet\juubevUCBE@Ep EP C @fBUCLBLUCPBPvjS‹EP$P(EC1e[^ÍvUS]E {uj@ 0Sݨ?tEPSt @dEuh')Sa+1]ÉU WVSuU ~ujB 0VkBxt}up^ Btr0V褈ǃu`{|sVs{c?KFjV rVЃ vjvLVz$1e[^_U0VSEMQMQ9ujj4EPCt FEEEUBE} tRX} h)uEPW}h)jMQWh)uEuh)jEP,KBƃtvh)jUR }tuqExtpZ}tMQuv}tu/Expv}tjuu6j]sb6jsU6 }tuExtpuu j/Epth@MQ8 UhPQu.Mpth@Q8Uh@jMQh)PEpth@MQ8 UhP h)Mpth@Q8 UhPjMQcja2}tuuyE Hwy} uu\jEPEPURh)MQ- tEEUB\} M9u EUEMvUBHXEUÃt tBh)jMQEu uESuh)u u j41jjjURMQPh)EP4P1u9} u URMQ,t?E6jEPEPURh)MQ}, tEEUB\jjh)SMQD tE}uH} uBjEPURjMQ ujEPURMQht E"E8v0URuM UB`X1ۃj1} uM%PEPVURCu}t؍e[^U WVS]u jjuw,SI u@EPVS u+CTujjjSuCTtF @th)jSV1e[^_ÉUU B}PRuÐUju uUu^EujjP avU@uojPjjRb tE뻃jEPEPEP)PVMQIb uEǀUBLEUMAPBjRj'QMhjmƃujjEPOFtFBVvV 7EPURaEEdEPEPjWMQ EEEEEjEPjuEP蒍ƒ t t}%}EPRURi^@;]tG9C uC ZjjjÃujjMQ;{ {EЉF@CU9Vt1uuJ|UWVSjjh*EPEPo v!uh*URMA@|xt Q}Eh*ƃt1jjHPVh*UR h*ƃt2jjHPVh*UR h*Cƃ>h*Vh*h@S:$ jjSEPMQ2 ttrtOkh*Vh*h@S# jjSEPEP u+SURv@PMQMUB@|xt R>|MEt@MQ8<uEjjh*@PUR4 r tMjjh*@PMQ u\@;Eu D;EtFh*EP"@;Eu D;Et"h*UR9t vMA@|xt Q${1([^_ÍvUWVSu dPjjjjj6lS HPVEPS1SEP hVdPVURƃtrt#9WVh+WVh@+jURWVh+jEP[ tk1}tUBt;ptu UKvV:tr t.Wh+Wh ,jURWh`,jEPt,1}tUBt;xtu U vW[^_ÍvU,WVSExu"jU B 0MQ(,] Cd@PEPuh,jUR:1ۃ}tMYt Ut=EE}wehEPj]SqsEA{xw#hCxPstEPqCCtStU܋CxEUM A|tAl] Cd;CluClEEEE xdPlU}EMLM1ۃ}tEXtU;StuCUM;KxvQCxPstEPpCtStU܋CxEU(M;Mv QEP]SEPpSE܋uu1ۃ}U B}}vMQ診v4U%tG}EvRj 4%ME뻉E8)tnMQh,;t  FE FE}tkvEvR 4%t ME}uƃ}t(uuVmUUETUE }t+EH)؋UBPE+E+EH)؋MAPG;}w)EPEPjW]S> OE xlU BdMALzdZl]9v"vEPURPu)M9}w}uW+EPMQW]S7t<1}tUBtM;HtuU.]Sv1}tUBtM;Htu U ]SUBh@M QdYl)ӉЋMAh1e[^_ÉU WVSuE @}tU Bxtt:DjWV|W ]-uD-PjVU Bt3v;#C=w%1Sv=w%1tBۍv:u{j WE PtBpB0pSjjVQ0t  vNt,E PtBpB0pSWVv1{;wFS%vV:RwPV1 ttD u?;w@VBXPVwPh-jVB*vjWE PtBpB0pSjjVPe[^_ÐUVSu] C}tPCtr0VRu1h-Ct0jVe[^US]M {ujA 0S=7vQtxujAdPPSvh .jSP]ÉUlWVS] Cxt t*E.'vCtEPEP!svC}u*EPEP"uh.EPj(vhhEPN5ǃh.W_Ãu}<0Wjh.SEP VC @jh.SEPUurC @uljh.SEPUuTC @uNSEP.u:C @u4St ;0.vh.EPjEP13;0Sd;0h.EPjEPe[^_ÐULWVSuE~ujU B 0VU BdRhẺUЋU BlRpEĉUȍ}1EEE];]w }䐃WjjSVE u:C;]vMU BTE܍UBjEPRjEPV: t Ev]+]]ԉ^LFPEP荪Ee[^_ÉUtJC4Ev4vEPHE4F4 uEG>u}t EP e[^_ÍvUSM4t"A4S4RjQǃ41]ÉUS]M {ujA 0S{GvCLEUCPBjRAdP1A|tAQPjSK,uECLECP1v]ÉUVSuE @|%؃SV訾uSVOztt1e[^ÉUWVSu} FEGxt trEovGt@E;!uFCHEEdt\@V8<u .\t#j G E vKv~u,jVߢjjPV-}}WxUjEPSWV hU;Wxuj G pJGxHE{ts莳GtU0̑Cujj}t' t_GtU0h1VXAv tGtU0h1V&h1V~Vut-jVUЃtjG KjGtU0EPjGdPWV @UVLtFPFPPRVZX1vF @EEPSWV Gx~ tvvOtQEF @%f=u[rA0VXÃtF p跱F XF `?F H VjF pVЃ0URV/jGt0Vwh1EP{ÃtEPCPth1URjV뱍vE%f=t&f=t S7h1jV{|jCPjjV uEPh 2jVGjEPGdPSURV4tGdFL}tFL EGdFLЍh[^_ÉU,WVS]ESUUEEB20MAQ9uYCTjjjSu CTup}u$uPWSUh1uEp,VjSq UUFEEPEPSsDUB @Ruw}tUE}u_EPE PSǃUREPWh`2jS0}t*1tCt;xtu UvWۮ1%h1U RjSEP }ujjSUhЉe[^_Uu_ÐUVS]E Vxxt @t1PEPS迤tt EC1e[^ÉUMU B|% t t t%1 j B pQt PrXQKÐUWVSuFEX9uh2jVvEEErC xHMUF8H9ErUEh3}tEh3VC pVwEE9t3FTu`jjjVٿbFTRFTu-jjjV覿u FTuh3V1e[^_ÍvUS]E uh`3jS(xxtPSduSu1]ÉUVSujj4V@UhÃujjVf-C CCCC\Pj8uh3vc`cdCTPhht@ju h3SvCTPC\PCPCPCP` u h3""t tLKvh3jV{ts{;s+vjh3h3jh3h3 jh3h3yjhat s stjs jsjs s<pth@V8hj/S_u@jh3PSWh3SjV jV'uFT 1e[^UWVShS>pDžxxFUlB VjjSlA@P t.u)h3jEPh3jURp)¸)ЃPpQlptu&h3jURmvh4Wvp;p;wMAS-vEP:RwPURv1t uFtPMQM+)PWtjEP {C;p]9vp)SWV5މp9pDžxx@PjjPlB@P t.t%Wh3jMQQp)ÉptPEPAu#SpRtjMQ tEP SPURX[^_ÐUh4jW4}1ۅt_tE;CtuAUEE;CxvPCxPstWIt;CtStU؋CxE쀋U-EE;Ev PEPEPWIuoE؃uuEEP`1EEPURuW tE}t,1tGtU;Ptu UEP蜣E܍e[^_ÐUWVS]{DžthEP7DžxDž|_G9tTupt7@ t9P~ @t;puxPjjEPt@PO tth3jSL^1]_G9uvt,@tS&uG9uX[^_UWVS|PEP}1ۃ}tUZt UtKDž\DžxxwphxPjMQ8GL\F{xw#hCxPstEPGCtSt\CxxU\Dž`MhhVhput!u5URDž`h4jMQƋ\9;wMAS-vEP:RwPUR蠰v1t u4)dQW||jEPB l{C9s9)dtPRWMQt tDžllFh]S4hB VjjShA@P=0u-dPW\R-\d>dQWEPt vdRW||jMQ uD|UBLdtdIJP E@PjURU`1}tMAt\;Ptu U\Q轞`H[^_U WVS}u{ ts 膞FPwC ujjW{ tVu s +sC 1We[^_ÉUWVSE} uX9rPH tMtA9u)t;vAKt49tt+t'GNt :utGA8uNKt ut1}tE0[^_ÍvUVSutpVk{tsw{tscjjh"43V( s &Sdž1e[^ÉUUJQA9tt T 9u怡TÐUWVSh/4)Et@EE34=343Ua84=84apajjha ƃu8atEPPhahha hahjjha à tYU2E }thaURЧ}tEPjSd}tURhgtS 16V蓥G?EE8e[^_ÍvUMU zxtB prtQ4tjQ1ÐUVSujj4V1t pth@V8 vhPh4hSFjjVЃ 􋆬4PjSu V/à VjF pVЀ؍[^UVSuEXjj4Pbt UtXjRЃt#jE @ 0MQ!`vjjEP\ЋU}th4MQ t!VEPh4UR MQet t(vh4jEPvj/Upth@ыQ8 UhPMu.Mpth@Q8Uh@jMQh4PEpth@MQ8 UhPE h4Mpth@Q8 UhPjMQ j jjURPMQe[^UWVSu ]v8ujEPV|tЋE}t C; t; tEPSEPƉЍX4}}4PEP`P4v4PV؃vPh4jUR } 1}tUBt;ptuUVߖEE}C; t; tEPSEP,ƉЍXEP4v4PV؃vPh5jUR0}tA1}tUBt;ptu U!Vh4jEP1e[^_ÉUM1Ҹ<59u@#vBvQh28j(hÉUju uUju uULWVS}ujU B 0W[t@W8<u" uh8jWTjE lPE dPjWqv uM AtEE/t@W8U ]EE8>t̀8 E  O$ȉ,,DB$LH8u@B$B;8r 8HB,B;8r 8IJ,FL0FPjV7 jjh(:VPV&jjEPVj  Er EPV蓙vj$P,PE PVc d$P,PVUBhjt<~tvvPtH@V8<iHZPtH@V8<u HutlPtH@V8<u MHtD7PtH@V8<u Hu AGMuErvU1ۅt^t Ut-EE;MvTQEPjVt E;;Kxv"QCxPstVu CtCtECxEUU :EE]<[z<*p<.hv<\t<~|v}MG<t6<~t8,v;; <<BfCBCPtH@V8<uHtx~vPtH@V8<H\PtH@V8<u ,Ht#St=v~4vPtH@V8<u Hu\CCGM@EU )ËU1e[^_ÍvUWVSUEM91ۅtZt Ut0EE?;EvXPEPjR1t#E??;Cxv#PCxPstRu CtCtECxEUU ut&|;/t|;?uOt|;$u OE Et ;/t;?uCO;^u^CFOt?;\u{/t{?uCOvPh <t\FCFOuÃ}t$FEM )ƋU21e[^_UWVSM1ҋE E]]tE8 uBEMuE]E +B@ҍ\Z]1ۅtYt Ut2EEU;UvZREPjQt%EAvE;Cxv#PCxPstQvu CtStUCxEUM M]^G<󥤋]EEtPU: u߾<󥤃*vUPh-< t\CMCEMu߾<󥤃$CUE )ӋM1e[^_ÐU WVS}jh<<WE P#ƃVlà ujjEP胨*VSWE P#Sh=<jEPc Sle[^_ÍvU,WVSEEUUM ME]ЉE싃HEvF&t \tBUPtH@ӋS8<uyEHb}MAڃO$L<FUPtH@ӋS8<mEHY1F]<u |5]|u | M|)U UlEvUB:RwPR/{}}t$w}t#v}tj}tkvEӁvRZ 4%ӁvRFf4VEӁvR9Z 4%t6ӁvRn4 vOmvE@;Evc=sE}uMQiEPURjEujjMQ~}JEEEUBUEE\vFEvFEvFEvFEvFEsvFˀwӋMAS"UB:RwPR!y1t M;uuPgvUPaiMujjQ@EuǀMM E}}t$w}t#v}tj}tkvEӁvRW 4%ӁvR*Df4VEӁvReW 4%t6ӁvR蚵4 v{jvE@;Evc=sE}uUR:fMQEPgEujjUR誢}vMMME@EEm~MU E]MU 1e[^_UWVSudPjjjjj:lS]* } HPE PEPS*SV?u1H[^_UUE PRÐU,WVSuU Bx{tseU Bt0)DCujjVZt@V8 vtJCEǰH9v/E&{uh=jV[hvt@V8<u 4t+U %PsVlEu (sVE EE9uxj jEǃxEx j,jEUBUzE9x uP vUBUPUEPP~ FLEVPUEt}E uEU B|%%t'PEpVvPUrVh9u%EX9[uC vUPEUUZ9[uS vUPEpUBp$Bp V }t)EPF BEPFLB EPFPB!vUBxBUP UBUP1>}tEPb}tURbEPV e[^_U WVS}9ujjW yC0C9uh>jWVE @|%%PVWt +sCtVSWHwsv$v W 1e[^_ÍvU WVS}9ujjWo xCpC9uh@>jWcUE @|%%PVWDt +sCtVSWvsv$v W 1e[^_ÍvUVS]u ~uvSOFtNF;C u1GjuSiu+j jvS&Qu1e[^UVS]u ~uvSxOFtwEPSsu`juSQRtjEpu7Z+F;C t4ujPuzPtJjuUu#jUCBE@UFB EP C @fBFpjSC‹EP$P(EEEC1e[^ÍvUWVSE96ujjP%MvU Bxt t 6u U BtEj EPEPi‹E8uD9t J9u URh>jEP谚]}Ѝx9tQ;t>C@@Ej/uuEv@WPURyt ]9u9uh>EPjURY4;u 1*avU B|%%PEPURVe[^_ÉUM9t%E @|%%PBpQjjQU WVSuU XC;F uC FLCFPTjuVfu-SC BSCBF Hj jsVMt 5vSVHu;] u98u PV,1e[^_ÉUWVSEE9ujjURMy8"wh?jQ苘EE0<v^!;^uURh?MQ h?EP軥{u SU C@E}ҍJvMDPjjh#?EPURjjh0?MQS 9^uh9?EP:;^uY~tSMQ8BvE~ЍHB9vvQ@?9^u;?PhF?URܤ hM?MQȤF9E6UBTu+jjjRnuMATu ;u1e[^_ÍvUWVSEEE U29EPVE P$^mvEPSU R9^u UEBEUUE@ BUB9BuEB EP EEUP F9uE8UGB9?u E WEEG6;u7EXt?EPSU RouTEUG BW EEG u‹Ext-pV8GujjU R脕1e[^_ÉU WVSjXÃt,ߋu E p7CtE1jjue[^_U WVS} tw!VJXÃujjuΔ1vVWS]CCC CtCCE1e[^_ÉU WVSu ,~t~-~ tF$|8WWÃujjuA0WVS\~tC(C~ t FC@C E1e[^_ÉUSE] ;t CBCB Ss(XSX1]U WVSE] KC9t?ƍv91uAC AB9quCQQWK9uƃ;t(9;u CG CB9{uSSW1e[^_ÉUUE Mtr t!/vh`?h?jRܒh?QjR;ZvÉUWVSEESUREXuu u>t1vRF 4%+}jUÃujjURvGPhUCujjEP{uStF1e[^_ÉUVSuPV9uvPVFCu{t sU1e[^ÉUWVSu} U=w%1t.WAEuV u EPjfE]ChjRWSSV tHj(W t)hjRWSSV tEPjV<1u džUVLFPFPPRV1e[^_U WVS} u];vvRCv4%@uC;ù;wC;jvRCv4%@tC;ù;+; vR`Cv4%@uC;ù;C;vRCv4%@tC;ù;E;vRBv4%@uC;ù;tO?t;t*E8tS詠~ 1e[^_ÉUWVS} Ӎ{C Pjzƃ FFF FF~SU RPVE P?}t?Ph?hS'0h?SbYװЀ| uװDR u鍅PPPPҋЍD,PjLÃC(CP*]HCC@C P\VF C 9Vu^F ^ RhP}PwcF9Fu,h?U RjuMVlPH뺋FF1[^_ÍvU WVSEE} ӍsC PjǃGGG GGwSU RPDT1EXt/U RWSEPtKvcuҍG9Gujh?U RjEPZtCUZt9Ct,Cu&‹C h@sjEPKuȃW/O GG1e[^_ÉUWVSjjE p.E}wU B EPMQ|Xu'jjEPjjujSt u&!U B MQXFvtEЉEPtRMQxEPxRMQCx xEU9s8 tvEM9MsE8 uE9EeE8 Y]CxUx12vtt #|p߰HEFh@EP3Ãuu(}t"tuЍXEPURMQŘEEPE pUR謘à Suh@jMQ蘈 }t11҃}tEPtE;Btu UuL}1}tUBt;Xtu UuSLcv|QEPmEPEPpRM QEP# EED0Pj?ǃG(G}tuuPkPWE/EEUBGRpRP@PEEGG@G _$SRVPPUMA G 9Quy UB 8My euЋtPjth0@jURMQaUth7@jEPˆ1X[^_ÉUlWVS]E;/uVSΟtqj/U rǃtXSE ph=@hS˜/ VS{u!U BUǰHU[^_ÍvU WVS} u)89sGC< u>vVSEPuމ)89sC< u9ue[^_ÍvU WVS}] u9s5VSW5utv9s C< u9r1e[^_ÍvUSEU ]: t: }B;@B8t9s : t: uӀ8u19s: t: tv[UlWVS}EE 9t*9u{ wU R0 C@vj jjEP/ÃU S9RuZU XE UBL@CRUTt*dSCt%@SjjEpLP薔 kWURSEPlEjjEPUR#[4EH w$@EEPEPD`C@;C vPC PsUR2CEe$@ER t{tSC|\3tSSB9SuJC|.u@E 9u CU CBE 9CuU SS.+vj jjEP-ƃSBVt^}u3VučEPjEP uF VsSjURْ EWEPVURE U BC9u U BE XC;CEC;CE1;ss9CvR5v4%tF;sr;su;CCUC@ hj M;8{.}t}tpvC@9CEECvPEPjUR~'EssuSICEEEC@9CEjEPU|CC1C;CdSEP_ GvjURU|WEPSUR} @t>UvR3 4%t} t }KSE CEve[^_ÍvU WVS]} u@tuhA^t?t@S8<uvtwhAtwwh Ah-e[^_ÐU WVSEt@MQ8 EUt@ыQ8< E11ɋU ;rs)BEU< u1)FAE ;HrN1)119w1)G1)9v)ˍD;U ;B v%PЃ PrMQuMU B;M AAtM QA AOutE P@ U BKu1e[^_UVSuFLEUFPBjRj'V{uQ^{X| KXC4C4t$rFuIEPV(kuC4/vEPVgt"C4 vWDvEFLEFP1e[^ÍvUS]hAS萊hAS肊 h BSqh`BSc hBSR1]ÍvU,WVSU BxdBtEvR>0 4%tBEUvRƒv4M E=tAE0=Ht;t"U2;Ju;t }t\C uV}t4MvRύƒ 4ME0phBUR袈IsshBMQ興 t  u   sshBEPGuBkC tbE[vRv4EEE]PUpMt vFAuu3sVj hBUR裇 ;tDMATu5jjjQqQ>UBT+ SAv1e[^_ÉUVSuU Bx3Btxtj B pVBBt~a[t]uBt@9uH~u3 t@V8<uvtps KxuFTu2jjjVrO{FTk W?v1e[^ÍvUWVSuU] 1!E <@<~ V`MNdEFlFpFh}tN}Fx^tt[^_ÐUWVSUM u}ZxBt 1yBxJxBt[^_ÍvU WVSu EE{,U;S0r)@;C0vPC0Ps,EPt^C,}{,NyVeau)F u虲8u&菲f 돍vt u}u vEU1 GEYe[^_UM} uMA0@9A,tDy(t>Q(zt5A,A0Bzt 8u+A(HPhgCjQu1UVS]sjSЃt sjjS\ t@S8 vC4`tX@S8XC81e[^UUE M $xFPhCjhCPjRRyrPhCRPh DJu h`DuI{>uCM;t7vvR#v4%tC;űU zxt;uEPj߰HPSU RVU Bx~ tv5vE HtQ:F @%f=u[rA0VJÃtF p{2F XF `?F H VjF pVЃ$WV<jSV|URWE lPE dPV-e[^_UWVS}EMURU0 M}tE UEEE+H};uvMAQ9upUBTjjjRfDuUBT}$u1}uPEPURUhEEPEPjVEPK Wuju艳;EE OxوvWj & uEFE;uWuQEPGP$:u"E%f=uGPRuWXu13vUB@Xuh:Hu jRoWLX}$ujjEPUhЃ}tUE UE؍h[^_ÐUMU yujB 0Q"vjBlPBdP1B|tBQPQÍvUWVS}u ujF 0W'F|t^X(ltd@W8 vdKEEFdEF|%%@t~t' tRM==B1E9Ev U)‰@FdFdFd!v9]v E)@FdFdEEK9]v E)؉Fd vFd]^lGLEUGPBjRj'WgEK9]v U)ډVd vFdEHFlVWphHWKwUUVdVlVWp chHWwE@FdEHFl%vtEEEFdEHFl}t&EPWMFl;EvEFlVW@p}tUWL1e[^_ÉUh@IjuhÐUhIjuphÐUVSu] EPC PCP3VF t }th#JjV&h@v{ ts shtCCCCSC1e[^US] Ct$vC PEPj3uF t CwvEC{ ts P輖tCCHCCCC0C H9Cu CCCSC v{.v1]ÐUVSu] {ujSvLRIISVu{u/SvRv4%u1e[^ÐUVSu] SV~t@{t{t܃{u,SvR9 4%u1e[^ÐUS] {C$4J;t~C PCPj 3uD tv{ ts stCCXCC HCSC?v{u;u C(CvKCSC v,v1]ÐUVSu] SV t@{t{t܃{u,SvR 4%u1e[^ÐU,WVSE@E @1tPU}@t}*u(Mf|jjQEEUUvR] 4%t.UvR 4vUMA@vt 8SuuIj}wE@MQBXEPEP5PURRMEs C9tNCu9>tjjhJjUR7 ujvvjMQ7 uv9uE @1t-phJj]SyjPSjUR7\1e[^_UUM AwN$JR8QR,QR* QR&QR)vÉUVS]U BwZ$JvSVRS:RS*RS6RS W)vЍe[^ÍvUVSu] SVDt1K@{,t C,@ u C t}u|}uVWdEHC8EC1tSM9Mv E9u9MtJuE)HC@CuGEtEPV,u!U RV0u }u1v Ve[^_ÍvUVS]u jEPjsLS4tCLCPCP;Er}tEH1CPCLFDCPFHf0N0 1e[^ÍvUVSu^{uVu5EPVSu juV% tu7oUC@BE@UC@ B EP F @fBELPua9ExLu@LvEEF1e[^ÉUS]EPEPjsLST3 t{LujjS@}t*jjuujSHu!CC1h"djSS]ÉU WVS]} CxuSguSCPC;Bu1FsC@@CEPSL8uwwujS4sse[^_U WVSu^jVbǃtDCPVSu/jjWsuC@`X1sAe[^_UWVSE x#u@+U z+t&z-t jB(pMQhE @1t#x}jURՐM IMEEPEPEPE p4UR0 t }h됋M I8|;MQvE|vR 4%@t||;Er|;UM ;Q8tEPPjP1u+|E|<0|Xt |xDžx|E=w%1u EPhd)E||XutdpNxdp;vE|<0u]vXDžxG=w%1E<8t}<9tw|dpvt`E|<+t<-uKDžx |G pdpE=w%1tLiDžx |ldpE=w%1"hdjUROx xtvxE=w%1tE<8t <9E<Džx ldpsvE=w%B1>E=w%1u&EPhdu /vG;}+|1ۃ}tEXt Ut?DžtEE2;EvcPEPjUR3t@E2;CxvPCxPstMQuCtCttCxEU;}u/V|EPtR轟tt |Ex j jPEP萹UE x-uڃ}~~+E9}}}+E9Uup;pdu ldpupPjdEPcƃxRjPEP腸M y+uE;Es EEU9Us M)MxuuVpPjdEP!cƃ |RutQWVEPt|S= +|lE)PEPS|E+|+l‰UutRM q4EPt/à PURNtt51}tMAtt;Ptu UtQ؍X[^_UUE tr9tt-vhdjRlKhejRXKÉU WVS}hj豣ƃtRE džudžHt^HODujjWJvHDD~HH|t:|HP|E P膵|u'1e[^_ÉUVSu0t0\DtDB|t|(tS dž1e[^ÐUSME ]2t? &t zItcqXtP@Q8PPS-St@Q8 vPQE0Q1]ÐUVS]u EPjjv4S' u}t EHv1CPSt+@u S/VSe[^UWVSu} jWV]džW4VLEPEPEPRV&0t}uMEv}tFP@9EtFPFPSG1tGPjjuujWVL9e[^_UVS]u CPCPPv4StASt+@u S.VSe[^ÐUWVS}u jVW5LJV4WLEPEPEPRWy%0t}u7E}uSF1tFPjjuujVW:8e[^_ÉUju uUju uUWVS]u j VSmǃ{Lu4EPS*}uEE1EeCPSt+@u S -}u:jusLS(u_EPEPjsLS$ uBSLBJjusLjS& u EPEPjCLsLS]$ t ,vSLJWF1tFPRjuujVS6e[^_ÍvU,WVS}u f0N0 V4;VKss4V|‰S@{,tMC,@ tD;S8u?Vjt{,t"C,@ t{8uVkOvC@C8;C@s{,t)C,@ t K@C4S8v{,t C,@ tK8C)t? (t(‰< E< M A4EUEPEPtE9uG E;EuOtHEPURփ}tʃ}t}uօthfjMQo7EU BF,@ t5~8u,uF4PEPbN4N0vN8~4sEPEPjWUR QF1t^ۃ}tuuat EKE~8tGEPEPjOWEPl }t}}tuuatKEE8 u K뎉E8.u}zU|:bMv:Auz u}tB:AuKtO:u1}&uu` KtEv~M9t6U:Bu"y u}t UA:Bu Ku~<5v9ũEPEPjOWUR uF<F@~8uf0N0@N4N0N8FEPEP:uK G4;EdG8;EX}ujtKEPEPvuÃ}UvR@v4%o}u.KEPEP{\K[vETwL$jBt<5u 1u1)u KuEPEPtVEPEP菮}G4;EuG8;EujEPpDvEG#1E.t  !t*?tMuNj]EEVEP/}uL})t܀}]tր}"tЀ}'tʃ}u.UvR 4%tVEP-^G4;EG8;EVEPk,}t}u.UvRW 4%u}E܉]EEv1ۃ}tFUvR 4%u})t}]t }"t}'uVEP訬um}EGvE PURWMQÃs9vu^XC8}GLCGPC}tNE* tUJ)@C(E+BHC }+{{ E) tEpSUR*&E(t1} t+SjjM Q}W CC!vE(tC$CC vCC$E*@tKSE CCC$E(t$SC CC jsEPԡDžDžE+@Ut@ыQ8v}tEP8+FMt|@Q8 }| vDžDžHDžDž(0TtE*%(DžE+tDž(e*Dž Dž$E+t ƅ;ƅ;DžDž DžLE*t Dž@ Dž@CUBLCBPjRpM A1 }䉽4@j4PUR+LMu~DžLE,\;A4s Q4)‰EԋMA4E܋,LJ\LJXLJTEPQFjEP蘄 4BH wR$HmvMEP}WjjEP|9D 4RMQm) u?E+u94 u-,DDž(e*M+7v 711E)ttUTtL@׋W8<uOELtCUTtL@׋W8 UL4G 9uE*tvEt@}W8<uPEtCUt@׋W8 U4G 9uutC;C$u C8uLPSEP4BtL~DjMQhthlj}WDžDžE*B),;Hv/PHPDMQCqL,D+Nj,D4E+t*+,D4tDž4x 44B  t up@E*t@ u&4AwDž KC(2 uDž 4 Dž ~J4B =w$%1u"Dž SMQ%4GH $tmE)tbE*t jsEP%UtjjhmjR C;C$C8(u{E+uu0TtfHPDPE(%P4 PS}W( Dt$E*aD)Jv(t Dž(@tE*t@PSURE(t { tKK CC4CC0CjsMQ蹙VC,{({ E+CsvR<v4%t FC,uƃvRv4%FC,OCsE t@MQ8<uBEt6t2vRhv4%tFOuDž9B PRVEP\ƃUxMA|F9QxuqxUB|0Mq|~ ~(C@FE($uTVuEPjQM 1҃}tMQtE;Btu U1vuVsSj}W .Dž$FFtuxu ptFxp ;F vPF PvEPk FxtpPXFFPvSxtpFtFxF(pF Dž~(uB~ u u}tEE1)EEEFs}}u 9]11;]w 1)G1);EvU)ʉUM +A9tO)ӃQ)‰PV)PfAM )Y)Yqr  Fsmr  FmsEe[^_ÐU WVS}U Euu;uFvEPEPjRW tv@E]}t5vRv4%tCMu+]tRF;F vPF PvWwXtF~tvFPPQ@^Suv<@^1e[^_ÍvU WVS} uM^9uAuhmjEP&xS4S{(u{ uC C C !9>u FG FB9~uVVjC@PEPu1e[^_ÉUWVSEt@MQ8< EUt@ыQ8 EE11U ;ZseM A< u 1)BU B<w@MQ]BvU BPMQپCE ;Xru}t1uE)EME1u)UE}tU B$B9BuEM A;A$v*QE H@(U B;B$vR| t| t11M ;YshvU B< u 1)BM A<w@MQ]BvU BPMQCE ;Xr;urE16vE1)E1);EvU)ډӃ}t E؋M AE }tuvjVU RMQ MuE tujVE PUR Ku1e[^_U WVSDž EU zuDžJuvDž] sN{vRΞ 4%uU ;rt;r$tN벉M Q)֋A@;A v"Pȃ PR]S*T4} GE p21*jjjjjjS1r S]S@PWPEP t9]E tt) }GWd]װH9[֋@ NEP0.uE%f=@u  UBRdMPS}WiE@E9Xs @1;s?:u$]F;s:t{EtLt+CGt!u׃tU )BB(M y(t.CGE H(@x(uӃM Q)֋A;A v"Pȃ PR}WPU BM qyyy tq PP8rCBs僽EPE0E%f=@M y(ukQ)֋A@;A v%Pȃ PR]SOu^} GE px tp R@P7M A v] K(} G/Dž 1[^_ÍvUv?w@MQ]BvPEPжG?u;uvuKEE%n@EEUtEEEM;A8EPUMPEPANj] vK~!Wh nURMTtڃ}t,1}tUBt;xtu U WKMTlYvEP8J1uE9E vE 1uEt@EEE]1;uEPMUPMQVǃWhnEPE }t.1}tUBt;xtu UWwMT];] s3hnE+EPhnEPZUTugF;uIhnMQETu=E܋U9U hnMQiETuUR MT}t E1e[^_U WVS} UB5WE< uEPEPwRMQp GWE<w@MQ]BvGUPEPE9]EG;G v&PG PwURnKu GM)ى˃ t w GUBREDP+3__(Ewƀ> u؉Erbv FsTWE<w@MQBXGUPEP]r BFsWE$jwURue[^_ÉUVSuE XvKSVuu^LuFLFP@e[^ÍvU WVS] SC MSJC1v;StC;S$t>HJG8upt/jjV'8uvSCM `SCM S)S){CL{(ts(CCRPp1{ ts CCC(RPN11e[^_UWVS}u Et~(EN(~(2FEE8 u4VE EPEPvvWnVE 8U:w@W]Bv]PW̰EEbN(VE< uEPEPvRWm AvVE<w@W]BFUPWTEE;Es E)EEF;F vPF PvWG"FE])ÃF F(PVE@PUDP/^^(VE< uTre BsXVE<w@WBXFUPW訯MEVBr ABsE}t ~(}t0F+EFt%F F(EPVEEPUR.}tdF@;F v"PF PvWFu RvFF~ t0~ uNVD vF F(PFFP@P|.NV] F1e[^_ÐUWVS]} u{4u E #~wG4W8GDWH VF|\u|\FVDP|tt@S8 vtPt~t VF|\t G4W8GDWHVN:D u$t| \tG4W8GDWHM!WFE􋃜SMtG4W8EU@vGDWHEUHV:/uPjFHPBPGDPEPSB"PjFHPF@PGDPEPSN% u7GDCLGHCPE CujSFUt xM Su㋃FM;t(jjS1uCjS1e[^_U WVS}E EtEPSWEsssWbuz}tjsW#ou_sdvEtEPSW vEssVjW׺ u}tjsWnt FGx9u1e[^_ÐU}t}uրw EGSW蚪Ph njWe1E9uF뙐E;EuNuE;EruE;Er͋EGLEGPjWRu j@\tT@W8TPjWDe[^_U WVS] sN{EvR贋v4%u";st;s$uENOE뱐OUJEB$EK )J C(B(E)CUtEC(S D)CC vEC(C )CC C(vRv4%tKK;st ;s$tON뾉M1e[^_ÐU WVS]}{(E 1Mx9us vB,BƋ9u9sU);{(v{(jEPjU pEP8 u(CCUWRPߞC())CC({ e[^_ÐUh@njuÉUWVSE X4p8@1trxm}uOM AHV7;ErEP))NjE PHT71BM AHRVuuSMQ t WtC1tBEPEPjSEP: oujjMQ vKE XD1e[^_ÍvUWVS}u ^4EPEPjSWԳ u<}t?F0u ;^ 4%t[~,t9F,@ t0}t*u%=Q=~,Q9~,S,EPEPOhO}tOt]vSEPf}L}u.UvRs 4%tu*~,t$F,@ t=Qt =SSxSEPg}OO1ۃ}u4UvRہ 4%u}_tvEPEPe}M}UvRpv4%uzu>UvR= 4%n}_u@cvUvR 4%u }_(u<~,t6F,@ t-=Qt=SuyEPEPetbv}u,UvR聀 4%tEPEPeu@}t OJ~,t F,@ u'E;F4uE;F8uF4PEP7JEFjuVXjjCDPVsjsD~jvDuF1tMFf1E܃8uPVW E܃~u3 t@W8<uvtEpsU܉V(:.tD} uPwÍ@WBXPWGP$} <;G,uF(RN1 M A1 uhs F1tE H1FU BF1t FM Au 몋E܋@EF1t }u]Uu F1Mt=jEPjW s} 0Et EEFN1>[t>]t >ZjEPjW #} Et U]8tb}uM܋AGE8~u0 t@W8<u txsUKjP|>zjEPjW ~} ;Et MEFF=w%1tZFPFPWN1jEPjW } Et EEF}tFU8t?M@u4wÍ@WBXPW藄PhtEةt1jEPjWuu} t6Et UEFMA*Wu>}t1r}t'h+tjWGWd1e[^_ÍvUlWVS]C0% u2}uEPSEPjEP tz}u M eEtEEEC1tCEMc1K1:Eu~K0 UBLC4C8UMQLJS+ȍЉЉUC8+dMH U BB BBTLt:t DžP~<DžP$PwP@MQ]BPSEP9wPPwP@MQBXvPSEP!wPURlXЃ]SllЃ|xSl Tu'Dž\] C Dž`CHtsE @ \M Q`p]t @S8<u! E ud9T,MI8d]U ;M yA;A:AtY\A`RB\Dž`\U J `ZpEt @MQ8<u#v] ud9TTUR8dCDžXDž\Dž`Mt @Q8<u|] l\;tpPp u~@uuMt@Q8 ]Et'4@Uz8X14Ӊ)ZX]1)APwP@MQ]4BvPSEPsXT9Xs\\;t][8dT9X\U J X+T)Ɖ``Zp\;t#pPp @uyEt@MQ8 ]Et'4@UZ84X14X]1)APwP@MQ]4BvPSEPyrXd9Xr)XMI8dOt\\;tXt.\E P X)Ή``Xpv\\E P @}t#M ];CLu\9CPr d;CPsDžhHUJP+\Ah}]8DžDDžX\;ttvpPp @Mt@Q8 ]Et'4@UZ84X14X]1)+`XNPwP@MQ]4BvPSEPqp+`X1ɋd9XrouX))ƉE XXX5] SX+d)ƉCd9Xv DžD\] Ct\hh]u DU] +؍ЉЉU]tX)EXH]Ut@ӋS8<u*vEtUuTu]H-HtK]v;8r#)PSEPlXЉ߃ Gsv>;8r&])PSMQlXЉ߃Pw"P@MQBX`"vPSEPMn`r BGs\Dž`\;td9XPw$P@MQ]B] CvPPURmM A] CCtHC<t_XUB5>;8r#])PSRlXЉ߃]S0r BGsd9XsURllЃU9v!)PR]SlXЃ|xMQl1[^_ÐU,WVSuFE?@PV~EEPEPVU苂pЋ ;}t @V8<u  t{ v{;t}u3V~tzj+ЍЉЉPVU苂3hguj W PWVU苂XЃ;'uuVU苂1e[^_UWVSuE{~ w tOW?`\*`ǃdjtPpPlPVpЃ EPu VXEjF@;F4rF4HPVЃ uEPVXЃhPEPVpЃ VlЃhF@;F4rF4HPVЃ Tv`D`\u3`u*jF@;F4rF4HPVЃVlЃ pl\`jEPرtM))ʉ)ЍxM)щЃ=GEUtxdu ǃdhF@;F4rF4HPVЃjduPdVXЃ hF@;F4rF4HPVЃjVЍe[^_ÐUS]SjC@;C4rC4HPSЃCjSЋ]ÉUWVSuFEt1EuuPE uuPhuV茣Vw EPEPVUpЃjF@;F4rF4HPVU􋂐Ѓ VUlЃ} t@} ЍXًF89vÉكQU RVUXЃv1ۃ}t?}ЍH~8G9vC)QURVUXЃuuVU􋂐ЃjVU􋂘Ѝe[^_ÍvU,WVS]}E@EUUEu UTt2EtUTPdЃ ETUu3tBjR EPP9} ujjURU\ЃSWhu+} ujjEPU\ЃhBEUBjREuWSU RP vEPEPEPUpЃ} uWSjEP`$|; uOUz4uEPjRd vEEEP8JUE샸Xt]UXE;EvjhuPEP/jhuUPEPjhujUR U E쉐PޅhvRFv4%tFOu΅.E싐X:;EE)Ѝ09v4vR8Fv4%uK9w9uEU+X<]SvRE 4%tKύv7EËE))u)~|.uK)PVU REPtjhujURrUBTu,jjjRhuUBTu uuuEPUЃjEPUЍe[^_UWVSE@xUtMh}EPj URh+Mpu EpvtXpЋM;A8v A8)ЉptXNMy4\uljA@;A4sH UB4PMQxЃMQxlЃ MQt\Tt\M;A@ut\Tt\tjjURyjMA@;A4rUB4HPMQxЋt\TUBTjjjRfuLMAT7tXUB@;B4rMA4HPEPxЃ} ujjMQx\Ѓ}M`EdpJl\d u wÍ@MQ]4BSEP3`ƍ>;`r1+\P\RMQxXЋ\wÍ@MQBXSEP_ƒr BGsdl2U9v!)PRURxXЃ} ujjEPx\ЃMQxlЋtǁXpE)EhSEMHhu(tXP|PURxpЍH[^_U,WVS]} CEXt*jhuPSdžXdžPt$CjSЃt,ju\wHugCTu[jjjSpcu CTu<%t PWS PWS?tC9t@t jjSU\Ё\vWE\;C4s S4)‰EC4Edž\džXdžTEPSdž\džXdžT1e[^_Ut! @V8<v E  UVLM;sFP;EEPEPEPRVr[ t}=vFPU;E؋+~PG;E91ۃrGEMM؃ wEč@V]BEPVKNÃsK}wEč@V]uDjVWjS=1s8tAuuȍe[^_UEPE PjuSO }t} u}t E1v8t0@S8E 0Ut @S8E v Mu uE1t@S8<u tE}M}UEBU un}uht@S8E Mt"@Es8u܉M14 1E)/v}wE؍@S]BEPSgAUUEǃ}u;{8r} u1E1s8)U+{8M}vM MMUEBU uo}uit@S8E Mt"@Es8u܉M14 1E)/v}wE؍@S]BEPSg@UUEǃ}u;{8r} u1E1s8)U+{8}}t}u C5E}t u+uM1Ee[^_ÉUUM }t"EPjjQRLu$}tEHzTtrTQR v1UMY;s8<}F}t } u1+s8mu؃mMUAM ur}ult@S8E }t&@EC8E܋E؋M}14 E1E).}wE@S]BEPS3=;ur%U+UU;uuEH9vOKvEBvE؃}u)M;K8r!} uE1s8) v{8)}؃mEHe[^_UWVS} ]Eut u$ujURNu uGM;8U;8tr t?n1vMQt]ujjSrV}uEC]ÐUWVS]} s{4uSlnEPEPSpЃrPStЃjC@;C4rC4HPSЃ SЃuuSЃ s1e[^_ÉULWVS]}u8uit @S8<u uxu-Gv;ujSԄЉUȋCD;C@M;K@s}苰SumrfvEPEPSwu}u1t @S8<u' u}t}umsujjS1 jjE PS0vEtEPSStE}y8u>t @S8<uQ v uCxt1S7PCvjSMQW+wFvjSEP=ƃC;]s;uve[^_ÍvUWVS]u CE{4wjhxjSIWjjS迾{4}t vj@Pߡ‹ujjSEIu CL@@CD;C@ЉUC8F8E}uVEPSnu7U)‰ЍЉЉ@9s uE}toC4)F4CHFH{4F4CHCFE9Cu UrC0sV4C@)Ѝ@PRRܙ5~4C4)C4CHFH^E9u Ep p3{4tC4HC@~4tF4HF@}tj}tF4)C  G 49 v 49=u  ]STSc @uSP=}EPj$EP1vWw 4%u_uEPW8G~WvEPbEP`=uAzPv0 ^uB=uAzPPwv0 E vE[(E b= b]4b=t t u 1uvWӃt VWG~݋Eԋ bװHװH)‰УuAz*PQuU EԸ bUԃ<\u?t6=uAzPt0 =uAzRtU -=uAzOPvt8 ]u \u?t6=uAzRt8 =uAzPsU E܋EܴfE܉EEڴfE1]EE޴fEރEPEPEPEPSV}=vVpv4%t&SvV]4NvV 4%t0SvVQ? 4PFuԃ]5}]SSP=vV\v4%]SSV vVv4%t*EPvVz:4*EPvV>v4PEP2%Ce[^_ÐUS]P;P|6|ȋP҉PP;P}PRp ¡P HP @w$| @  ;B~B]ÉU=v`=T=tH=t<=t0=t$=t=t =u5A=u@;j`=thX|ohÐUVSu@ D=|= ~== }4FP@#FPÃC)ƉPDe[^ÍvU WVS}u 19}!v;@ 4C9|e[^_ÉU WVSZ= pơx)=}h k=uhR;}UVW2h ) C;|.vVW h h C;|T59e[^_ÉUvh ~=t= t =}US]= u=t h vh = tċ]ÍvUSEU ]=uhe|l C j'=thy|~lC PUh H { t h2C ]ÉUWVSu} 1;^}T؉ىTC;^|FG[^_ÐUWVSUM 1E;x}.;sGE;x};r];{};u L1Ӊ΋E@;x}!ULtGӉ΋E;x|[^_ÍvUWVSuEEFEU;BM ;A];E Mϋ];v]ߋT~TC]hUM ]؋};s^TىT7v^U}TىTG}N] }D DG}FEU;B}@M] ;KG}$^U}TىTG}FE;x|֋UM ;Q}-v^} }TىTG}FE ;x|[^_ÐUVSUM u1;^}:;tC;^}-;u;^}!N;^}DT ىTC;^|[^ÐU,WVSE}ЉU}ȉME}] ;{}Kv]D1EC]9|EE};G(_$UM; uf} G;DuZD 9EuPD 9EuF1U<FM ;q} UB$T8D;Du;tًM ;q1EE};G(sUB(‹M;A,|1|A,9}]C,}G,Pw$hG$UB$M}<U BP ‹MA$TA$P} W UB$ML B$UT MA$DA$DA$D1;wP]]}<}EEvU ]C <T}t @u vt}t ux}t @u t}t uYuP}t | v t}t u1u(}t | )v t!}t u t }G$MT}_$M| uDU G D 0vM ]C <uC$UDC$DF} ;wE@(Ee[^_ÐUWVSU BP-E1M ;y}EGU ;z|1 EEM A <<<UTEUuMQUTRPEM<tOU}M A w6$|&EU} G0};|}/אUЃMQVSUEE H0U;T|ԿGM;y}We[^_ÉU\WVSE UB4BPE؉EMAPEԉE uFPlE̋FẺEFPNEЉǃ FP7EȋFEȉEFPEE E;F}UċMBUċu;V|UBPEjMquF0E E;FUB Mċ$|vuuEE7UBEMMu1;_EEURMA0PEPEPJU މMME;|^|&vUM܋UBH މMU;}݃ދM܋PދMA04EދMA0M ЃUB0PMQC;_AuF Uā< >MA/uFEEEGu1;_UUMQUB0PEPMAHEމUUM;|^|&vEU܋ ɉ UBH މMU;}݃ދM܋PދMA04EދMA0M ЃUB0PMQC;_Au~t UBB MAEEu~t GG:vGuƋ_KxvMًTމTKyGEGG1u~t=~%/MAAMGG1u~u~tUBU{MA UEuā<%EEEEU2M1BAEj/‹MA0EċuċE;pgEUċM;Q]uF }ā<~<t <~nSUB0MčPuVSeN0U }ċD;B}BP4‹F0UB0MčPSEċuċ};w\EEEċU;B}-]S}ċu<7WVsEċ}ċE;x|փUREP1E;u}3M]v}ċD%T09tEċE;C|֋UB,B(jMA$jVEPQ uVa}WU EPFUR: MQ+uV ue[^_ÐU(WVSDž=DžddvdPi4d%u d_uh`dQdd~hPPCDžd] S$ӋEEd;tx\vU Dd ؋\u F <w\W4V8M A <\SPdu V$}| t|# u\PP] S$u| t@u7u/Dž(( ! G(v苍] S$u| tu8u1Dž(`(!G(v拍E P$]| t u8u/Dž(`(C~EUz8u R11] EH@UE4CtP?e[^_ÐUujQÍvU WVSu Ѝx];tWVS6u C;u1e[^_UEt PUVSut%1ۃ>t4}C<ue[^ÐU WVS]E P$E uSEU 1;t vE P4uvG<u1v<t,4U RuF4O9uPSDÅt"E DU R1e[^_ÉU WVS]t} tjPƃu1~;tq1PE 5{tC:AuB<t: t9v׃PAP5utWSVoƃtC;ue[^_ÉU WVS]t} u1:1FE <t(װHPRS ÃuΉ؍e[^_U WVS}t} tj=ƃu1VEE8tpv1U :tTE 4UE4uÃtSVƃS' StGU <uEEU<ue[^_ÐUSUZJB 2]ÐUU؋B 8t"Mqr]؉CUԋB 8u M؋A]sEpU؉BB 8tC 8tPr M؉A m]؋C f|utq~VzFVkN VFN VF@BAjv 6d tEEU;B}tMj 莼ËU}PmC URPnMATCYTuE]E;XY]44` tQtE t 6EUM;Q~VԼe[^_UUM :t9u B:u1ÉU,WVS,E0U=xb}99E+EU+U9~@U19}.E+EU)‰UM}UF;u|U)U6}+}}19} MEU<<F;u|EEU9U~ }9hxb+0,0[^_ÐUS]xb0, h}x(;-u$C7;+u$C$=(t$ v$؋]ÍvUt>=u]E"}u]EE vEE;tJ )PR3'u؉+ ;H9u]UUE}tR}uL=|btxbM 41h}hPL װЍD Bv}UUxb>Myt F5D$=|btTxbU Dx-uM12h@}hPK*E0xbU DP2h}hPK ߰ҍT UB #MyE9xb}xbU Dxbl=|btxbM t1h}hPNK ߰ҍT UB b?M9:9:/ װЍD }tMU Ex,UB v}t1xbM x-t PEP=|btUxbU x-u5 2h~hPXJ+5 xbM P1h ~hP+J @~xbb?.v  PEPK¡ 8uxbt:uY=|bt<=(tPU 2hA~hPIPM 1h[~hPIãb?:Wz;EEEE 8uVE9xbu@=|btPU 2h~hP Iãb?M9::xbU Dxb5D5 F>t>=u]E"}u]M؉M vEE؃;tJ )PR3t#u؉+ ;H9u]U؉UE}tZ}uT=|btxbM 41h~hPH װЍD xb?}RU܉U؀>tcMytF5D=|btE0U 2hhPG װЍD ?UzM9 xb}xbU Dxb`=|btxbM t1h}hPG װЍD ?U:: : װЍD }tM؋U ExtP@ 1vUB  Wz:z:u 8ueDd 8uMM9 xbu7=|btPE 0h~hPFãb?U::u:xbM Dxb Íe[^_ÐUjjjuu uÐUjuuuu uÍvUjuuuu umÍvUS]E t'P+PS5hhP4ES5hhPE]ÍvUu ujfUS]Stujhv]ÍvUSE] tSPe vS跮tujhe]ÍvUU:t< vB:u5D\‹E 1ÐUVSE] J9wA;tR3ɯ vRt15օt )É1e[^ÍvUWVS]u=t8%(15Ut )lj=u蝱E= sE UU15хt )EEE U9r6%(;u!A9rhPujh=$t+hS ujhFPSWt %0h=uF %f=@u1=$uF %f=} t u]EP)PSЉƒt9u;}vE8Gt;Uu=0t9sEPWSue[^_ÉUWVSu] PEURSV+ctl=ucMA %f=@uQ=$t5 讨 VtL0SEPSX\dhlp111ۃURju18u =T05nvE=(u =,t =(u: )P1}uP5ndtE}t=(u 1Et,T)9vM8KtK9vE8Cu5)9s>SRQǃ=pt SVt=tt =0X1ɉ; @}C;v;;dtEAEvJ;UvE8Bu; @};v;du;dt d)ӡ ))X\=8t REPSu18u =T05{v`=dtd)‰9}tHM5)Pǃ=pt5E)t),,ЅEtt5hCKee[^_ÐU WVS}u1[vjWƃ8tޅuN=uEE PWt0W^XE PWSF=Tuك=u7 t u-ĉE PWuU B %f=@tSW덍v=E PWV0Ã} v=Ht9=4t:P5h,cShlc؍)9Lu P5h,c=$t5 螣.t*Vϩt;8t.0W؍e[^_UWVS] EtJB;CutqӃUDPEPlEURPPUE/ VEEP1ރEPUR!E >u4=PuH4}tEPڝUR˝Eh[^_ÐUS]t25hhPf25hhPN2}5h@)a5ha h ah` h`h` h@`h` S?vUS]=Ht%S5Htjh@H]ÐU WVS}1d=dtKv4W躽uddFvd<u1e[^_ÍvU WVS]u 1vvRċv4%@tCύv;ugv}tE4G/vRtv4%@uCF<\u ;t FC;uF_ve[^_U WVS}}P3EjREPU: ËU PƋE U2VEPUR4ue[^_ÉU,WVSE t+j/POtj/5O@8zu$EEEP @DEEh_jE PEPh`P $@MTBЉUUv=DhD5DijhZ=DKh@5D-jh=Dt/EP5DjhvEh?h3h'E5D<q,HWv5Du.5Du5DujhÎ=DӃU\sVMQE5DEPأE u zDƿގthPavu05D*}t E@9vSUR]E}EC9EuSMQ:EF u!VE@)‰PjEEP{t V$;}ME|  AMzPiXY,Lt5,Lt8t,vT0TL$P5Du (e5Du (A5Du (jh j~jhbh@u u>ƒ =D}ED=@}E@=Hu H=t^h5Hh zXhmX h@]XhPX h@Xjž=t j}t}u 50GvM?vxb;U}%E UxbװHE jJ5HJuh76uURMQСxbU)‰Ѓ~ =Pt}t 4xb;E}WExbU h`޿ގ1t 1҅tR!Exbxb;E|h`jEhZu 0h1^=uEP%U WVShHÃhxh`U jjS"C, ߉ދC S)‰Ѓ }j S.F y9y uI(AA Q!ЉA Q)ЉEq)Љ9U~q A A{0tgC0@C0@C0@ C0@C0@C0@C4C8ǃ<ED S1e[^_ÐUWVSEEP0UMM Mm]]}Љ}EDtMMDE M]]ExEEEtTU:W tDMЍUE<]:_ sE?E@Et]:_ uÅ uC S)‰Ѓ}jQi{ q9q uI(AA Q!ЉA Q)ЋY)׉9~Y A AtyGuC S)‰Ѓ }j Q C q9q uI(AA Q!ЉA Q)ЉEY)Љ9U~Y A Awu `GG@GUPG@ G@GJAHG@]_ G MEU<u M8]Ux}E‹Mx u:u]ЉЃ<0uH M@ MsUMЋ x t̃}WE]<u UH u"EM<*]@ UM@ tCV)‰9C~C[uv \G0p t(VF;B~BFF;F~FFv u1ɍA~PG0p'Dt)1ɍ<vA~)v1ɍ<2A~ꋗDt$1ɍw<1A~v1ɍ_<A~1[^_UWVSEx4u E ;}u"UR<PM QHvp<<UJM@EM 9EE EEG)E;MvA0A0хt`A0A0A0хt>A0A0A0хtA0A0;MvIA;Eu79ȃUC9)؋U)ڊ:t9tM4U UUA0E)9fEEA0uEA;Eu99(ȃU:uC9)؋U)ڊ:t9~)UE)9~1e[^_ÉU,WVSUEE;P4>M<ME;uw9t>vMƊU<t;urFNU<ue^M>v}tK E܊ K B:H sv@t:H utP:t]Uz;] w}uE)971UUE+EM;A8~ EA8EEE)FU<uu^Mtc;}tK E܊ K B:H sv@t$:H utP:t ;]w]Uz;] w}KuE)9m}tU U EBUBMAE[^_ÐUVSuU E]~,u2Du)PRV…ttSF4C SPRVSe[^US]1PRS脃]ÍvUVSuM U]uu^EF JVf(F(t Qv$ 6FЃFÅudЍCFF FCf(f(e[^ÉU WVSuM U}]uu~EF JV^$N(F(t QS 6FЃFÅudЍCFF FCf(f(e[^_ÐUWVSuFEFV )‰U] \d;}F(t Sv$SFЃDžudЉ~EG;FF@~1MIx FDIyE$URv$F Gv1;M}WFA;M|E9FuF(uUBGF(uRF ЍGFEF f(e[^_UEU v@t9s9r%ÐU WVS]} S&rC(t Rs$RC ЃK(t9s9:r΅t{ {CStσve[^_U WVS]} S&rC(t Rs$RC ЃK(t9s9:r΅t{ {CSt_ve[^_UE1ɋPt)RuÍvUhPhqXIhPj I 5d0UWVS] uujE( uS~EuEPUUEx.ux ‹B%=.ttU+U})19 u89v49v9tSURƒt[+EEUEPEPg @EURENEURuEEPUR~1e[^_ÉUju=UVS=Xte1۾vSm 4%t&vSmZ4؈3C~1=XtP ujhe[^ÐUWS=2tK;t?${HPs5 tjP#v[utFv;u7{HPs5 kt jP[u5 ct jPe[_ÐU WVSh PP5Xh { hE PURft jPE=Tu =LE 2PW{EM=Lt=Tt}f}ЍXE؃U RMQPW] =Tt}߸̒f=Lt U}߰Ѝ\jhSURjhM QuVe[^_U WVS5Hu(hPP5Xh&vhPP5Xhz hE PURHet jP=Tu =LE 2PyEM=LtfA=Tt}f}ЍXE؃U RMQP~] =Tt}߸f=LtUfD}߰Ѝ\jhSURjhM QuVLe[^_U,WVSPEUU Uu9v= EPE)PV5 Yƃ|E)PEPV9EuEE;uvU8VtvN;uvE8FuUE;$*EPjjRVh[ u EUsEEPjjURVh!ƋE E)PEPV+9EuUU;uvE8FtN;uvU8Vu}|%hE)PjPVhUDà 88)߃=Lu=T-vE)9=Tt5TvRrg 4%uQ|_tJE)90vR.g 4%u <0_~- @hSD;PVhEǃ FU)9t7C%h)PSRVh%Cá8)߃ uFE9ET1EUU9s@Ue[^_ÐU WVS}+E 48v9s: tM 9vC9s; u)PR5 t jP9sC9r5 t jPe[^_UWVSPEuU 29*ЉEvEPE)PV5 ƃ}=Lt-;uv U8V7;EU8=T;]v3SvRe 4%uh{_tb;EshvRdv4%u<_u4EPOWV5 Ë}tfF;u1:]] 7)PEPRX5BuڋEN;uv~ ue[^_ÉUMU vABuAÍvUVSu]u 1ɋU AJ9r9tȃ[^ÉUWVSEEEuUPU@E }}t@CE9s2E8uEPSVTu)]1u}}tQ t EH<0 uE}t8}t,EH0E8uEPSVuM}u}u[EE@PURsÃuEPs1av]EuVPcwUUEUt*1}tEEPUR(ƃE}}EPUR"]ހ>E8tCF;t~U8u;tr{tl1ҊE8CuUE8CuEŠE8CuEŠE8CtE8CtE8CtUtCCFCF;o}HE} tUE Ee[^_ÉU WVS=eehh`޴u_j.h`ƃtGVװPRh`'QD7 RD1PV``H`=`uE D0E`|:u{Xhj3P~`=`)E)9wJӀ<3W<3.u8Chj3P~؀<0u `)ʋE)9%FE)Pj.V0ƃt15`h`FPuǡ`|0e[^_ÐUWVShutSLƅsjSމH j TS+DžXDžTPPSjV u PxuuVj"jjtװHPRPppT tPhhPujj h"ǃtPWxukju]SKju EPK jVEPKEPK j,SWx,tEURPWzWjx8[^_Ív$FreeBSD: src/lib/msun/i387/s_ilogb.S,v 1.7.2.1 2000/07/10 09:16:28 obrien Exp $v uė e%eUE]EÍvUEU щA uNu~AvH҅5v ~&HɅv~ U=eu?EEUB jjEPhejRu eeÍvUU:t2v:%uB tpuJ:$uz%1Fr8$N* Q)Ѝ( Mb)‰)Ѝ) F;u=et EMvMAMtUEEUfEE\F9~FIu`u`> gfff)Љ)‰})t<3WEPDm}=ЋUTUE)~!]EvMAMF>tFEE;&P5]}t65eEP,v=eЋUTUMe[^_ÐU WVS]} uStVWS WVSe[^_ÐU WVSEPju }+xlHy8t0Pq8|B%uxlPB84xl@t llxl@xLt@Lexl@4t 4exlBxtAxt;j*BpUt@P訶1҅t xl@ fPDxlBtFt=j*Bt@PO1҅t xl@ fPFxl@(t (u8xlPt't(xl@ǀxl@,t ,ulxl@t[tRt u@xl@t u&xlP,xl@ǀxlP fzBu$fzt@ttBfBBxlP@t"t~uZ)xlBx8tCx8t=j*Bp8gt@P躴v1҅t xl@ fPHxlBtFt=j*B t@P_1҅t xl@ fPJ}t=`thh`EPQCEe[^_ÉU WVS}=xlt\5xl1F9}J+~F")‰Љ)‹F vjPWu F CV9|1e[^_ÐU WVS}=xltlxl1C9}Z&~C$)‰Љ)C"‹CjPWuC fPnxxl@DtD赗PnB9x|F;u 1e[^_ÍvU WVS} u9}E)@Pn;1;uvM;u BvPn;~{)Ѓ)PPރPnh@utxl@xu j9PSEPPnxt+bPnUtx1C;]XE)@PP-e[^_ÐUSMPnBH9tuBH9xuQ]ˡxl@xt ~u0ۃ`Pn09ht RpOɡPntQ.PnPJy B;B| t RQ6<Pnxxl@DtD蕕PnB9x|]ÉU WVSjy9PnfbtfbPndu xtPndt2U`Qo4PnPXСPnǀd1Dnxu HnxtODn@Hn@VHn@PPnx9~סPnt6WC1ۃ9u1HnP([ f| uDn@(f|t SF HnA9A([fDA(fD DnA9A([fDA(fDC9\Hn@9*vыA([fDA(fDCA9~ىDn@9'ыA([fDA(fDCA9~ً HnyuxDnAfBfrPnh@utxl@xu jPLVSPnxtE^PntxPnht j LݑDnHnRPj61e[^_UVS @n xl@xt ȋ@% ‰ѡHn@PPnp9~փQV1ۃ 9}S C9|e[^U WVS}E E=DntYPnÃt|Ix@9}?v|"DntR(@98t8EAPnC9|E}ePn09ht RJPnP+x9r"vPnBH9tuBH9xuWxl@xt ~u0ۃ`Pn09ht R0JɡPntQ.PnPJy B;B| t RQ6Pnxxl@DtDUPnB9x|{Nxl@pe[^_ÐU WVS}Pntx09ht R:IhDT Pn@)Pxl@pӏPn@9}&vDn@(ɡPntQ.PnPJy B;B| t RQ+Pnxxl@DtDPnB9x|jUR9\M];uPnGt 3Pnh@utxl@xu j=EPURPnxtOPnMt]x);VSQEPURz tf^Pnh@utxl@xu j"=SMQPnxtOPnutxjEP9}SURMQ]SuVvu}UM;ut tNO9~;]|Pnh@utxl@xu jU<EPURPnxtDNPnMtUxSRQMQEP' 9\UUM9}MCEܡPnh@utxl@xu j;URMQPnxtMPnEtM܉xM)١xl@t9~xl@x|t6t-Pn UЉ)U97Yxl@tPn)9 /v?B$MQCP]SuVEP )PUDP9KMءPnh@utxl@xu jd:EPURPnxtSLPnMtE؉xMC)xl@t 9=xl@xTtPn)9v?BMQCP]SuVEP tg]CPnh@utxl@xu jo9SURPnxtaKPnMtxj]S-PnU09ht R 9)PPn@;E~ +EuU ]PRQp4e[^_U WVSxl@xu xuxtPnlt40u+hDT jjhPZxl@xuxl@xtQPnU09ht R*8xl@p~PnǀxǀtxlBxPnǀxǀth@u tBxu j7jjPnxtIPnǀtǀxU09ht RU7xl@p}xl@xPnǀxǀtU09ht R6Pn1fxUh@utxl@xu j6jWPnxtHPntǀxxl@p}GPnB9zPnU09ht R96Pn1fxh@utxl@xu j5jWPnxtGPntǀx1fxPnBH9tu!BH9xuEP<v]xl@xt }~u0ۃ`Pn09ht RJ5ɡPntQ0PnPJy B;B| t RQ"Pnxxl@DtDm{PnP9x|FPn@9GPnB9kPnh@utxl@xu j]4jjPnxtPFPnǀtǀxPn1fx~Ev1fz~*Dn@(M FPn@9|GPnB9|e[^_ÉU WVS}u xlBhDT VVBXP?zxl@xt ~u0ۃ`Pn09ht R@3ɡPntQ.PnPJy B;B| t RQ Pnxxl@DtDeyN@Avxl@x|&p|&yvxl@xt ~u0ۃ`Pn09ht R@2ɡPntQ.PnPJy B;B| t RQPnxxl@DtDexxl@tCxNxl@ x vxl@wxl@xt ~u0ۃ`Pn09ht R1ɡPntQ1vPnPJy B;B| t RQPnxxl@DtDAwxl@twNe[^_ÉUVSuxlBt'hDT VVBTPv$19}xl@pTvC9|e[^ÉUuvuU WVS] uM}xxlB99MPnh@u tBxu jp/jEPPnxtaAPnUtǀxU09ht R /hDT jxl@>}xlBxX9MPnh@u tBxu j.jSPnxt@PntǀxU09ht Rg.hDT jxl@pXxlB99MPnh@u tBxu j-jEPPnxt?PnUtǀxU09ht R-hDT EPjPxl@xlB9MPnh@u tBxu j8-jSPnxt,?PntǀxU09ht R,hDT URjRxl@NQP}sxlB99MPnh@u tBxu jd,jEPPnxtU>PnUtǀxU09ht R,1;}hDT jxl@rG;}|xlBxX9MPnh@u tBxu j+jSPnxt=PntǀxU09ht RI+1;}}7vhDT jxl@pXqG;}|vPnl0xl@x1;}])Pnh@utxl@xu j*jSPnxt<Pntǀx1fxPnBH9tu!BH9xuEPv]xl@xt ~u0ۃ`Pn09ht R)ɡPntQ1vPnPJy B;B| t RQPnxxl@DtDpPnP9x|8FPn@9G;}l1e[^_ÉU WVS]uM}xlB9u 9Pnh@u tBxu j(jE PPnxt:PnU tǀxU09ht Rp(hDT jxl@O}xlB9Pnh@u tBxu j'jE PPnxt9PnU tǀxU09ht R'hDT jxl@vxlB9u 9Pnh@u tBxu j<'jE PPnxt-9PnU tǀxU09ht R&hDT EPjPxl@xlB9Pnh@u tBxu j}&jU RPnxtn8PnU tǀxU09ht R-&hDT EPjPxl@JPlxlB9u 9Pnh@u tBxu j%jU RPnxt7PnU tǀxU09ht RT%1;}hDT jxl@kG;}|xlB9Pnh@u tBxu j$jE PPnxt6PnU tǀxU09ht R$1;}}7vhDT jxl@kG;}| Pnl0xl@x1;}] Pnh@utxl@xu j#jSPnxt5Pntǀx1fxPnBH9tu!BH9xuEPv]xl@xt ~u0ۃ`Pn09ht R'#ɡPntQ1vPnPJy B;B| t RQPnxxl@DtDIiPnP9x|pFPn@9G;}l1e[^_ÉU WVSu] }xl@uxXtxl@uu *vPnh@utxl@xu j!jSPnxt3PntǀxU09ht R!u$xlBxXthDT jBpX6vxlBt.hDT VjVBEPg-v19}$hDT jxl@pXgC9|ޡPnh@utxl@xu j jWPnxt2PntǀxU09ht R u.xlBthDT jBgkxlBt*hDT VjVBDPf/19}'hDT jxl@fC9|1e[^_ÐU WVSu @n xl@xt ȋ@% ‰U}RVjEPU RMQǃ xl@x I}u uxl@tRPnE9tt H9tu8xlBt&thDT jBehDT jURM Qxl@p ]CPet%hDT jxl@hevPnǀxǀtEPURM QRQEPǃ hDT jVjxl@p BPdPnǀxǀtu5PnFtURE+E@PM QEPǃxl@xux 9uy9uxlBxtx]+]Pnh@u tBxu jjSPnxtu/Pntǀxj v1;]u)ޡPnh@utxl@xu jjVPnxt.Pntǀxjj ]C;]|\vURVjMQE PEP_ǃ xl@x 2} tTPnM 9tt H9tu8xlBt&thDT jBbhDT jEPU Rxl@p t@Pbt$hDT jxl@bPnǀxǀtMQEPU RPREPWǃ hDT jVjxl@p ?PbPnǀxǀtu9PnFt"MQE PUMDPPǃxl@xux } 1yE 4Pnh@utxl@xu jjVPnxt,Pntǀxjj CE9{t>UREPE PMQ5Dn*d EPU RMQ1ve[^_ÍvUPnǀhHn@Pnlu"xl@tU`xl@t `xl@t`xl@t_xl@t_xl@t_xlP\t3`t*@xt \xl@`Ph_ÉUÍvUPnht jPnltt0ukƀ0hDT jjj:Pnƀ0jPnBHPxtF*PnPJtǀx jj ÍvU\WVS=Pnt+Pnduje9u{UuVjV jV]SVjb jSǃu'VjVH jVjb ]SjS ujSjEPj|bE]ȍEP^E uVSj%bjfPe jVjbd'TjEPjbe[^_ÉU VSu=F]EPEEjSVa Lnty=Pnt=Pnxt2@@P\tPnƀPnǀDT S =PntPnǀd|uj=ULntƀx|uÐU$S]EPjS`u(}t u}uju S`1]ÐUSE=uhh=tjhj2`h? Sj+   Sj Sj4  Sju ]ÉU WVSEPnPnpiPnB DnB$HnB(@n$g,geD؍e[^_ÐUS]t!3s S ]US]Ln=Lnt=9Lnu|Ln(v||t9|u狃||s Js$J s(Js,H s0: t P (t(6 t t sg{t0{t*sBt^8 us S ;Pnu<DnHn@nggPn]ÐU1ÐU1ÐUÉUÍvUÍvUS]EjEPSƒ}u]v|xl@ HЙE E8t8;tEE8t8;uE8;uEE]ÐU WVSu]E fEhj诜PnPnLn|LnjVPPnxlPfXfXUfPǀtǀxǀ|ǀǀǀfǀ\ǀdpǀph  Pn %Ƃ0Pnƀ1Pnǀ4ǀ8h3 t?h3l ƒPn4PR*ƒ Pn8PRPnǀHǀL ǀP ǀT ǀX, ǀ\4 ǀ`ǀhǀlǀpxl@ fx~F¡Pno@с<xl@ f@xl@ǀH=PnDePnƀGPnƀFPnǀtǀǀjjEPPmGHnjjEPPKGDn_Pn HnJ$DnB ǂd ADn@1e=ex}ۡe8};jPn@)PuVSFeHVQ@=jjEPSFeJEPQBСPnfXPnf)Xee Ge8t 6ejjEPPn@lPF‰@ntPnP(J K1e[^_ÍvUUu13=es eU P@e 1ÐUUu1vu }PU=Pnu ,PnǀdP\JU WVSPg+Tg+Lg+Hg+tg+pg+xg+|g+dg-g|Xg+\g~lg_ g+$g:8g'XfvTf^@g#Dg#`f#`g-hg-g<g>g*g!gfxl@ltlQxl@Htw1ۋHЍx9sZ xlevAH}u8g9uEgt t vtE PEPWR)}cg@t3xlBt!E PjBM%g=gxlBtE PjB=PntPnEt:t2xlBt E PjBM=PntPnDt4t,xlBtE PjBLg}u }g9*}tEgxl@ uU RjEPEPEPEPEPEPEPEPEPxl@ )0PKg}u }g9u*}tt Egt t~tE PEPWR '_v@t2xlBt E PjB#K=PntPnEt:t2xlBt E PjBJ=PntPnDt:t2xlBt E PjBJt:xlBt(E PjBKJE0 g}tKu}tAg9u#}ttEgtttE PEPWR%@t&xlBxdtE PjBpdIt&xlBxhtE PjBphI t&xlBxltE PjBplbIt&xlBxxtE PjBpx4It,xlBtE PjBIt,xlBtE PjBHt,xlBtE PjBHt,xlBtE PjBdHt,xlBtE PjB0Ht,xlBtE PjBGt,xlB tE PjB Gt,xlBtE PjBGt,xlBtE PjB`G t,xlBtE PjB,G@t)xlBtE PjBF}tM =PntPnUh Eg1e[^_ÉUhDT uNU1ҡxl@xdt@xl@xhtxl@xlt xl@xxtxl@txl@txl@txl@txl@tPnltÐU VSEu u @BZEÀ;);${<j>Sf;>@EHˉ=w%1tЉEE\;*u uEI;.uCC;>t==w%1tЉEE]EC;>`]Pnu @ PnۀE]C;E}fUf fUm]Eme[^ÍvUSu uk@BtPnIșȋ]ÉUxlBx t$Pn@HPjBp !PCÐUxl@xptppCPnǂxǂtptpǂpP=ÍvUS Pnxl~_Й Pn ǀjxl@p4¡Pnjxl@p0¡Pn jxl@pH¡Pnjxl@p8¡Pn jxl@pD¡Pnjxl@p,¡Pn jxl@pL_¡Pnjxl@p|=¡Pn  jxl@¡PnǀxlBt#jB¡Pn PnxlPB(uB<jjjPn P¡Pnjjxl@PP¡Pn jjxl@P¡Pnjjxl@P¡Pn jjxl@NP¡Pnjjxl@p P¡Pn jjxl@PK¡Pnjxl@p¡Pn jxl@p¡Pnjxl@4_¡Pn jxl@pT:¡Pnjxl@¡Pn jjxl@P¡Pnjjxl@P¡Pn jjxl@Pv¡Pnjjj xl@^PA¡Pn jjj.P¡Pnjjxl@p P¡Pn jjxl@PáPn;~ڡPn9~ЉxlBtExpt?Bpp6[t$xl@ǀxl@ǀ]ÐUjPn@HPjjPnpt j7xl@t<j ><U\WVS] EDžDžUREP9]Dž@BxlBt:MQB@P}Wb tPn9]ME)؉xlBt`Pn9}MSBPEP}WP tPnxl@x,Pn;EPMQbPnxl@1@,ǰHË;BkKdQWu7+]xlBtZPn9}GSBPEP]SP tPnxl@xLPn;EPEPPnxl@1@LǰHË;Bs*K~(QWu־@B@BUEBEBEM9MDž@BxlBx tG]SBp )PEP}W$P; tPnE9EU)‰xlBt`Pn9}MSBPEP}W蛿P貿 tPnxl@xD1hPPc~g;}YuPuGPn@$P(MI]%=w%1tƅ1;}c PnA$P(][U0;hvF;}.PnC$H(URU0;htƅtp1;};MI4Pn@$@(Uڋ0C;|Ӌ)PnPnxl@@DǰH;s+N~(RQ臽uֻ@B;PEP]S-PDmb}+}xlBtZPn9}GWBPEP]S蹼Pм tPnxl@x8hPS/Pnxl@1X8ډװH;s0v~"SPuӾ@B;}-PEPUR»Pٻt@Bu@B [^_ÐU,WVS}u;}u 9u u1PnP9|әM֋ PnA9E ] CؙA9C)‰)xlBthDT jB4+ xhj -K} ~lxlBxthDT jBp3< y ;|vhj E +Pn@H9~ǡPn@H9E~EDžDž@BV]SPnPhPEP腹P0 tPPn} ~'@9})yډ+E yЃ~} tNjV]SE PWhEPPaƒ @Bt;}Džtgxl@xtYjVURjWhEP軸Pƒ @Bt%Pn;}Džxl@x0tZjV]SjjhEPSPƒ @Bt%Pn;}Džxl@xHtcjVEPjPn@HPhEPP)ƒ @Bt%Pn;}Dž} ~ Pn1ۋxlB8tzxut~pBx8tgjVURPn@HPGPhEPGPƒ @Bt'Pn;}DžthPEPŶH $PvjV]SE PWEP xl@p]S%jVURjWvxl@p0]SjVEPjjxl@pH]SͶjVURjPn@HP} ~xl@pEP?xl@p8]S%jVEPPn@HPGPS0@BthDT jP.1[^_U=PntPn4vÐU=PntPn8v1UEȣUS]M xlBt%QjSB P@.4QjSPxl@ P .]ÐUS]M xlBt%QjSB P-4QjSPxl@_ P-]ÐUxl@t +xl@u1vxl@-ÍvUWVS<t)hDT 5PhDT FPt xl@ fxPn xlA @,gjA @P>q¡Pn(t|ơPn( fxl@ fx|FPnxl@ @$gǂl@P¡Pn u xl@EhxtE1;g=PnxlEgUv# [uTfT [ ؅}C$)‰Ѝ@UUDfDuFxt [fDBdN [f<tf [f|tfD [f|tfDC;]*1e[^_Uft7vf}|E;g}f|;g}f}~M% MPnU(f%tukF ]]EEE|DžxDžt1E%A>vXwD$AuGA}tE Ex1TGEK}u:@=w%1tTPЁ'~EGA?ta}t%1DžtDžx|%AA}ttxt;x}xU]l $h%@;v P, 1҃=~ $t =ӋUD;v PmSWg=~& $u t װЍX;v PSh"vg=~& $u t  pl]װЍP9~ڡD;v PplRpQP=װЍDFσtE܃<t$=Tƀ$zESF<w;1҃=~ $t <1҃=~ $t  F<w<F=ƀ$ FF1 \BF< v= ƀ$ 1҃=~ $t 1Ƀ=~ $t 1҃=~ $t 1Ƀ=~ $t )щmv1҃=~ $t 1Ƀ=~ $t 1҃=~ $t 1Ƀ=~ $t ȅtә11҃=~ $t 1Ƀ=~ $t ȅt љF1?11҃=~ $t ta.11҃=~ $t u,1҃=~ $t t=ƀ$ d1҃=~ $t 1Ƀ=~ $t !+1҃=~ $t 1Ƀ=~ $t  1҃=~ $t 1Ƀ=~ $t 1{1҃=~ $t 1Ƀ=~ $t 9v1҃=~ $t 1Ƀ=~ $t 9v1҃=~ $t 1Ƀ=~ $t 9`1҃=~ $t ,1҃=~ $t ҃=ƀ$ }uE}E1҃=~ $t ulF1 v>tnF>th>%uF>?u@v>;u~?H؀>euӅu1F1 v>t2F>t,>%uF>?u@v>;u߅~H؀>t F> =ujjxXu1vH[^_ÐUS]{t SG{t S=]UWVS} ]}E@8Et{U9Z0u 9z4|f|b}tMATS}tMA@980}t UBT8W}tMA@9 ~kEPUZ0z41]/MI(Mv]E@(EUMً]GF}tMA@9||1e[^_ÐUUE uB1ÐUWVSEx8ǃ8G8EEGuoW(UMI4\2|FG4@MQ( ET0G0fytA9~fYfytA9}fQEG9E~88q[^_UWVS}Ex8P8URE]CEUB4]{(@ f||[E@]C(4DS0)L)х}1ۋUB9~f~tF9~f^f~tF9}fNE]C9Eqe[^_ÐUS] CC0PC4Ps8[8t{8u֋]ÐU WVS}t'UB PBPB@PB@Pƃu 1 vMAfFfAfFAfFAfFA fF AHfFHA $fF AFAFAFAFAFA F A$F$AFAFF0F4F8A,fF,A.fF.Q M1FuPV(MA(MQ44GV(MA(DfDV(A(DfDGF9~e[^_ÉUVSuPnt1҅9quPntvQOF u01Fu(V([<t4"CF9~ڃv( V;5Dnu Dn;5@nu @n;5HnuHnʋ @e[^ÐU WVSu]|u|q}|k} |e}uPn@)E} uPn@)؉E U ڋ PnA9*UA9jSVE PEPƃ u1}V{1;]}hjE PRF([ F(<tĉ[ E 9s   F(9rC;]|e[^_ÍvUWVSM]}}} |{|wUU }G@9eG@9Y} uE@E EH)E u UJC)}G tVUB PBEPQM Qƅu1Wv}~4^0UBFBF1;} }-]v ][(URU^(EG;} |܋MN8e[^_UUB M)PBM)Puu RÉUE19uȉÐUWVS}u$EWt\M QtIjj PEt3jLjOÃtj WOC(uS躻1ivfCfHfCM IfKEfCMfK PnBfCHfs CC }uB9u B9E KCCCCCC C$CCC0C4C8fC,HfC.fCfC@fCDfCBfCF19}"u NC(IfDC(ftA9|}uGUU PnA9u3K }uA9u }uK EPnR9uK PntMYt؍e[^_ÉU=xltuxl@(Pt1U=xltujxl@(Pt v1Uxl,P}t "xl@0t@ǀ1ÉUxlXP5u xl`\1ÐU=xlt]xlXP0=Pnt9=@nt@nx t jZPnx u jp1vÐU=xltI=Pnt-jaPnx tjpNxl,PÐUh5ÍvUhQÍvUVSu] h-uqV蕢PnӉP tVll ~ Pnxu-SƒtPnPS%PRV!e[^ÉU WVS}E t55Pntuxl@x t_F1v[^_ÉUVSuU tPnt FG[^ÍvUS]C=w# PnC1v[UUE t<u B$ B$1ÐUUE uB1ÐUUtE B$ÉUUE uB PÍvUSM ˋPnÉt%xl@t#uxl@tu1]ÉUVS]Pnpw_9u t' t9evu]xl@xPt/pP?xl@x@tp@(xl@x4u 5vxl@p4Pnpte[^ÍvUUPnP1ÉU WVSu] u1<C 9u,13VusVte[^_ÐUPnp,uÐUSEÄt xl@dt du+xl@`t`tPnx4uPn@41]ÉU1҃=xltExl@uux|t%txl@xTu tÐU1҃=xlt6xl@u txl@xXu tUVS1۸g=gtKgv<2w'Pxl2@4Pn,PCg<ue[^ÉU WVS]EfEu >=hlf;tj;[{t8Cu ;빐j jFCtÉ`j jFÉ߃uGhl_j jdFÃu%hlt9;S-u#CFuEfC e[^_ÍvUS]xl@xtwS cnlPغh )pl~vllPtlЃK=tlDT u 1]ÉU=Pnt Pn@P衛ÍvUM=PntVPnt4MjEP=Pnt Pn@@PEv=Pnt Pn@Jy B;B| t  vRQz1ÉUhDT juÉU WVS]}tu =xluEwExl@;Xt;uEExlBxuJB fx t@=PntPnu)nlP¡xl@ @ 9|E1=w%1=w%1ttPCѐ4;.uOC=w%1t t0C=w%1uۀ;*uu C=tl;;$tP]C;S&uj$׃j<׃ g1ɉ=w%1tLPCѐ ;.uOC=w%1t LC=w%1u۰;*uM C;*t;/t~1}u }ut!gfff)P;t Cyv~*}u}tgfff)P^tlDT 1e[^_ÉU,WVSu} EfEUfUNEE)9|9E)EvF([URMQ4U44K;]}])9}9)E1Fu$[EvF(MM BF9~C;]|΅]E)99E)EvF([URMQ4U4蠰C;]~])9~6)E1Fu![ F(}HfCEP1e[^_ÍvUPnf^u Pnf\uefǀ\f^u fǀ^Pnf^Pn^f;\u fǂ^Pn^f`JvPnf\u fǀ\Pnf\Pn\f;^u fǂ^Pn\8U1UMU t A9}A(Rf|%ÉUSEt*1@u"X(HRf|t  B9~1[ÉU WVSuM ]}t| |F9~kʍ9}`F9XىMN(Ru fD fD^(R t FfD fD B;U}F9~1[^_US];DnuC^+vS'u{t Hn@^C]ÍvUWVS}t E@ t UR fUMYHnQPQPQ(E` PfUfEfXHf]Mf;HHnf;XE@R(<E@MQ(Efxty@EE9E~EURfUu‰;ELUދ;t,fu fwfwf;w}fw f;w~fwfEFM;M~MfAfAfEfEUEf;PHnMf;J)Ext @Hn@Uzu"HnRMffQHfQ fQfPHnMAB1e[^_ÍvUMMb)‰U)Ѝ))ȉ)эEPjP1ÐUSExlxlt6fnlxl@t ll؋]ÉUS]t*SQS;xlu xl1]ÉUS]; u $>|.19u Aw9u닂$[ÐUSE|/19u Aw9u닚[USxlXP质ÃSfnl=xlt xl؋]U WVS]3{C @tf;s}c C @u f;sf;{~ bvS_Eƍ@S(fztf9z~fzCfBNj C9w U9vS1e[^_ÐUE@ÐUEM P u@t0 %v@0t0 Љt0  ЉÉUWVSuE @u#ۃSuEx^M V uFt0 "F0t0 Љt0  Љ@V(fzu fZfZB9}fZB9~fZ CF9~BN @ff;F.~$F.fFfF~jVfFDvf^8vFEE t*  E=ll)E~u F.9Et F9EE 0 EF;Ev}ӉV uFt0 #F0t0 Љt0  Љ@V(fzu fZfZvB9}fZB9~fZrxl@(PtYX EPhht@xl@(P)} ) 8u  8tʃ;E>E;~>(xl@ fx~f8~@xl@ ;~> PxlP fBxlP fxl@ fx| @l le[^ÍvUEPEPj=PntPndtuudÐUVSu] j/Vt1tSPV$tSV7uE1f{tvC<}BC9|1f{ tC]vRzt 4%uh^t Sփu Sz1PEPSr=mt,mmt‹ƒum$n[^_ÉU\WVSEDž1m1mt|9vj31tQFu'01Ph/hPRG ~ 31PhIhP- u~. XxPPhPj x,~1Dž,n mDž;B(010‹IL,D4ƅRF[m tPR4;t-hQ30tƅu}1 EPPP!udh贀Ãuh[ߍu C(Rƅu>(nRhMcZI;H(StQ 1vmNz(Dž;J(}+0Ix(A;H(|؃RQ>fx(t4Ã0B(H@4Q1TH(uӃRQ Txtpz tr ytq  m1ҋfxt#A<uBA9|1ҋfxt(vA f }t}tN}ttvEF"EVUN"M^$F$ȉEFEV"F$‰U^&N"F&MF Eq^"F$F&19sCF4U R*u#F"V$9wF"9ȉMG9rEv1}E9sfE PF4ƊuE|?}+UU}t}t )}t!E,E'EvG9r}4}t_ }t}fF"fFFPv(\F^K;]VDK;]w~fF$fFFPv [F ^K;]vRV DZfZK;]w ?uv8$=8$tb5m7輆uAhw"Ãt.}u ww7hn> ?u5mÃuq=mtAEP5mUR:Ãt&= nv5mh =u#}5mh"=}M9Ku=:=mu&=m%P!Pjh:A}uF==mu/=m%Ph!Pjh=!à t}u{u E_v}Ct"t "t @HOW5mPh`<h} }t~}}Ct, t*t3S]C SMA fPvS]CSMAK]S mfJ5m=mu!CEPV5m9%ƃV3S]C \w7h ;Fw7h;2}uhq;,=mu:PEt AEP=U29P:0} =mumEj+M1RtE71ۋE;X(},j+[E,4"uECU;Z(|փEPMQ}v]SH EP21e[^_ÍvUMU u tu 9$uGyuAǍv:$uGzuBǍv9u :u1:u ABKv)‰UUtE EUEEPu6ÐUWUt#װuPu u}ÉU<WVSE UBu((t(0‹MA]Cu%,t,0‹CUBxu[B fxD~6@DPhӽh۽SaSb0‹MAP hӽC0‹]CPUBx8B fxH~7@HPh׽h۽S0aS/‹MAP8 Lv]Cx%uh׽/‹CP8#EP4t4t 4B8MQz,0t0t 0B,i]Cx)t[C fxF~6@FPhսh۽Sk`S2/‹MAP, hս/‹]CP,EP@x&0t0t 0B,nUBx)tbB fxF~:@FPhսh۽S_S.‹MA !vhսk.‹]CUBxBx)uVB fxF~<@FPhսh۽SI_S.‹MA +hսvUBx xt~tutlh VS2MApS2 UBS2V_-‹MA}]Cxtyxtsx,tmx,tgh VS1UBpSE2 t3MAp,S,2tV,‹]CUBx+tx'u MA@]CubC fxJ~:@JPhٽh۽S]Sf,‹MA !vhٽC,‹]CEP fzu@x*ufBUBxuh+‹MAP]Cx*C fxt!fxt@Ph3UBtPhٽt'MA2Ph@a3 9]CuhٽH+‹MA]C f@UB8_8Rji8Wƅt ymMA8v)Dž8t)װH9u׃SVRuŋzuVShZ2Ay3h1Ãhpƃ tuh2vSMA<u3h1FMQ<tP4C4yV]C4"1P0ph |1 fvS]C:t':$uzuvAB:uP+)V]C Fj,Vc*t4EP4u% t 4UBǀ MAxAuh׽(‹]CUB<uh׽c(‹MA<]Cuhս6(‹CUB@t @ MADt D]CHt HUBLt LMAPt P]CTt TUBXt XuhMA\t \uP]C`t `u8UBdt du MAhhthVS+UBHS , MALjjSZUBHjkSC MA@jlS)UBDjmS MAhjnSUB`jqS MAPjtSUBTjuS MAXjvSUB\jwS MAdjxSetbV%‹]CHh`-tŐEP4-su"j8 9zuB9u C<u냍ve[^_UVS]1Ɋ@t$<|t @Awt<|u@[^ÉUWVSMtnv9tf] AC;t:t19t0vU:t:tB:t :uu1A9uӅt ;u Au1[^_ÉUWS&=muzh RÃtd߰Ѓ =wJ߰Ѓ PzOmuh%y*Sh35mRm1e[_ÍvUW}twP?t 7 PtwO tw OtwOtwOt wO1 }UEmmÉUlWVSE=dt+dh@(dO t  ǐc ƃ t t t\uG t t tƃ=a:u :u ƃ.u)=mu Evƃ.t t tvV<>v4%ub.u =muTPh@u:VF$Ph@h`^' aP{v`a=`i=mmm(nmm<,uma,\u t t tƉCƃ t5uh'v:u:,tma:=muHma:UhhPh@;&v=muvK; t; t;,tCj|h`eÃu`Ѝ_3h`%j|h`ƃ t>uh%u`Ѝ_`9s]vR;v4%@;/Ph+茼C9rm`/vVs; 4%u=mu _u;uCƃuC:t='#,t=3@t2ya9t h8%m`1nvOa9tV Ph`h$ m`&v1ƉvVZ: 4%t D/GNv]jEPS0Tǃ9]uh`h#E8u a9tha#m`=mrvh`Sza9th#m`m) VPh" }uÉ؍e[^_ÉUWVSuEEE_^}%É߃uh'N#w)vW8 4%uWPh5#" ?u'F= nhN!}s\[É߃u!h'"P GЃEEÉ߃uh'Y"CЃv3w%1tShK;/K=w%v1uڀ;.tՀ;*tЀ;\u#~^t~,uF h >$uO~.t>*t >/t>>uFǍvN>%u"~%uh'EPl>%u} h IEPEPh'V豕u!j;VƃuuEPEPEPh'VutTEPEPh'VZuj;V解ƃuuEP7EPEPh'V!u-j;Vnƃuu}W>E؃ vVtƃh(EPQEPh(V趔tEPh (V蜔uPj+Vt>ph%}WE؃}tEEuEPvjh%V̡uh-(jh$%V褡u!E}h0(EPljh,%VluE}wh3(4FN7$D( %h EP %h }WE؃=w%1tF h EP뻃Ph6(w>d1h%vh<(EPjh%ZF>1u E>2u/}us}umh?(EPJEEMv>2~E1bvhr%}WE؃%v h EPE؃E>tF>t ;u1}u e[^_ÐUS]fC,fC'fC fC"fC$fC&{uj,.C{ ujN.C {uhxw.C1f{tvCBC9|1f{tvC fPBC9|1f{ tCBC 9|@]ÉU WVShjÃtߋuEPS؍e[^_ÍvUWSU@װ׍;=wR@ P:=@@ e[_ÉU WVSu-@ |1f~ tF~N <u #F DnQ(1IA~vIPn4[^_ÉUWVS]} Pn&U)؅}H)R PnRP苜u)9)؉E DnQ(v1IA~IPnN2~S[cE>FS(EC(C(C,S:E4vE>e[^_UUB(;B$u1)J(A;B$ry tvH;B$r8 uR()‰HÍvUS]S<C,]ÐU WVS]} t C<C,;C0r ${<un{4t80$C( $0$jSjSC(C(C8ScD v{4tJ1;s<}$v0$C( $F;s<|ߋ0$s]ÉUÉUuU1ÐUS]Eǃ C,u/hs$C$S,)‰C<Sd<uESPS`2}u1]ÉUUǂ B,B<)ȉ|R%ǂÍvU WVSuEdž@dž F,}džSvu/hv$}F$V,)‰ jjЃtX1ۅV>;cjjЃtX1G;~-vGjjЃtX1ۅt>V$F,)PRS7\uF$V,)‰Ѐ<tSV=tE}tVG%e[^_ÍvU WVSuEdž@dž F,jjЃtX1ۅVE=nvV$F,)PRS=[uF$V,)‰Ѐ<tSV<t}jjЃtXv1G;}u}uV<u EV %e[^_ÐUS]S=S(: uJ;S$r%: u K<{<~'vJ;S$r: uK<{<{<~ )vJ;S$r: uBI~ ;S,s: uS(]ÐUS]SS(;S,s#: u K<{<~%B;S,s: uK<{<{<~ vBI~ ;S,s: uS(]ÐUVS]C$C$C,C(jSC( C(C(:C(C( C(S- VS 0C$C$C,C(VS$t[^ÐUWSh#Ã1E @C ECuCCPSEJ ShS SSk S_9S: S&SECǃ1e[_ÍvUS]t|SySdJ SgS SS S9S S-&SE 3S]ÐUS]SmS]ÍvU\WVSu} M E$b1V%11VyT!1VE9tNf1AEt]vB AuG$bEbEPRVEbEPRV\EbEPRV]jEbEPRVK_REbEPRV?m:vQA1PRVR A1PVZ e[^_ÍvUE$ÐU WVS}E uC:uQhbƒt;hbRhbhS8؃ hbP ƃuEbV 퐋| uRW9 ÃtÃPVsƒuV 1[^_U0VSu]S]jS EPSjH9EPEPVT tuuVyUjEPj9e[^ÍvUUE ÍvUEu1US]C(;C,u2;C$ujhcSiM4Z0SQsu hyvuE8uhysn1uPWEPVqe[^_ÐUVS]M u< u5;\u X<u;Xu\<t VS e[^ÉUEU :uh zpmtRP1UVS]u u>t1"jVS(VhLzssme[^U WVS] }u:u@{ t&WEPt 15[ эvC{tC{t[믐e[^_ÐU WVSu} :t<~tF[{tC:u{uPCsG?~ tv lF Ftt,"t#u~tvvEF}t  }t *t!UFGE0菵F3Cv~ uPNF UREPWv 1e[^_ÐU WVS}M 1:t,ڃ{tCRztoB:uzt`֋^A9u t*/v{ tFQC Pu1{ u+uCCFCSv1e[^_ÉUS]tk{ ts C sCtt+!t#u{tsvS]ÉUS]j@@@ @]ÐU WVS}u ]U>uRSW1xv:uZPRƒ{ tF[ B붐~u>D"DsCPW1{t [se[^_ÍvU WVSu} ]~>C"DhzvpihzvZi~uuPSƒ u.D"DwGPV5vBPw V@t SwV*1e[^_UVSu] MEtmt t.XuSzuzRP1Pvt :t8;Bu2S5\tvShvhzS5\tv4h[^ÉU WVS}] uu;^C;@vvV 4%t";^Cu ;?v$ @^u;\C;^\u;\C;\ tQvVZ 4%t.vV1v4%@u%;\C0;C$0;C$0;؍e[^_U WVSU}] ?t] C:u^C@Cvր>vRv4%t^C>u ?$ @>^t>\u\Cv> tYvR' 4%t2vR 4%@u$\C$0C$0C$0CF> ?t tGCE e[^_ÉU WVS]hXh\ǃd`tǃh`vǃl`u hDxƉthlRƉx [ǃ|[S1e[^_ÐUS]XǃX\ǃ\ǃdǃhǃl tǃtxǃx]UVSE\vS 4%t3C~ɍe[^ÉU WVS}\X1ۀ>/tC<3/u~01ۀ8/tC</u~puƈ]E3t8 t1"t($Ej3PW PEPWvC~E0e[^_ÉUWVS]\XElMhǃp`S1҃M 2:M B~SjSN S Be[^_ÐUWVSu\XEddžp`VJ1҃:E"B~VEVEEE jj(VPEPV:jVM VWAe[^_ÍvUWVUE ƿzu R"%ƿzt Ro1e^_ÉUVSu];t{uXhzPSct9t?E v9At 9u#1Phzv"a SVV[^U WVS}u M]Ȉf؈f<1"u;9hzPPPhzw`t:ti19BuW9tc2hzPPKPhzPP,Ph{w`? :uOv2hzPPPhzw_[^_ÍvUVSuh{v_11ۃ\:tCPQRVكC~؍CPQ\Vch2{v__11ۃ X:tCPQRV2كC~؍CPQXVhL{v_ hzV>hf{v^ hzV=e[^ÉU,WVS}Dž}u v\DžDžDžMQv:-B$ |vXvDžDžzDžnWWKt;s3hz{w] ;uBPU2h{w]FM#E<uW|u3U4FPyÃuM1h{EFtXtSW;v{u<uSW"E<u3tSW;vSRWt$wvgM4PvuE0h{vt'RQWPSWU:%vPRWPSWE4WMuU42h|w[t'QPW8PSW9kv{t2RQWPSW`1SQW v?v1[^_ÍvU WVSu}|} t }tu Pxx[Ptυt|xt:tu߀>t F>uN9us~ tu;t C;uK9s{ t]E8u ?;uv 9vNK:tFuC]u]܉u]؋U:tjE;}s^vU:uNu;MsE9sFA;Ms ;us:tE+E܉)9}҉)9~]܉M؋UUuC;]r?tiEuU9sZE:uL;Ms;}s:uvAC;Ms ;]s:tE+E)9}҉+E9~ }܉]؉uMF;urE+E UUEEU)E+E)‰UԋE+E؉EЋE+E)EЋUBPuE}~EEEUU܉U؃}~ EEUUU+UE)9} EEUUE@PuE}}UUUEE܉E؃}} UUEEU+UE)9~ UUEEE+EUUUEE܉E؋U)E+E)‰UԋE+E؉EЋE+E)EЃuURME9Et9}}+E EԋU;BH+EPRE9EtcURWEPURWEpHE+E PU REP0])+]SUԍ4:VEPuSVEEP])SWURQSWEPc}u+u VURCE9EtP]SURBSEpHVU RP0])SWEPSWUR ;E)PWEPE+E U+U)PURN E}E+E EPEPU9Ut2EPEPE+EPUREP26E+EPUREPE+E U+U)PUR 9}u+u])9}+EPEPU9Uth)]ԅ~3SWEPURWEpHE+E PU REP0])+]SUԍ4:VEP\SVEEv])SWUR9SWEPK }|qE+EPUR3E9Et<}~UREPUR"E+E+EPEEPEPE+EPUREPe[^_ÐUVSMU u1 BAC9s:u9s  AC9r[^UWVSEPHU@$EvEF u1 ut}vFuovSӡ 4%tF;u~>6vS蛡 4%u ;u~+uG;u|1GEEU;B(HWURVEP :'e[^_ÉUVSu] S&VFFFF;FH|$FF j &j &e[^ÐUVSuF(X t;F,tV3vS蓠 4%t&t @?j^V/vvSC 4%tSVMvj\V0PV 0PV؃0PV %e[^ÉUMAA1;QL}AB;QL|ǁ ÐUVSuFPtKjV1ۃ; %vSVvHV. C; ~ރjV_' VMj $ j $e[^ÍvUS]h1ǃǃƃǃ1]ÍvUS]ǃ]ÐUWVS}] SWtAjSuVfu&jjjWVd ؃V1ۉ؍e[^_UEu vUWS]CD<1pu`;X%C(+C$=~ ǃ|+s$He[_ÉU,WVS]C(EwUEEU} C,D;C0 u3w:.*EEC, C,wuw S,FC,>uS,wC,p9sS,FC,9rC,SEPS tjSF%XE`'wr$}vE S,EC, EdvETv41E<t= <t<vEvSOvF9C(DC(h js,Pƃ,C( S,C(C(C,9s(s C(8 t~SEC(C,S<TvPh}$9vEwhwSEE C,K,C,;C$v8 uC,}HE]N;v>[t>]uE}[}tg;} ub=w?uIt ǃ ǃS-<u SuC,C$vC(uH@C(.*C(;C$r!;C,wW@PSE<uVSDu jS覻 jSAE}t(uC,vC$C(W@PS0}uASE9tS<US(w?w:WSE<u=w?u }:uE}t }uZ}uTEwU쉓E9t Su<u /vUS(}u Sk}u }Ee[^_U WVS}ƅ.ƅ*G$G$G,G(E jWG( G(G(G(} u/v?WPW&p uG$G$G,G(8.8*hPSS.@*hSP(.* 2.F*FhP踃E GDG$G,G(} ujW諸<t&jW=<uWy8t&WWG, G,G,W[^_ÍvU WVSu} }u/^(;^$rKvWSu K;^$s/v^(1*^(vWSuC;t;^0re[^_ÍvUMU QDA$A,t t+vjQ9%jQ}%ÐUVS]u S(MIt9uJ;S$v9us;S$r u9t:9u}tBS(@uS)1C(S@e[^UVS]u S(MIt9uB;S,s9us;S,r ;9u}tJS(@uS1C(S輧e[^U0VSu]SVS蓯 EPSj t tDR5w%j5wڴ <u5wI$v5w.5w(1Ƀ=wt#;5wtwvA<t;4uw4V֬jEPjB Vje[^ÐU0VSu]S jS肮 jStjSi jS[jSP jSBjS7 jS)EPSj j$m1҃w=wtB€:t 1BA:u苅B9rMyT󥋅UBX=~hցr0.MQUBXBTP貧UBX@BX[^_ÍvUVS]sHSC`@HCH>@FS e[^ÍvU WVSuHF@P!1ۃ;^}@PC;^|FExF@Pܙ1ۃ;^}@PęC;^|FEx e[^_U WVS}wGt+>tv3r;uV^w G t'>t3:;uV&e[^_ÉU WVS}E ;G;GL+w~R~%W\z|tB|8th{ VVVr|r19}j NC9|GW\tP8tE؃zhtBh8u.h{ PPPG\r/P@vG\xht4@h8t,1ۉ9}"ލvh{ jG\phC9|E Ge[^_ÐU WVS}E ;GGH@9E } uj [Gvu +wFv*W\zt!B8th{ E PPPr~3W\t'8th{ VVVvGPtEG%U 9t09}u j 9|E %GWE )POGRWڃ~;O\t/8t$h{ RRR-PbGPt؋U M 9 &;E ~j G^1ۉ9}ރj C9|E Ge[^_U WVS}u ]~ GH@9PF GKue[^_ÉUVSu] FP;^HV\zxtBBx8t:ztB8u'h{ SSSF\px,PvV\z tB 8th{ jr F\xt*@8t"rh{ jF\psV\z$tB$8th{ jr$pe[^ÐU WVS}u ]\GPR;_HIW\tS8tHz4tB48u5h{ SSSG\+PSVWAW\z8tB88twz(tqB(8tih{ jr8_PF KuW\z<tB<8th{ jruUzd1Vrd(ǃuhEpuVh Ur'h`Mq&UB`@PB`@@ MQ`BBw=wjSEPU;uhӁ+‹MA`h|+‹MA`P ha+‹MA`P hmI+‹MA`P h+‹MA`Ph+‹MA`Pw =wt*V3+PSEP ;u܋UB`x@PMA`x@EP`BMALBAHQPPEPV URjPj MQy1[^_ÍvUWVS]} uC`@C`@EPhht@s tEfxt@f}tEEPhht@s ItEfxt@f}tE1ɋS`B;uB;tȍe[^_ÐUS]M UC`~P v@PC`H@SS*]ÐUE@h@@@ @d@@@@ @$@(@,@0@4@8 @<@@@D$@H @L@P@T%@X @\UWVSu^hsCEPhDyVds CEPhHyVO st<>u%EUt DPS]SͰ>Ov<>"uISWEP,EU| u D>EUt DPS]SxE} e[^_U5@yuTÍvU5@ytÉU WVS}hwhw G`pphwGP@tPhwGPtPh"wtw_\=wtR;t$8thzP3;5P6vh=w >uwj R1[^_U WVSExxp@Ew;t18&Usu/UBPtOP5pyMq[uxuUB`x tOR봋u}u EhpuMпtuUB`p5tyr'MuUB`pljw;t4M13Ŧu-wuV\;uPE0@ t :uPM1h31;tLv;%u>CMw$ԄvG$tPhEpC;utn t vEU:t(8t!Ph Mqh{ jVEE8t8u!Rh`Ur:1ۃM1ƒEu>t(8t! Ph Eph{ jRSRP(vtWhMqOEu>t8uh`EpuU2;ÃEM9t8uuLh`7E0ƒEM9t.8t'uPh uv(vh{ RRSPP)1[^_U WVS]EPs l 󥍃l lPp4t%=%}RPPERE 0:t9:t} E}~ERE 0:t :t} E}~ҋ! ! ! ! 9PP 1e[^_ÉUWVEǀƀxly-󥍸 @zfPe^_ÉUÍvUS]Su Sه]UEU H HJHJHJHJHJHJHJ HJ HJ HJ HJ HJHJHJHJH"JH J@!BUUE JHJHJHJHJHJHJH JH JH JH JH JHJHJHJHJHJ"HJ @B!U,WVS]9EUEfEEfE\M䋻XpulE싓hUvdMEEz=zEEUMEBUEE:Eu } MQEPSUM M EPQSѤUup0M }t=EPWS衤UM :EPWS膤Up@0: E E86e[^_ÉUWVS]Hw1Ps V%=%P􍳘V ;t!V V !;tt(;t ! ;xt(;t ! ;lt(;t ! ;pt(;t ! ptǃCPRPP1ɃR: uR A1:t1ɾRE U9#u}9}:9t#t A~ȃjS99PP1Ƀ RE Uv#u }9:t#t UA~ƒul Pjs 虁tǃ1e[^_ÍvUS]u1.lPjs Htǃ1]ÉU WVS]u1 󥋃! ! ! !  Pjs |tǃ1e[^_ÍvUS]t1.Pjs ,tǃ1]ÉUC $lC 4C (SCC C c${ wcC $K$C K$뼉{ C $C$tc$0SwC UCU1C Vvc${ wVC $P3t*S 5C\CC  C SC SB9CrCC)ƃVPelj+Kt!1;S} C  B;S|KKs{SB9CB CPs $C ve[^_UW=`~u^1@a@z~A@Z~0@9~?`~_ÉUEd~d~ÍvUS]:] u12E hhx;…u E )‰Ћ]ÉUlWVSE UUЉEԋMIMEEEEhwbE(E Eu]s cccCC{u=;tj 3cj bUM9f(]C u6u؉uċE9E''(vEEE}t EUЊEErU%$vE@9Et#MuQu]S(%u‹M)@;FӋu~'FF=vFUr2bMx'9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]'$u9utEuPVu'($U‹M)@];CӋu~&FF=vFUr2aM|&9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT] +#MME:#}uu %#EEvEEE}t EMЊE}*tf]u}+tX}?tRzv}\mu9uEEE}t EMЊE}+t }?0]]E}+t E€}?t ‹u9uN}$U‹M)ȃ];CvӋu~$FF=vFUr2_M$9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR}tE@]EP}tuF.9t v.uo}tiE9Esa}tEME}t]C 9t 3v u+u@u E+E؃PEPj #EE+E؃PURj#EM‹])ÉӋu~:#FF=vFUr2P^M #9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]S+EPuV}tP"EE}!U‹M)ȃ];CӋu~2"FF=vFUr2H]M"9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]SjuVj!]؃!vE؉EȋU‹M)@];CvӋu~>!FF=vFUr2T\M!9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]Eu9uU‹M)ȃ"];CvӋu~V FF=vFUr2l[M( 9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ";AR]؉]ȋu‰)@;FӋu~FF=vFUr2ZM\9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;ATME؋E8^uE8^uE]]܋u‹M)@;FvӋu~FF=vFUr2YMp9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT] C]؉1{u]tu؀NE9Eu EEE}t EUЊEEtT}\uNM9MBEEE}t E]ЊEEЊMu2wv}]u E@9EI}t}-uHE8]}-u6E;Er Ex[t"E;ErEx[ux^tE8]uE8-uAx]t;u9E萃EPURMQ]SEPH Ez}[pE8:du9aEEE9EUvM9M<EEE}tE]ЊE}:t&}]t u9ut}tEM E뫍vEU}:E8]пXE^EdEjEpEvE|EEEE߹EE^߹|pXtvtctPt=vt*jtdE9EEU9U1ې}t,vSD 4%}t.vSC 4%}t.vSC 4%}t.vSgC 4%}t&w%1T}t.vSC 4% }t.vSB 4%}t.vSB 4%}t.vSkB 4% }t*vS7B 4%@uT}t*vSB 4%u$}t8w$%1tكM CEr]tEHM}uEu؀N NECvEEЊMM v]؀{tC|uuNt F|tUB‰UAM v] lvuf}E%=E9Eu WEEEEكUa$pU LMAEE;Eu-EPu$QE]ۉ]EUMċu+ EM}t E+@DDEUu؋]+3t EUMLUME+D‹])É؃u;FӋEx"P҉Pv @vMq14Pu9tBE)؋ЉE؃}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)Ѓ;CXuFEFFuEEEU؉UEM }urA}]‹u)ƉvӋExP҉Pv @vMq1 Ou9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)@;CPuFu؃EЍDPEPj Z}uUq-MEU] 4Ήuă|t LIM vEEU] t Ήuȋ|E9LȊU(ʈ‹])É؃u;FvӋExrP҉Pv @vMq1Mu@9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)Ѓ;CNuFFE(ЈEM]‹u)ƉvӋExzP҉Pv @vMq1LuH9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)Ѓ;CNuV+EăPEPj&Eu؃}t+EPURj M؉M]‰)ƉӋExfP҉Pv @vMq1xKu49tBE)؋ЉE؃}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)Ѓ;CXEEu؉uCE %= E;Eu U9U ]MIu9uuE pvEEE}tEUЊEE=w%v1t.}}EuEDPЉEE9Et대},uvu9utbEEE}tEUЊEE=w%v1t}1ۍE\P뙍v} ]}|UM9]Huu7}\E9E!EEE}tEUЊEv}}t] }u!u  E؉EȅU‹M)ȃ];CӋu~ FF=vFUr2HMh 9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]S+EPuVj I ]؃vvE ~EU‹M)Eu;F׋Ex P҉Pv @vMq1Gu` 9tLE)ЉE؋E)ЉEă}t E)ЉE}t E)UEȃ}t E)ME̋uE)E;FNEPUR~ +Eȃ v+EȃPMQjZ E uVEPjURj; u؃ 0KSE)PVj VS+EPMQj u؃0vM]96 ȊEE}tEuЊ0E䐋EkU9U_Ex\?Mf~>M؉Mȋ]‰)ƉvӋEx P҉Pv @vMq1Eu 9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋UEȃ}t E)؋ME̋]E)@;CPuFu f~VE؉EȋU‹M)@];CӋu~ FF=vFUr2DM 9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]Sf~nu‹M)@;FvӋu~FF=vFUr2DM9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]sf~u‹M)@;FvӋu~FF=vFUr2(CM9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]f~u‹M)@;FvӋu~2FF=vFUr2HBM9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]f~u‹M)@;FvӋu~RFF=vFUr2hAM$9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]f~u‹M)@;FvӋu~rFF=vFUr2@MD9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT] f~u‹M)@;FvӋu~FF=vFUr2?Md9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT] u@,EЈEE;EPuuu-U؉UȋM‹])ÉӋu~FF=vFUr2>MT9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]CEC]ZU}t EMЊE}]D;Eur;tmE8*te8^t`ut8\ux+tJx?tD E8+t:8?t5EtE8{tE8\x{U؉UȋM‹])ÉӋu~FF=vFUr2=M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)Ѓ;AR]CC]K]̋u‹M)@;FӋu~"FF=vFUr28<M9tLE)؋ЉE؋E)ЉEă}t E)ЉE}t E)؋uEȃ}t E)؋UE̋ME)@;AT]u؈Fu؋EU9U7}tE+EPMQj m}uTu:]u+3s1? 6. & e[^_ÍvUMU E BBÍvUS]M EUAAQQ[ÐUS] UJ9t IJ9uuSu]ÉUS] UJ9t IJ9uuuSuw]ÉUS]U ;Uvz\1:(u uu:|uf|t[ÍvUVSuU:\ÍB1;E s1 t :)t-t t9)tf} :|tvtt 9|u[^ÉUS]MIxU9\uIy1[UWVSU;E u vHMMQEP~1ҋEt 1ۉSURMQSo}tËUuƃ}tËMvE8}t&ËM%)ˆӉ%)C<1e[^_ÉU,WVSE@EUUMQUEEeEE1҉߉@EH`U9Uu:},M9Mu(}GU $gGEMUEUMAM$ȍ}OUBM}74G}v}FM}F$)ljsENyLU2vMF~}74G}v}FM}F$)ljrENy1<uUF~1<tMF~1}>F~E@ @u G fUBWM1Aƍ|}<?t ?.EE0@ƋUtu}UE9tMM1AƃM;EsjU;UuBk~9EwJE$)ĉPuSO9]t}}UEu4EvEH}tYEEOEMAƒMu1ME4EEo7vE}}E9E}UBM $bB1e[^_ÐUEU Mt`H EBEB`BBÉUEPuuuPu jjuU,WVSu] E@EURUMMM39} ;E~])}t8 u~ }t'E@uPQu yr};uUBE];u}3;E| E))M;u| E+EU }t5;]~W} 8BE<uCK;]~= }9BM<t';]~"B}<8uK;]~ BM<tE)A}t;u| +E}8U }t%M%E8tJ|;uu}t }GtGE(PU$RVMQ}WEPU RMQY tt~KFCNe[^_ÍvUEPuuPu jjuÉUWVSU$EEЋMAE̋Y]ȋqFuEEEEEEEEEEEEEeEEy$)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe)ĉe}}}}}}}}|}EE9EE}9}sIEM]u}M $$$@E]9r}u } tu u}}E EE EEMMM;UU U]]uuU})U܃}~E9EU UU؋MM]]u)]؋}܉}ԋE9E@U9U}}tM9M w E E9v]9]0Ѓ}tt u9uwx}9}lEE؉EEU9ULM]u}UAM]9r!}tXuu؋}܉}ԋE 9r U9wMME]9]s)vu}UM]Fu}9rڃ} E@@uYE@sU P,M AP,] C{ufN\}GuKE@U 9s@Pr(.M APq.] C{u >t(F}8VE9Eu M+M E+EEEM Mv]urދU+UE9Et E+E)+U UEUBUЃq$<] MC]Ѓ}tIu9uu}9}HEE؉}9tM]ЊC]AM؋u82MuA}9}uE9EUU؉E9tMЊAMЋ]؊C]8MuEU9M  @;Ev]9]uu9u}}؉u9tE@ @u*}tUMȀ< iv]؀; Xu~ }'}t}UȀ<u5M؀9(E]9u  @;Ev}ЀËE9EuU9UMM؉U9t}tu}Ȋ 8vE؊ыu9s%Tȃs}DEЄvEU9UM  @;Ev?]Љ]uu#V}WEPS$EMt]MUuEMU}EMUuEC;]vċUEM EUE]EUEuu4EUE}؉MUuEMU}EMUuEC;]vċUEM EUE]EUEuu4UEBEUЉUM9sJЀ8uE]9]s6E8tu9us&U:uBEBE}uJMU+UE+ED@9sjE+Ep]čD[~9EE$)ĉPuS&]}}M+UDv9r]E9w>MUuEMU}EMUuEC;]vċUEM EUE]EUEuu4EUE}؉MUuEMU}EMUuEC;]vċUEM EUE]EUEEUEEU+UE+ED@9ssE+Ep}čD~9Ew9E$)ĉPuSB#]t EEqM+UDv9r]U9w>MUuEMU}EMUuEC;]vċUEM EUE]EUEEUEEUBEBE}~"MM EBUv}]CCUBEBEtMMJEB/vEKvuFÃuމuUEBEUЉMUEB}t] 9] u9u}}9}EH;Eu U UJEH9u MA v]CЋu9uu}EH9Eu MA]%9G}tu 9u }9}}E9EEH;Eu U UJEH9u MA v]CЋu9uu}EH9Eu MA]%9cu9uu}EH9Eu UBM%}t] 9]; u9u,}"EH;Eu } UJEH9u UB vMAv}t] 9]uu9u}EH;Eu } UJEH9u UB vMAL]9]uuEH9Eu }GU=M9M1]9]uu9u}}؉u9tE9Eu UvEH9Eu MA]EU9vM  @;Evr]9]uu9utt}}؉u9tE9Eu UvEH9Eu MA]t1EU9wvM  @;EvE3vv}MUEtEMEUEMEEMEEM9r=MUE]MUEuMUE}I;Msă}nE9EsVMЊ<w <s < t A<u<]C]@EMtE8 E8] 9],u9u }}h[^_ÉU WVS} uEU9E<<EE@E)EE@ÃEE| tE3E| u'VE؃Pu}tl]E8tEX@ÃVEPuIt8]*UE"VWEPt 9}1e[^_UVSE] uE9sBE8tVSEP:u 1&vEE@ƒEU9]re[^ÉU WVS}uEEw<$EVu EP>u $$uq1wE@ExMREE@EuăEE@EMEu 뙉E둉Ee[^_ÉUWVSM}u] tCF8::tIu1[^_ÉUMU E``HP5d~RQ賱h~ÉUWS]u=u @1}=uCh*t#hue1 h5d~߰HPS h~e[_UWUװHjPjPRh}ÍvUEÐUVSE u]t7PhhPSVhP  hPj SVhEPue[^ÉU WVSE }]tJPhhP賨SWhP蠫 V0oPhhPJuSWhVmuK0)Ph)PVee[^_ÍvU WVS}u jVRÃu!躊0PVh7W؍e[^_ÉUlWVS]u ǃ ǃǃǃ0ǃǃǃ$t'H=vhՏCEthv}uEjEPEP聂} EPvEP} EPE%f= uǹ ujP u tEPh 3S3nEPh?ǁ }Jh?vjjV裁}Vh3SDvSW|)}thCPEP9 S1e[^_ÍvU WVS]h4ƃt*1҉ Suu uV$h40MPS 1e[^_ÐU WVS]h4oƃu*t 0PShIhP1&1҉ juu uVe[^_US]| | |0t S~t$t$rSf1]ÍvUWVSEu }V#1>te8t^EEEE8_uEEPjj*ctCCfCECG ;t8u)ЉЉ)e[^_ÍvU WVS}E jE 1RPE Éփu.u)Ѕ8tE PhQjEP!WEPE FÃ}hfjEP9shoE0P]hjEhfE0PuEPE PEPÃL9vjE1RPEuuɄ8hSVE]ÃXt ] )m+Ee[^_U WVS} fjE 1RP 4Éփuu68t E PhQjVEPu Ã}hzjWZ,;]sh7Wvh7We[^_ÍvUS]0t&08t 0 0 ]ÉU,WVS]jSyǃuh/v0EBEEPS5uuELEEPS t hU^jEPE)PSt hb8hShVuS} =u71hv3S|e[^_ÍvU WVS]} |hv08u E8v}"%?ЋM@) %j1RPuu hFjEPPu Et-E%U)%h3SWhƑjSS1e[^_ÐUuu uÍvUlWVSEEu EE}ttjdlÃu1HC C$C(CDCHC CCC@C8C<jjjCLCPCX}PCT JURsTC\9mt]>ruC\r>wt>auC\w< w ЉE,>fu E>hu E UBUFu{\{\wuFj8hEPjjjURSƃ h@ CHC u4zh@CDj8hjSƃ uN{DtHC@D}}EPEPEPUR,C@{@uS{\wu2jjjjjjjj5~5~hs@ C` SCs@i+CC`؍e[^_Uju uVU VSu|!Vhj]SXVu S'1e[^ÍvUS]t{\wtD{u.CHC s@h@jP0=@tC8C@uu S]US]{<tT{uC}s@h@jsDCuC<C@@ @tC8뵐CDK]U WVSu1ۉVw;~t+tFt FFX~%CvV1ÃV&ǃ utF81ۉVCvt4VÃVà rVutVtutvVtut1ېVcCv1~<tF8e[^_ÉUVS]1u {PtsPg{t&{\wu SS{\ruS ƃ{@t!s@o,t{8t{8}s8{DtsD{HtsH{TtsTt Se[^ÉUWVSE }Et\rt 8t8u 8u1vG8~EG EGjXtn_;_v_t"S7w ]UW )_)_tw@wjEP)GW)UEGGuG<EuF<u@Ozw@h@jwDSGuG<G@@ @%GDjWm G8u~G +EPURwLpGLG EW ;GLt G8EWW> 8u?_wW_wjjjGL 8u<u G +EPURwLGLE+Ge[^_ÍvUjEPuuUÍvU WVS] u߅t19vN~jSEPuC< u9u1e[^_ÉU WVS} u]t{\wtrC8Sv;sv{tB{u'CHC s@h@jPz=@uC@jS"C8tVWsLCL+Ce[^_ÍvUWSEPu hS5b߰H~PSu1[_UEU UjURPuUUWU װHPRu}ÍvU WVS1]t{\wt C8vC?vE PSC8u uC81{u{8u{8w2@+st"s@VjsH9uCHC C@t1{8tC8e[^_ÍvUS]u S"us@D1{8tC8]U WVS] Eu~8~8~\wuku+^~DuJh@mFD1)@?؃PvDEPtb)ÅԋFu^|H~Xt*FFDjSv@|$^^u;^sMQk} T+^tI~Hu?h@FH*@?؃PvHEP~)ÅԋFe[^_ÐUS]t{\rt^C8C<CCDjjj@CL{`tSjs`s@s@]1]ÉUjju ÐUU1t z\ruB<ÐU WVS}] 1vW%PcF~e[^_ÍvUVSuVÃV à VÃVuF8É؍e[^UVSuu@{\wu1jV3usLs@.ss@ Vu+C84~{PtsPZ{Tʉ)P/CPsTP4 hsPVsPCPe[^_ÉU ÉUWVSM] }u 1у 2Љ3 C2Љ3 C2Љ3 C2Љ3 C2Љ3 C2Љ3 C2Љ3 C2Љ3 Cdt v2Љ3 COu[^_ÉUEtxu <@@@P1Ƀz t jP@pX1US]t {t{$u 2vCxtSp,ss(C$C1]UVS]u Et 81u}8t u C{ uC P9C({$uC$h9jjs(C ЉCC@C@ } ދC@ FvSYvCpPC1҃x u)RS‹CPtSN1Se[^ÍvUuu juU WVS]{z;q1} uE EC8 L$v{E ECKCPtC C SB;Bv C;C{iE EKC8sNB))9t COS uC C{E ESKCBC{E ESKCBC{E ESKCBC{`SKCBSBC0C CfC@uEPSCpEuC C@}uE E}E ESBPSr9Cx t C{E ESKCBC {tVE ESKCBC {t+E ESKCBC {uE`vE ESKCBSB;Bt CvC@C  e[^_ÍvU WVSu} ]]t~tF8t cEPWj;F0t CF0FHtKE)ǃSWFpR'F1e[^_ÍvU WVS}tu G8 t G@_u vGPt7w2:ĖuBv9t1 v)ЉAKtvՉ+G_GPu"_wW_wG1e[^_ÍvUUtzt BxuBpb&Uuujjjju uÍvU WVS]}E Et~:u}$8t vtsC{ uC P9C({$uC$h9} uE } EߋEHw(}u"~} |}  }|}~ Tvhjs(C Љƃu ,vsEF~(F$HF,MNHFDHFLU %VPjv$s(C ЉF0jv$s(C ЉF8 jvDs(C ЉFu~u{ut~F/~3C E{ {*S(UC|Hv E{dtM BEыE))ƒCqRS{dt%F0PSF0%PSm F0{tV~u~u ;}u{u~t~F$v~u{lu{C|@WS(ЉBwCtu ~umdukuS08vjjjS@0u$SDCvc6vb.v-&vlvsvpvwv?@tr-@}wv-@ʁ@@t' t3vt@t-vxvSvs@ tr-@tw-@ʁt' t3vtt-vxvSvs@tr-@tw-@ʁt' t3vtt-vxvTvt@ @ÍvU|WVS}u BvE]EP螝EEЉEPSje }WSjS]Sg jSٜuVSjR ÃuWjEPjjWj jVjjEPh h#h&=0jߍuvjjVW!Ãu *8tjEPjjEPju jEPjtEx[^_ÉUlWVS] 1jh.`}.fhuS'mƃj/SDt7x9u0H9v8/t@؃Pp߀?EPWXupE%f=u;F ~>)hSWPE%f=@uWe2WPhS% 1;/u {tf߰ҍЍD@=v1?]uh0SNPS;􋅜P} .􋅜PY2􋅜PN􋅜P,1[^_UVSuAlÃt=j=St"j@PSƃS跍vS觍e[^ÍvU WVSu} ]=h u Ȑ8u[h 95Đ}3ĐȐ8-u!Ȑxt,ȐȐ8-uĐȐ@ Ȑl Ȑ:tPSu[=l -u Ȑ8uĐ=;:=l ?5l 5$hAhx:td Ȑ8u{sȐ8uZĐ;5ĐDȐ@;:u :P=t5l 5$h`hP ?#Đd Ȑ@Đl e[^_ÉU WVS} ut4E8SEPU҃u~E<Nu1e[^_ÍvUVS=th̐6p  p 5p =t ̐h*ÃtŃ=th̐;5p t@=t ̐S=th̐p Cp p {RSEDC=t ̐1e[^É$FreeBSD: src/lib/libc/i386/string/swab.S,v 1.5 1999/08/27 23:59:35 peter Exp $VWt$ |$L$tfffIutCffffffffffffffffffffffffIu_^É$FreeBSD: src/lib/libc/i386/sys/reboot.S,v 1.5 1999/08/27 23:59:43 peter Exp $鼔7̀rϐ$FreeBSD: src/lib/libc/i386/sys/pipe.S,v 1.8 1999/08/27 23:59:42 peter Exp $^*̀rL$QÍv$FreeBSD: src/lib/libc/i386/sys/fork.S,v 1.8 1999/08/27 23:59:39 peter Exp $̀rtÍvU帨ÉU WVS}u]<U :PWSuFP#‹M 99t )1e[^_ÉULWVS.=EċE8L vU:% 11E]z $vMuV}WE xw‹BMċD|vIP! ]SuV} wGUċD`IPz]SuV}  w$GtUč MčD0IP2]SuV}  wGUċIPqMQ]ShKu NlQ)RURMQ] Su}WEPU RhPMQ]ShKu v uvtlNXP2}WEPhYU r \vMQ]Su Vh]}WEPhKU r$vMQ]ShKu N*)؍@)Ɖ)ڍR9u P}WEPhfU B@PsMQ]ShYu vUv}WEPhYU J*)؍@)Ɖ)ڍR9u PB}WEPhKU r$vMQ]ShKu F@P}WEPhkURMQ] { ~ uċ }ċPrEPURM QhmW]SuV} WE;URMQhK] 3a"Eԋu PGEPhs]S9 EPURSQMQ]Su Vh{}WEPhURMQhK] Cދ^)ù$Iэ )PjMQ]Shu FuPCCQ})ω$I)ЍH+vU ZlJMruu?Qщ)Ѝ9u)Ѝ9u nmEM)$I)))ȍH$I))Љ)‰Љ)lj}9E9MKuCQщ)Ѝ9u)Ѝ9u EnEmu>Vu}WEPhKQU:gu@-MU;Ju Bu];s> @UE;Pu@tf]M;Ys{ u@uMEu;FPvR` 4%Uz_u]M;YfvR` 4%u>_%UE;Pu@ti]M;Y; u@uMEu;FvR`v4%U:_]M;YSvR_ 4%uKu~_tB`EU@MP%Eu%=uEu$E9EuU9UEyMM@u%=X w+=HDw=8tG6=PI$=pw=hv=xEP|u | UUJT)‰UE)9E0MAUy NjM UP @M9tuP @EM9uUUE@AuVEPE@PURMQuV %UMD]CUuTUE@FuMAUu;uE@NuMAUuVMQ%])É@PuVREPw UE@MlMA%U\uVSQEPURMQ. <u@%=CKP%Ë%=uK뛍vEHUTEUEu+F UDEPURE@PMQuVEPMQ]ut1}uNE‹DT EUE+F uD1D1 MQuVE@PEPURMQ u uVM]L\ 넸e[^_ÍvUWVSE EEU;BtHMƋMVhVEPQU2>ƉuE }EEM;AtU;uuMME1ۃ u U@uuMAuEUX,} u M@u}u'E@u}uEUX0t(~&VMQVEPURM1mƃ Kہ}tAҁvR`Zv4%uI_tD}t;UvR#Z 4%u}_uEҁvRY 4%u_uL}t<}t:UvRY 4%u }_tEE{w VEPVURMQE0!ƃ Ur4M9Mt,URMQPEPURM1EUEPMr1vE@e[^_UWVSE@0EU UEM;QtBEƋMVhVEPQU2iE }EEM;AtUE1ۃ u M@uuE@uEUX,} u M@u}u'E@u}uEUX0t'~%VMQVEPURM1ƃ Kہ}tAҁvRWv4%uI_tD}t;UvR[W 4%u}_uEҁvRW 4%u_uL}t<}t:UvRV 4%u }_tEE{w VEPVURMQE0Yƃ UsMM;ut5E9Et-URMQPEPURM1EvEe[^_ÐU WVS]E EƋM}9vUBM%=Pwx=(qw/=== v=8w=0<v=@q=Hfi=xw;=`Hw=Xs>=h)=p!= w=p==t]=tn9EE}t }EE~Ev}Eyv}oEav}ZEL%}O}4E"A"E! Éс‰! ÄM)MƋM! É!с! É!сUBMT%=t'EH%NjE%=u!=v! ÉсUʋ}G%=t!! EE9E[^_U\WVSEȉEċUJ AMr$uBtE}tU EUM HM"vu uЉDEM9Ms vu~<~Dt}~Htwv<}GLT0UOD_H]}\8D;<u;]s2KJ:u9u:t )}9}ËU;]r9tnv]E9sSMQ<:uE);AL|މ׋ILt/C;]s'uV<:uE);FL|މ׋EHLu;]MUĉ urBB} z EBMJuFPv`}ĉG$uY }vEp$UrBaMq$4a H]s$a.uċV$V(F y׉~,F AЉF0F kAЉF4F qjPdEx@؋U+B@;EsEEMA]SuV}WEpPƃ tփ}u UzTMăyu#@P@P@_]ĉC}ċ;XPw.UB@@ @C;XPvҋMyTu!]Cu}WEPVsS\UzX~8MăyuBX@P^]ĉC}X~ Eăx7jURMQV]sSYà !j}WEPVUrR.à uwM;qv!}WEPFPqQUƃ uuJUċJAM]SuV}WEPUR ƃ }=MyT0}t#]ċC S)‹}W)ƉGG }vs;]siuċ;XPw.N}TTTTT T -vUDMDD C;]r]ă{ts ^uă~tv]}w$]1e[^_ÉUWVSE E];]]U@%=Xtw =Htav=xt!UvM@u%Ɖu8U‹@MJu%Ɖu%=uEU@%=PwV=(w==8w=0tlv=@=H=xi=`xw=Xt+j=h=p&MEDEvGMQSPuVEP ǃ URMQuVWEPm 9uC]]KSURWMQuVH tSEPWURV }vEvGMQSPuVEP ǃ URMQuVWEP 9uC]]KuuuƃSURWVMQ t9u݅uuS]SPVuVEvGURSPMQuVg ǃ EPURMQWVL ;EučsuU@%\)CKMuP%Ë%=uKSEPWURMQ 9uS]SWuVEP} \U@%JE]+C D/vU@%JE]+C DD ];]dEe[^_ÐU,WVSU EU1EU9fM@u%=0w2=w =tZ= =(tf=w=`v= =E9EUBU8M9MEu%JE9EU"AEPn]M;Yu A4Eu;FHx >@-MU;Ju Bu];s> @UE;Pu@tf]M;Ys{ u@uMEu;FPvRG 4%Uz_u]M;YfvRG 4%u>_%UE;Pu@ti]M;Y; u@uMEu;FvRGv4%U:_]M;YSvRF 4%uKu~_tB`EU@MP%Eu%=uEu$E9EuU9UEyMM@u%=X w+=HDw=8tG6=PI$=pw=hv=xEP|u | UUJT)‰UE)9E0MAUy NjM UP @M9tuP @EM9uUUE@AuVEPE@PURMQuV %UMD]CUuTUE@FuMAUu;uE@NuMAUuVMQ%])É@PuVREPw UE@MlMA%U\uVSQEPURMQ. <u@%=CKP%Ë%=uK뛍vEHUTEUEu+F UDEPURE@PMQuVEPMQ]ut1}uNE‹DT EUE+F uD1D1 MQuVE@PEPURMQ u uVM]L\ 넸e[^_ÍvU,WVSEX(P,U@0EU UEE;PtRUUpjSVEShSURPE0ËU0pSEPVEUUEUE;PtEUދ}HuEE11} u U@u}uE@u Up,} u U@u}u%E@uuNjUp0t'~%vSWSEPURE0à NށtB}UvRAv4%uG}_tA}t8UvR@ 4%u}_u}t{UvR@ 4%u}_uIt<}t8UvRR@ 4%u }_t{wSWSUREPU2à E<ubU9UtZUpSEPTUpEPST SUREPUREPU2?E UEPE<u1E@e[^_U,WVSEX(P4U@0EU UEE;PtRUUpjSjSEShSURPE0E0}EEU;BtUE1 u U@uuE@uEUp,} u U@u}u'E@u}uEUp0t(~&SEPSUREPU2à Nہ}tAҁvR>v4%uI_tD}t;UvR= 4%u}_uEҁvR= 4%u_uL}t<}t:UvRJ= 4%u }_tEE{w SEPSUREPU2à E<tUUUދ}Ht]U9UtUpSEPqQUpEPS\Q SUREPUREPU2E zEe[^_ÐU WVS]E EU9uFu%=Pwx=(ew/=== v=8w=08zv=@=HZ\=xw;=`<w=Xk1=hq=pf=w=l==tY=tb9EE}t]}NE~E}~#}nE_}YUT Jv%ƋUr}+E>8"FE vD ׁ)4 M)}MD %vT D %v<uFuT%=tSEp%NjE%=u,vD ׁEUr%=tD EAU9U[^_ÉU WVSE} u]UH 8eu9EuA(t1y w%uRSVWQvRSVWQe[^_ÍvU:-u9B;Cs1z]t+;Csz-u E-SE vEEM:MuEN fEfF=tCE:Ev j S ]E9ËN ffFC9~qEPEP~ ~j Sl SEPV (EPSA ËN ffFC~e[^_ÐU WVSu EEU;Bs:vRD$v4%t M;ArƋE8+}v;t"WUR3u<uڅujMQx v{ C$PvӁvR#v4%tËN ffFC~vӁvRH#v4%tËN ffFC~+vӁvR"v4%tËN ffFC~vӁvR"v4%tËN ffFC~v=w%1tËN ffFC~;vӁvR"v4%tËN ffFC~vӁvR!v4%tËN ffFC~vӁvR\!v4%tËN ffFC~?vӁvR!v4% tËN ffFC~vӁvR v4%@tËN ffFC~vӁvR` v4%tËN ffFC~Fvv=w$%1tËN ffFC~ōe[^_ÐUVS] j=uƉҋK %fCe[^ÍvUS];CrjS(;CsB;Cs:[uz.u Fvj.S=E;SsB;Cs:.uz]u  jSE]U WVSuM E;Fs6s @;FsU;VssB;Fs9uz]u;Fr jF>+}x=xt'WEP3詞u<t;uڃtjV 1CUe[^_ÉUS]vS,v4%t*vS v4YvS 4%t*vS |v4Ë]U WVS]3{E UUSEE]ES3{e[^_ÍvU WVSu] Fx8@tMӁvR 4%t"S9tSVY'vPhV<;u FP4;@4e[^_U WVS]3{EECE^E@ @]@S3{e[^_ÍvU WVS]u }CE{~u}~B}u BM$E))CvVC)@PhxS-EPjFPSY C)PhSC)PVS jhSjCHPSo jhVC)@PhxSC)PhSM C)PVS"jhS* jCHPSjhS E@PFPS‹EHPj_vVC)@PhHSC)PhPSJvMQVSN‹EHPEPVS6‹MQGPRS vjS e[^_ÐUUzuE BB1ÐUWVS}GP U@ WJME;GGGMMzuP0)PGp6‹GPGxuEP(‹GPNURGp‹GP1҃;U})GpЅ}BEAB;U|׋Wzt"ztMQjE)BPi-vEj WWEZE}EBE}$M)CfCCC ؍e[^_ÐU WVSu UBP PUx19sˋF ff)FC9rE9u UBH [^_ÉUWVSu FfEUBP HʉU@E9Ef9Cu`9t\1;}sP"CЋ"F%9u0vG;}s'ҋ"Cȋ"F%9t;}t;]r;]sVURދUB+pe[^_UVSEu @H19svŠ"FtB9r1[^ÐUWVSE} @H119s7Š0"GtCB9r[^_U WVS] s}C{ u P4&ss >C { uj ua!vEPC HP3SC De[^_ÉUÍvUÍvUVSuV Jȅ}B] 1ҋF9}v<t  vBF9|1[^ÉUWVSEP Z؅}B} u1ɋEP9}v:t1AEP9|[^_ÍvU WVSEU z8xuiv<>uUVE P)tAU R4UE @4>^'<;uSVU R@tE;C~F~e[^_ÍvU WVSu~]+] t;FPVBV EFЋM MQRP)^e[^_US]{u4C;C|C@@PSSC M M C]ÍvU WVSu}~u^uu VF ]N 9<|FH9<|C ~كF)PN RDPٱF Ue[^_UEM xuP % EÉUVS]u 9s}/Ps $uj STC se[^ÍvUVS]u CFCPs b$Fuj SC Fe[^UWVSEx E1ҋME ;H }"Hv| tEBE ;P |11ҋM A@Y;%=Xwk= )w.=w===0ew=( v=H=xtiw/=hw=`^=pzL=w=t}3v=tn$uCEF=MQRSƒ%;%=`t'=t =L%=`t=uE ;pL~'MMpL~ P@vE P@M ;qL~ EEqL~ Q@vM Q@~v~oBlE ;pL~ MMpL~ P@vE P@~~B1}t0)M ;qL~EEqL~Q@M Q@1%=E xLu @@kvU BL@PM AE H(3vU J<]RL~;%=uAJe[^_U WVSu} u X11%v%=pw@=0w==(=XtY=h=w=xt4=t!==9~1EPRV.ƒ2%4%=`t'=t =%=`t=u}Bv%=`t =9~׋U :e[^_UVSEu xuUhFDtAFDvVDFLA~1;^L}F< VDFL)HC;^L|e[^U WVSEu xFLPdǃuFHvFLP=FH1;^L}VHFL)HC;^L|FLX|? ;NL}3V<:t(VHFL)H;~ ;NL} F<:uIKy19vVHFL);~C9~;NL}79';NL},vVHFL);~A9;NL|;NL}|˃W^e[^_ÉUWVSE} 11xt1K_Ht Pt A9~I%=uɅtO([^_ÉUjjuuu uuUjuuuuE PuÉU|WVSu quXhkÃtBhhdt)9Pu!SEPMQuVREP蛀ttChhct*9Pu"jMQuVEPRMQOWt}1EE EEE%PhjPmPEPPu6Aà tOSo@PhhP# ̒0PhhPxt?x=w'hph MDžtvuDžhnDžvP8#t ~tvϑ8#uh hP(v襑0Ph@hPή ?􋵬V"mEPjQkvvPp 􋍤Q#80u 8=u Dž~uZt~Lؐ0Pu6hRhP C>􋅬PPlsv~S膐j"jjhh vv^ h hZhP茭Gj vu8BPRDžj"jjhh vv h hrhPv}u(jhQ&"DžvPjFjVmhjPi PPQ!Ѓ9t.ǎ0PhhP VI9}G~)hŷhP跫􋵘V  hSX։ 4 jjjSWl0~uW8t)貍0PhhP۪ h hPª􋵘VP`PPmƃat t#vbb1ۃuV􋍘Qy}6ߌ0PhKhPDž cE0=vh`hPЩ}PMQV}PMQV }PMQVjPV t,0Pu6hhP$ svt?jSPjuFjSjA u+v􋍬Q9g9Pvtu6􋅤P􋍬Qf 8x[^_UjuÍvUWS] }1҉ ]tt8E]E8E]``EBEBEB E蓊/TvjjEPSiǃ|7fEPW蜴t%UWh[_U,WVS]u}1҉EEURURhS7tHum71>]܅t&VEPM Qssu tʋ[uۃu07e[^_ÍvU$SU] MEEEEEEUPQSjEP]ÍvUWVS}  E PuSDž}uhh1ۅtBEPEPE P PS^ uSf91JvSS9)=xu }DžEPǃwShSm hƃwehSà Vde1EPPe} ]E%f=t ͸FvEPCP}$}tE;Gt vEt 5 S8[^_ÉU$S]E MUEEEEEERQjEPS]ÍvUWVSu ]1ҍ} }t }tEu?UBEB5u'UBEBFB FBF B vUuuEPRuh[^_ÍvUWVS}DžxDžt|Pvt Dž|jjjhPEPU R "v1j S~u0OyWj4 u; ;#]vRv4%t*vR4C; t; t; t;u; t; uAC; t; tހ> t,> t'> t">tvC; t; t; t ;u<+t <-tQuDžt@u|jPPDy^@u'|jPPtIkPEPU Ret&HPEPU RAt<+t <-tZ~uDžxv~@u&|EPjFP}xvFPURzvt~~@u#|EPjFP*tTFPUR,u6jvtt>E>tPEP,Љxtt xWhPX[^_ÐUPWS]U {uO{uI{ uC9Cu2EEEEEECE]ƅj"jjhPRS' }1CEEDžPEPhu/t~f/ivtLƅj"jjhWss uWP,+t[u.1[_UWVS]9{$E`jj%qÃ[j.SzƃFEjhaP*yu[}HP5N‰fFP5UujuljhnSxu EtjhzSxu EpjhS\xWEKu3E'޿t޿t΃hSHu붉;E'EEEE׼EpüD`E^v诼D(EJv蛼D܉E6v臼|]  tEt@Et@Et@ EE` p>' X* :X,Eu! pV'uE.vE+tE-}teЃ@P5||t9UV|@Pe|EvkEE`Ee[^_É$FreeBSD: src/lib/libc/i386/gen/setjmp.S,v 1.17.2.2 2001/07/06 12:41:44 deischen Exp $L$APjjY L$T$QYai qyy1ËT$jBPjY T$D$JZbj rzju@L$ÍvUjuu u^Ujjuj^ÉU WVS]}u vV 4%u^$tY-tT_tO.tJ+tE!t@*t;'t6(t1)t,,t'%CVPjSVvV# 4%u<u t/u t"u t t/Fv u"C\E@9\0 $\Cn\Cr\Cb\Ca\Cv\Ct\Cf\Cs\C0CE<0C0v tt"\C0C$0C$0Z@u\C}MCv V 4%t^Cu?@-CC؍e[^_ÉU WVSM] }CPWPQlu)e[^_ÉU WVSMu ]}MvvFPWRQ KwtjWPQ+Ee[^_ÉUVSutPV|"EPV uE%f= t 1jjjjh *à DžllBfDžl EBddBj\PRSC Ѓu*`h\9SCиSCЃEPV H[^ÐUpVSu h0ÃuXqS3b;Fu>B@PhBPEPh}U u;EuF;EtS$ƒuS1e[^ÍvU WVShNDžu1`u1ې[#ĖЅt;9v,A[Ȗu BA:u[Ė!Cve[^_U WVS} t E }t UUEE8?1vPW u8Ȗt}ĖU v} tpvĖU _vWc u4Ȗt} t/ĖE "}tvĖU  FFu "h<EPwPǃ 1e[^_USj Ãuh@jvCCjPduh@jЯ؋]ÐUS]SB9Cu/BCP37uh@j臯vKE C]ÐUVSutA>t3} t 1;^sv4C;^r6Ve[^ÐU WVSu} 1;^s$W4uC;^r1e[^_U$S]}hB]UBEPR2t1t8t E}t@]ÐUWVSE NjU9sFAt>\uAu\I@f9sAuf9sAuf|PVP\PVP [^_ÉU WVSu}f>{u3f~}u,f~u%7E?vWEPE PVS1 tރj{S Ãu҃WE PVe[^_U WVSM] 9tf9uf1qf>tTf>[u.f>]tf>tf>]tf>uf>uvf>{uGvf>}utOf>uuf>u"EPURPU19[t ,tQ{t;}t:كf;]tf;tvf;]tf;uf;uvrvGltOdtf;,tY9sf9rFfN ffuEPURPUK92E1[^_U WVSuf>~E@ EU |B^9s&f~tf~/tA9s f;tf;/uE 8uM5uhkuEtQOu'8P]PvU RtOu9HU ffA9s9u9sffufE e[^_ÍvU WVSE PhSURƋE ߃?*v[!uf>tj]FP$ uf[!f[!uf!شff>-u^]tf-شf]uNjU J f]8E H f?)U J 9tf*tf*fffEPU RPulU 9u,B uB %=uEPU REP4U B u(ht'j+PBBPK1[^_ÉUUE 02,ÉUEf8tuu PEPRR1UlWVSu ]}Evf;fWEPEP@t 1G taf~/tZE%f=@t,f=uFWEPEPvu.E%f=@u F;Ev vf/fFGEPWEP5f;t3f;/t-f:}EA;Ewff:tf:/uӃ}u5Ήf;/vF;Eoff;/tEPWRSEPVEPe[^_UWVS} ;}v mfSEPUR`ƃucExtRhPURu&gS0PUBЅu E@ t v1DžDž)UB @Bux.u Uf:.ufP;]sffBfuEPURWuf-E PUREPURSEP\ uV҃tE@ @tV‹B V'[^_ÉU WVS} U:t;~)RGtPw  P_ÅutwEG멃u"~GH|vIy_UEf8t fu+EEPƃt3EPVEPtV vG4G1ue[^_ÍvUWVS}] ;]L=?tX=*t=[tQ ;]tvEPSWt fu1fuvEfUftf;!ЉUtytvf;-u]=tfM:UwBCf9v05uVPCPVίEvf;UuEf]uE9E(f9f?%e[^_U WVS}tBG_7Ntv;t 3swGe[^_USU] f:t"hPRet19fC @uPvPC ЋÐUVS] uhPutN?+vF @uSP+SPF$Ѝ[^ÉUVS] uhPuxtN?+vF @uSPB+SPF(Ѝ[^ÉUUM v9tfu1US]M UJtAu1 s[ÍvUEEEEjjEPjjEPf =t5utVjjEP5jEP |U%5*1UWV=uu1_;s@25 =2tɃ=u52e^_U WVSu=u t{1C;sCV[Pu;s[25 =u5;r1v2e[^_ÍvU WVSu=u tw1;sD9p$tC;s/[9t$u;s[25 =u5e;r1v2e[^_ÍvUS]=tu5]U=t5ÐUÉUu&1҃u‰ÉU,WVS}u EEEEjjEPEPjEP }s1rEE$1;]}Mv]jjEPVjEP }I8-t(vFPW/tC;]|mIe[^_ÉUS] =D2jjj*D2|*=H2~*S5H25@2U*D2} 1D2_=@2t5@2ID2@H2P/@2tS5H25@2)D2|9H2v@2ED2]ÉUS]=u/jhL2$}BH1"1=L2tL2]ÍvUEPUWSEPxÃ}u.߰;U ~ E"vRSuKEe[_ÐU WVS h!Ã; j EPSƒuE8txu~Ev/*v@Sh1B9~jhG"ځ%ha ڃڃWRhzjh`2 `2ЋUHE e[^_ÐUEEUBjjEPh2jRt 2ÐUWVS] tE j(ƃ1 EF ^$EF$tN$UR=vMQPVjhV!EYf@2EEE8vU:HP2VfC2USK@KF$PSV fC4 fufC4}t EC]C}u]UZ]EEM9`}t}~EPURV EjhVt?MHf@4 F$ujjh<F}N$?CEP]UR- vV1e[^_ÐU WVSu] C&fC$GP{@WvKYj/Wƒ t09uzt&BװЍxPRC@P Yf{&FCCC,F e[^_UVSu>t9f{2|$vڋCuCÃRMf{2}߃S:~tvJ ~tvvF$uGv$t tB1ۃvtVNB V1e[^ÉUlWVS}?G%7V8fF8ujVW fF4QvusF4ffwejVW fF4fG$jjhE:F }AFfF4N6vf~4tG$@tBF,;G t:F6tv tw GfF4vtbG%tg%w Gt=vjVW tR@FN6wt=F@Fvu*jWMGuG%1wGvPf~2u,G$uw!VWf~8tf~8uXjVWfF4fu9G$u3jjh8F }?FfF4N6fF8OFP$@|/uT F@$/BF&@PF@PRkUpPf~2u"V`?vV$Gf~2uG$w evF6tFG$u0v t>v x>-vv a'vF6uhjvW t O% ~tfF47e[^_UUwE fP81vo>ÉU WVS}] tt@>7->G%f~4 u Ff~4twu O%f~2uF8/tG$tSW\GMvjjhC6ƃ|.SW0GV uVGv1e[^_ÉUE$Ft vB:uCtBIu[^ÉUWVSE} ÍpvCvA8t uv)[^_ÍvUWVSu >=uFHEEPURVƒt5}AװH;EFBu@1;t vG;u @;@u-PRÃ@ @@P0ÃtlPS5@f@ @@D}UB:t:=u+EUDP̣U@ u8E@BMAMt:=u=BvFBu1e[^_US]E@BuEPSæuЋ]Ív$FreeBSD: src/lib/libc/i386/string/rindex.S,v 1.5 1999/08/27 23:59:32 peter Exp $ST$L$ 18uBu[ÐUEԘÍvUWVS]j(藢ǃ6h}ƃG w$. .N PV@FO WGFj8P38EEEE EEE=ԘtԘ9~؉E]EEjhXP@SUEPSi u̥D@R@ЉÉ^S菡‰V t/XSPRڦFGFGW5hhP71[^_ÐUWVShP|uvE[|8xPjÃ}ߤv~19}2:A9|PSxP|PPX[^_ÉUÍvUEU @$JPRA ÐU VSu} ^$juuEP蓑{tsCC PEPYtC CFCF4vEC PEP%CCFCFVfe[^ÉULWVSEX$@;Cu 1CEEjssuV辐UURV^gǃ tajEPEȉEEEjV@Ѓ EPVgǃtUCBCBREEP]SfEԃxt S@Љe[^_ÉUVSu^$so{ts[v$M~tv9V-e[^ÉU,WVSu]~$jhGPS腏VSo tF PS[uhbCS@ЉCxt S@Ѝe[^_Ð$FreeBSD: src/lib/libc/i386/sys/Ovfork.S,v 1.11 1999/08/27 23:59:37 peter Exp $YB̀r tQ铩vUdSUE Åt C}fEfEUUEEuuEP5…tEЋ]U1ÐUdWEU fEfEEEǰHEEĘgEEEPREP4e}ÍvUSu*9u9tT]ÍvU WVS}(u=t W*!G u!jjjwG(ЉÉփu u=_PwTG tG)փ0t#G<)G t?tG)‰Йփ=t W ؉e[^_ÐUSE8eX ;E{ts{ts{ts{<ts<ޛ{DtCDPě{HtsH谛S褛]ÍvULWVS}uEEP EȃuURh vM1' }1EEEE %Ph1jEP%EPEPEPE0 t(PPh4hP/NEԃxt(hph@@w@DU@@u谿EPjjj2Ãu hMÃuh`#^uAju tjjuht]hWÃuh]h~ jMq&u607wPEphhPA. hAU2' uJMQEPzu3UȋB E8tEj/MQ NjURh%j/EPNjURMQhU2UtPRMQF0L0evPEPhhPq- hqu蝢j?E̍e[^_U WVS}} u}EEUP`DR,E}~؋E 8hÃ}t t;uE4轙Ãt;uh袙Ãt;tj/S1tjS]`DPtƃD}EE46Ãt;u`DjS]`DPGtƃDE}~;v}t*jE P]`DP tƃDj/E PZǃu=EjE P]`DPsƃDE}~E/u vG/tv+u ~VE P]`DP[sƄ3`DE} ?/u E E 8/tG?t?/uE 8u}+vU@DP`DRE}~؃}tEP&EUP@ER蠡EP uA;]}0v@EP`DReS C;]|1vE}~ e[^_ÉUSh h FvPh $t=hh F莡Ph Fv C~ vC~ F]U WVSE`DE=.udhMƃtDu;Ѓ+=yVxr.u_v.EPS9u E8}u.SJ1u߅EPJ}u.Ss1|߅EPs}u.SH1|߅EPH}u&Si1|߅ufEPNe}u&Sݗ1|߅u:EP—9}u:S=1|߅uEP" SEPϞv1e[^_ÉUE(G,Gh Gjjh#54Gh0GP}ÍvU=0Gt GUPWSUE]CE8װHPREP}WjS跳 |muuuu uW蔳e[_ÐUWVS=Ou qt^= PtOO OE2j]EPhO|R]E@P~ u1O8+t8-uu=uhh P%OOװHPh PRQO h Ps8Oe[^_ÍvU,WVSu=Ou ZtE1Ѝx~ 1vW]EPVoQ]EGxPtà u3=u=th0VhOÃtO8+t8-u1ۃ=Ou91tOe[^_ÉU0VSu=Ouu1E3uj]EPEPP]܍E@Pà uD=u=t)Vh>j]ShAShOà tO8+t8-u1ۃ=Oub1tOe[^US]O Pt j@O]UjÉUO P=OtOP@O=t"P@ÍvUSZtNjjjjSiO t #@G=@GuShgjy1]ÉUVSOjURuP@ Ѓu3uE;DGv/DGP5HGMHGu 1vHGOFCuOFCujVhOjVhO jVhOOFCuOFCuOFCuOFCujVhOBjhOVMe[^ÍvU(E4EEMAOjEPQRB Ѓu{Eu7=$Tuh$T uG5$TT T  T=ujjhXjj@ÐUWSUEPEPװHPRhn5$T u]uuh`Gh`GEu芋] hEP+thEPu1e[_ÉU WVSuE ]}8+8-SPhKBhKEhEPà N(hEPÃF(u9u-hSt6tF^N(hEP0ÃZF(uSXFN(hEPÃ#F(uS!F N(hEPÃF( u^N( hEPÃF(uS^>FN(hEPWÃF)uS'>F$N)hEP ÃtNF(@u^N(@hEPÃt'~(|^N(hEPÃu1)F)u^ N)j v Åte[^_US]EPhS u ,t#uEPhnS u1]ÐULWVSu ]=$Tuh$T0= TuShShhPAPPHPVP5$T ti= TShhSPPHPVS5$TU0< T= P4j:Džƅ5jWPHCS u9ƅ2jWPGS MO8+t8-f.=O7Ox@5$TVjP uSOPnÃC 8VC 0ZtC C 8u=ЍEO@PV=hЍHBjhRP@ Ѓ9%O8-x@5$TVjP uSOPRÃC 8VC 0>tC C 8uЍAO@PVlЍHBjhRP@Ѓ:J17:5 TuÃ؍[^_UWVS0=$Tuh$T= Tu= PuR=Ot5O觃EPEPhOhOV5$Tǃ uX P>OEPEPhOhO5OSV5$Tǃ S3t P1vj:uÃtiE=t;EǰЍUHBjhRP@ Ѓu:!:5 TuuEPTuu莂uye[^_ULWVSE8+CǰuhO5aEx@ P=@ 8t{=t@EǰЍUHBjhRP@ Ѓu @ 뜐h0@ 0hOá@  P1v=uEPEPEPEPuJЅuPSh ShЅuPhQ&}hQ}]U,WVSu}}HTEPHT=Dž1h@T~PP߰HPStP5@Tǃ u5EPǃyu&PEPuE PSDYEP} t"tE PkuXttVHu5}t"tEP u 0PPPX1[^_ÉUWVSutsV誙uuVÃt{t nCC EV8ME8(jwÃjS E hEPEE]hEPgƃtfF> t> thVt)H~4XS[vUMSPVG8 EUE}f#hEPƃVx u}t*EE8 t8,t8 t}t E81e[^_ÍvU,WVSv=DT=@Tuh@TePP}HPURh5@T t/5v=DTfEPhhP  u+uDTv;#C; t; tC; t; t ; t;u)C; t; t; ;j]t@FPDtB VPW-6B߰ЍpDž| uN|\u NDž DžDPs~/PRP5Rt VPSg5tN5hW>tЍp DžB URpu C=DT5hPY>561[^_ÍvU=\u t=\uMjjju1M\8+u:t>#t =\t|\u\v|\u'\%v8?\CB:t ::t:\u1t:CP5\ ƃuV=\tM\@ fÃtl85\\C&DLt(|t:tAB:t :|t::ujjPjE PPEP,ÍC wC[^_U WVSj=u ugÃu sjdTǃu` KEd;?u BC$v;\C;:;<w$1tCIt ;/~;7~ZC2w?$L@v 8v 0v (v vv:vCCBMu()FdPWǃEd>;:t;t;^C;:t ;B)K}t)PWDžE8؍e[^_ÐU WVSj=u uÃu jd6Su mvd.vCBOu")΃FdPQtǿd;:t;uB)Kt)PQtE؍e[^_ÉUSj#u u…um:0uB:xt:XuB  1 vB< w  <w<w 9|ƋE1]ÉUVSu >:tF>:u^FPut^e[^ÐUSU}t vAzu$)ĉE UECtABu5@Su蠩]ÍvUSU}t vAzu$)ĉE UECtABu2Su4]ÍvUSU}t vAzu$)ĉE UECtABuSu*]ÐU5@u u誨ÍvU|WVSDžj/EPtEDžIE8HhRƒuװЃ$)ĉua R\8uDž-Ѝp}ЍxD7=vBjh/juZVPjcZ jh8jOZ vVSP/WDPEPD7 5@E PPO=wq$T1ҋE 8t BE <u$)ĉ$ID$PCPE P]5@ShL}PPu uGDžh+P赠@tn _vSx[^_ÐUEt \ v\PUE\ÍvUS]EPu 0S:US]uu 0SvUEPuu uUVSu]=\u jW5$h5\t(uS5\h5\ u Z+Ph5\i =\tV\ЃVWUEPu uUVSu] =\u j5$h5\tuS5\h5\=\tV\ЃVWUE PuG0@ÉUu u(0!ÍvUEPu uÉUS] =\u j5$h5\t(uS5\h5\ u)Ph5\]UE PuÐUS]=\u j5$h5\ctu S5\Fh5\4]ÍvUj ju UÐ$FreeBSD: src/lib/libc/i386/string/strrchr.S,v 1.5 1999/08/27 23:59:35 peter Exp $ST$L$ 18uBu[ÐU=]t\Uh\j:j:h5]h]uPUVSu]=t VSu V(Ã=t V؍e[^UVS]u 9sHr1"VsDJt CDsH1e[^UWVS}W}pwj 7s ƃtF)ËU O )_7_ECPPWO+EUWDP7RM]Wo uVwj 7 ƃu_롐F+EÃSWu)EGDUR7PtME)G7U GD E 1e[^_ÐU WVS}}Hw}utuu1=.uqhVJÃtQМuH߰Ѓ+=v yS{&.u覿Xv.5.SThST EPSThST hSǃu WÃuWoOvWo{suSIsu Sfsu S Fs"u S/ &s't S3[^_U|WVS]EPCPGP}}S {u`EEbS SjuЋEP* tUR1MMuЉuT L E/t PUB0B0P P 4 4 < < D D E׃4Ӂ4с4U::  E}~NjML 8 4 ЉL u9v EPML @ < ЉL u9v EPML H D ЉL u9v EPEu8 UDD DAuTL)AL D L E9L )I~0}D; IED EMU;4 IEEu;< }KU@ UDDDDEuM;< |EUE;D }HMH UDDDDEu;D |UP L ;EvMQ vuVB1[EP u ǀL U4 u ǂ8 M< u ǁ@ uD u džH Ex[^_ÉUE@(@,|1ÐUVSM] uu P05Av ww P0I  At[^ÍvUWVS}] E~9ust/'tV~ CJ[^_UUvR61%v4ÉUUv R1 4%%ÉUUv R0 4%%ÉUE%UUv R~0 4%%ÉUUv RF0 4%%ÉUE=w%1UUv R/ 4%%ÉUUv R/ 4%%ÉUUv Rz/ 4%%ÉUUv RB/ 4%%ÉUUv R / 4%%ÉUUv R. 4% %ÉUUv R. 4%%ÉUUv Rb. 4% %ÉUUv R*. 40%ÍvUUv R- 4%@%ÉUUv R- 4%%ÉUUv R- 4%%ÉUE=w$%v1UEÐUUv R 4ÐUUv RN 4ÐUWVSE@(@,L u PUL C; t; tj$;EuMQ< *v1jEPSiF‹E;]t]uEPC; t; tjEPS*F‹E;]t]u URDvC; t; tFwjEPSE‹EP ;]t}uMQ;u;OWEP #v L u u;UEL MǁP $ 1e[^_ÐUWVS]1} tCL }%tu 1ɉ΋ ;M v}tE@0Pv|$~Iv CI}tEL P ! [^_ÉU WVSM] }L #r !M;ru`L p9ur7tJv E CJvL ;pu 09usZѐL ;pup9ur"L ;pPp 9urCJv ECJt[^_ÐUE@(@,X1ÐUWVS]}1} t_]w;M vt@0Ix CIyt[^_ÍvUSUM E]f}v.Qt ttA t 1[ÐUVSu] SVP3tihCPV:tPCPV2t}-E =tGUE9|81VW}SV UEF~̉:E v!e[^_U WVSE@U9B0uEh@+ƅtvEp0@4ƒ@7OyU21KEx4?URp0,ƃt#7WVSA0Ep0UP41ve[^_ÍvUVSu] =.u=t S软C u2C tOC t"SCu9c CCK {0tCC;C4|+St=t Seo CLvc ߃{t;Cv@9u C)CC<C8C@C0C4SBCBC=t Se[^UE@(@,1ÐUSM] Ut`9vvt/ tvtCtAvA%=uhtA$ACA%=u@A%=u0tA$ A$? ŠA$? ‰tA @0[ÉUSMU E]tKv2t $ $? B$? Bt vtjvt<v#t$ $? Bt t&vtt tB t[ÉUVSu] 9u1']]h]h]u)؍e[^ÉUt)}u#}WEPEPV u>t}t;t+}u%}WEPEPS ];t}t}t-}t'E;EuD}u EU)‰U>t;a>u;t)>t;uU+Ev>u ;uEEUR&EP&Ee[^_ÐUuu uÍvU,WVSEEUUEUvR<v4%@uƀ}-uEEEvE}+u UUE}t}u'}0u!E8xt8XuURUEE}uE }0uEEEEEURPjjmEUEURPjj'EܾEE©v=w%1tEnUvR 4%]ځvS 4%tCCEE;E}y}|;}wu;uw;uu;}uE;E~ E0vEEӋEËEEΉƃUUEU€}}"v}tރ߃} tE}tEHU e[^_ÍvUuu uÍvU,WVSEEUUEUvRv4%@uƀ}-uEEEvE}+u UUE}t}u'}0u!E8xt8XuURUEE}uE }0uEEEE5<=@}t 54=8EURPWVqE܋EURPWVƉEEEE©&v=w%1tEnUvR3 4%]ځvS 4%tCCEE;E}|9}wu9uw9uu9}uE;E~ E7vEEeӋEEËEEEM]EUUUEU€}}7<@EU}t48EU"}t ]U]} tE}tEHU EUe[^_ÉU WVS]E 0ESURtq;;}w1u9sE8uT]߅u`UttOu SƋE 0uh`hPW1avSjVd$19s(}t"jVURU҉EuC9suߋE8uU 2. E Ee[^_ÉU WVS}] 19s'vjSEPU҃u1]F9rܸe[^_ÍvU WVS}uzyu|a=.t[5.Sg+hS , EPS+hS+ hSRÃuSjj hueuOSjh heu5SjhhKuSjhh1tSF^SF1ɿvA:9u<2t1[^_ÍvUWVSuHEt>uhE}EUURÃuhjGqE>t}u؍e[^_ÐU WVSuE UE=tSv߰HPSVtu%߰HU C UC#;uUUe[^_ÉUuuhjGÉU WVS] 蛓0$װHPRj&jhj& ډװHPSj%jhj% VFƒӉ߰HPRj% jhj%EP%U WVSuu u1=tEPcEx}@u}LSE0WaE)ރPA t$=t EP#E)1u } tUt]E PVSރ>u}~u~u ~ >ub~u9Ft(>uF~u@~u:~ t49F t# EE U1Iv=~uB1ۿv<8tURURU RV8ЃuC~1e[^_ÉUuÐU,WVSEE}u1E8t8ЍPMYt*;t%8tǰE;u܃UMTEH MXtEuEE‹ETR EuE 1/uU:t*M12Vƃ vUEEMAUZtLE;t@8t0MAU4BU3V^ƃ;uUBMBtUBMAB A qZtEEtE;t2vUBM4AMEp 3V+u;uыUBMEe[^_ÉU(UE MEAQu A  A EAEEEuQUWVS}u E w} u EgE쉅$UuU $EB1Dž(vE (uEXtV Q;tLU v1F9} 43`zu9u  G ;u((~EUB U ;B t$@@ !vUB$BUB $B l$P1Dž(vE (uEXE (uE@ $;B u5;lF;u;tz,lT 8ǂ,ǂ0fǂ4jhD9 PF;uv((lu$P*$UR E P$[^_UVS]u tP{uHj t/@@@ @VSP 1e[^ÐUt Gt>EE@E EE@EE@uPuXÉU,WVS}uUf=,uy}/M}1EEEU U1E|}9}3؃A.A%A.AFO;u |ԡ'+Acv fÍf0A v]fӍfЍ(ˆfЍЍf0AfӍЍf(€0A.AFO;u ///BABAB A hPj jPBƃ TEP]Sj PVP@ t9UUM MEUDžMQS1[^_ÍvU,u D |}t ,ÉU%,ÐU WVS}u =`5\5.?@Åt9{utVs uك=.u?`\؍e[^_ÐU WVS]uf,up u /c,tSE PEPh@hWjjjSE PEPj(Ã0~",@tEPhWSr Ã%,t hZ諶/EPEPSPÃ}&,t hxh/Fu Ffuw,t!F%PFPhFw-$/"// /v؍[^_ÍvUWVSEEEEE,u u /vGi/1E8t 8.uG@8u1;Ev x.؅u3URt URURURU RPE$.9r5EPUREPU RjEPY C/UEu=,|,1۾-=-vEPUREPU R6EP "h8=/t t%"uEUBuEC,uC>ty}u/u ,@u"EPUREPU RjEPL=}tU/'v}t/}t /e[^_ÍvUWVS]u ,uu /,t%EPEPuPSh uF߰ЍpTNx <.uVSSEZvR߰҉ЍD=~/5VShP%uuEPEPP[^_ÉU WVS],Bh FphPyǃUjWYE!vRv4%@uF>ù>SPx[FvRG 4%@uҀ>^~t4vRv4%@uC;uhVh~CWV~.vWhP迷W#1[^_ÉUU h%PRuÉUWVSu}}t}w} mv=t VpEV7~0tF@9F0tv07F0FF^ }v \}taEPEPV Ãu E }} uZWE uDE;}t}WE } u f^ FFCFFZˀ;}t}uf^ E F~t tF؉Fv~ vF.=t VioEe[^_ÉUlWVS}$u(,uu /8,t EPURE PURh r  GG}f--fE$gG,$gGg_ }Em} }tz}neEPEPVSU RO D)ƃSEPηSEP轷 UfB} }EPEPVSUR ÃSj dSEPS Sj*Sj4UfB E 9|vCSEPSEP SjƶSEPͶ }tEPURS(]UfB )e[^_UVSEu 0U)‰Ѓ ~_CSj)\SEPKCC Sj2Sj$F @fF )e[^U|WVSDžDžDžDž=,u ,=,u ,,u ,f=-u t f-,,5f,,jh,h),%$. $. .;hCƃhVh -". -5--Dž= -t|=-sa= - tXv> t> uDž%vt0DžDžF>t%=-s > uF>t> t > t> uhOhQh8;#jhbPU t  p t  u F> t> t>B> 9hVh -.hih -Rƃ tDžjhmPT+ t   t  u F> t> t>> yhVh -.j h -.Uƃ t -5--Dž= -t[=-sE> t> uDžvt0DžF>t=-rF>t > t> uDžj htPS t   t  u F> t> t>6> ->t8vR v4%@FC;uȍ1DžDžj5hj S5PPSV zzw")rrP )1 󫋕zw#,rrP.,DDD 2jhPQW t  A tF> t> t>^> U>;L1vR,v4%@u(F>t"Ph@Qu >;t>}PW(.Qh@QF/vRpv4%@uF>t >;t>}PWbt,."􋝌(.,.ǂ@+(.D+,.T+UPWj買=ǂ@+)    T+F/vR v4%@uF>t >;t>}‹&t/u+W-ƒ SWj̶t|*1vy ٸCGv؋ǀ(.ǀ,. HjhPFNu) t  uhPRhP ~ ,%$.$.􋅠P.= -uChS.!u(j.SLNƃtFPh -u- --1t ,$hKƃthV ,1x[^_U WVS}u ,VShà{vC; t; tjhSLuRCP*$%$.$. $., $.PhDvjhSDLu9,uVWh ,h!jh+SKu , j h1SKu ,aj h;SKu ,Aj hESKu ,@!jhRSpKu ,@C;t; t; u;e[^_ÍvUE|)%=tÉUjEP13‹E3E1%ÉUEvÍvUVS]s{tsSu׍e[^UU:t.Ej EPR}tE8u v1U|WVSUE}EEE]ECCC CCCC}u} u (zzzzt EBtttEv߉{tZ{ tTE=|DSE;u-xt'xt!CM;AuC ;AtE CEE8}% =t=Iv= u {tcv{t {t{uB}{uCE PS Eߍu}E=.vߍuE8CU;tBt :CM;AtAt yC U;BtBt z{uMC{uExt@C{ uUztBC }uEPM QSEPE PURS'E}}tMytE@EtxuEU:}CtEE}uE1CtEPf  vE=ߍuCU;C;BtBt zC M;AtAtstyui{uExt@C{ uUztBC EPM QEPSE}tUztMIMtyuEE81}tE}u}t EU1$E}t uMEx[^_ÐUVSu1ۋF=t:t @8t:u#uAt 8tA8uAut;u1v[^ÉUWVS1ۃhhN:vƿt9ƿt&ƿtƿu<BUvƿtƿ#u<?ƿ(u <CCPz7&PhPϞP-|<vC~[^_U WVS1EEUREPt 1v=u61ۿ<v<:tSEPE PEP:Љƃu6]t#vjURSƃu[uᐋEU1C~}t ue[^_ÍvU,WVSu} EE]jjv)}7J8t1vPWVuكvttpPVoCt#vpPVSCu %jWszÃu EUb}t u؍e[^_ÐU#th0V1Ãth3V1ÃtDžCt;kv; t; uCCvރuh3S51ÃtCVU R[1t;u}uEPEPjPt0UtQSR[uы[^_U,WVS} E]hh6 ƃu QCtt[t{uEPWVu҃V}tUE1ve[^_ÍvUt8tF8u 1EEF89~ulWƒtZFM4REPCu ELUt6sRBE؃u,[t{uE܋FM܃<uUE1}t ugE؍e[^_UWVSDžDž,uu /Qv] sfC{hPjjjs sEPjƒ0~%,@tWhPRƒ/WPRPƒ|Fu FfuFF%S*uQw4$Dv/"// / v[^_ÍvUWVSE @EEEE,uSu /6/1E8t 8.uG@8u1;Ev x.؅u'UR{tU RPSE$.9r(E PjUR5/EEu=,|,1۾-=-tzvU R6EP58=/t t%"uEUBuEC,uC>tt}u#u ,@uE PjURH9}t E/$}t/}t /e[^_ÍvUWVS]u ,uTu /uH߰ЍpwVt!N<.uVSSEZvR߰҉ЍD=v/*VSh\P%uPp[^_ÐUME EUB EjjEPQjRt1vÐU WVS}ƅuKvV;~tWsPtՃ{uV31e[^_ÉU WVS}u \ÅtJ؃;t/v98u PvBAuS)8uԃS31e[^_ÉULWVSEEEEEEEEEEEjjEPjjEP }1vuE؃uйẼLP豹E{jjEPEPjEP= UUUԋM؉M9 vEЉEȀxxEĉB MUʋE܉D]ȃ`U#BtQ߃u6{u0SMM܍CRPQ]CE܋M̋E@E܃?t H \uEU;LuFLP袸ÃtqLPMQSEPw] UEЋM9ME<U܍:PCÃu"0+nv0 ^vMQPEPz]1;u}%MMMDЋMDF;u|ދUMD}tEP諸}tUR薸}t MQ聸Ee[^_ÉUucÐU WVS}=XE \5.Wv6Wet&^;t:3WIt ;u} t!E Pv #t ƅu=.uX\e[^_ÐU WS5\`%PhhP `\ =duhd5PP߰HPSh5d2 tFu;PP߰HPSh5d}2 t19hhu z[_ÍvU WS=duhd45\5XhhS3X\ PP߰HPSh5d1 u9hhu 蓵1[_UVS=duhd:3t1=PuW=ht5h4EPEPhhhh5d,3ƃ uSPWvhEPEPhhh5Sh5d4ƃ S跴tP10uuhhu uwe[^ÍvU=Tuhh~T5TwE .ÍvU=Tt5TOT.ÐUVS=Pth Rt =Tuhh}Tt!5Thh Q~ƃu1e>+u[jA;tJ=Xth '=`th  h P>#nhV} ÃS5$hVY ƃ/F> t> thV/ ÃCV%,0@(ƃhSÃtBCt<;t7; t/; t*ȇsvhSÃtCu$e[^ÐUj ju賻ÐUSMD H }'B+v1;}; | ;J~@;|[ÉU WVS}1=pt4lW6u pvF] j uÃthuCu讇¡  C; t; t@ǃhSÃtACt;;t6; t.; t)ȌshSÃtCue[_ÐUu hu'ÐUEuh0莆PÍvU=̛uhhv̛5̛&oEЛU=̛t!=Лu5̛̛ÉUVS=̛u/hhưu/15̛hhuƃu/1l>#tǃhV}ÃthVcÃtChVj膂~UvhVj`Q, t$hhr v0,(vC; t; t @$ƃhSÃtACt;;t6; t.; t)ȍshSJÃtCu/ e[^ÍvU WVS}j#^;tW3-t-;uƅtE 9FuW6ue[^_ÉU WVS} ujÅt9suWEPC0躉u~؍e[^_US,tK u ukl6 ]ÍvULWVSE DžUE} t% }tD}:Dž  Dž,UBЉUB%Dž`Dž փ ;VPURsà ҃t;{}t }u?vӁL)‰UDžDžDžDž.;vVPURrà 9҃ލF ;VVytǃVkt }uuV7t.vV4tÃ3;3t}t }HhWVREPqà 8W҃!;]Ӂ);P} hWVREPpà |BWGrt2;n;~:vPK)v;}tOWPEPPjPURh j%S 0{v t# svbPGtURVPURpoà otx; u/HsvӁ~v)ov5@t%5hj% ރ>v;t,u'ǰ))‰=`rSh^r,Qj#hq:SVYb)ރ;t+vWhZu~;s 0$.t&~}uPh=uM};iaURs), tPPhew/ /1[^_ÐUEtuvPuu u ÍvUWVS]u ,utu /#tt(//5j.SuS肰ƒt=w%v1 ڀ;{.h`SVyv2hSh`{aDžaDž``, tPPR\u/=w%1u:.uB:uӀz. =w$%v1tj:S7u ;:ڀ;{.h`SV-uhSh`wzaDžaDž``/=w$%1u ::t:.uB:u΀z.,hVWjS茪 |%WSPV*//Ph1[^_ÐU WVS},uu/1}uI} uCj hW|tj hW|uE EE }t }t v//v;E t/1wv}t }t0vPGPGPGPhP襝 P>%P>$%Ph SrÃNy֡C vhPj jP!ƃ } VhvVh@1vj PVPÃu1qECE C Ph`EPN[`}u), t h`h`qCC /؍[^_ÐU\WVSEM1E 9E}v$.ЉU1;us:#,.9(.t($.л,.vF9s#9(.uEf4x}u~ Dx9}}G;} |}t\] 9]}TvuNx@Mv6u f; ~& f f< ED]TNyEE 9E|[^_ÉU,u аt}t ,ÐU%,蟻ÐUVSu];s~s~Vu 33)s1e[^ÉUEPu uÉUl WVS]u tShj#كnu BjjhljR7\ǃ 􍅸PCtShWl, PPhRPhWA, ؛ tWāꋅ+P=ܛu$ܛt5ܛhW+؛tPhW+=ܛthW+hV@jjhljP [à uNWоv<%u(~mu"FS􋕨RtP_vSP`FuSj_Sqƅ uVW-WK+ ؛ tT)‰Ћ)‰DžDžjPjy=uj؛ P5ܛ jPW5ԛRajRW5ԛ(a}v؛tmjjh;ƃ|Sj>W@))‰SDžDžjPV藢 V连[^_U=ԛt5ԛ藞ԛÐUVS=ԛu/jjjԛjjP8=ԛ=EjEjhhu]SqjjV5ԛ4 %uPjhhSpjjV5ԛ %u5ԛ藝ԛx[^ÍvUEUtܛE ؛tu؛tÍvU5ԛ ԛÉUUtÐU WVS]u EFt7ЍxCu1:EuWVS`uK؍e[^_ÉUWVSE} " Btpv9u Bu@u1[^_ÐU WVS]} vRdnƃ44GvR:n49u Cu1QvRnÃ4Wv Rm 4)É؍e[^_ÍvU WVS}]E EvvRmƃ44E@EvRXmv49tWvR+mà 4EPv Rl4)ÉCtO>1e[^_$FreeBSD: src/lib/libc/i386/string/strncmp.S,v 1.6 1999/08/27 23:59:35 peter Exp $SD$L$ T$@AJt}tm8ui@AJtnt^8uZ@AJt_tO8uK@AJtPt@8u<@AJtAt18u-@AJt2t"8u@AJt#t8u@AJtt8t )[1[$FreeBSD: src/lib/libc/i386/string/index.S,v 1.5 1999/08/27 23:59:30 peter Exp $vSD$L$ 8t@u1[ÍvUVSuU ]u CFl vCB3s sߎS֎Npe[^UVSuFltXPjV؃ue[^ÐU WVSEpl1EPkt(E;F|^VWEP3܍vvՐe[^_U WVSu}~pt V~p~=1ɋFltv9P}P@uAVKj֌Ãu ltPE0訌Cu3蔍-7膌Cu$jr3h S\PjiCUCS PsEp)N 7swNFlC^lFpe[^_ÉU WVS]} uSM[ltOv3W u;CuPsvm[utC UCBv1e[^_ÉUEtt.tt k1s)!Phh蕎ÉUWVSDžDžDžj/uuǃ=tB9=t:5.t&~`t VAV裋ރu.=} t E }t}u 5.6tFPu{uu4jt&ƃjtVF\FhDžPPv\tu f;FdtM~\WeÃ~`tF`PPBЃFhF`WSS蓔 ~hG~`t F`PPBF`F\juhhhS. jS<ÃjSd8#DžDž jPS腗Nj9tS臓VhjFHPFIFHFLfFJfFXS>(S/Fh@,~`t F`PPBF`F\jSlƅDžjjPjhSà u:=/=/ =/=h)f=v{CS@gDžKRPPhURhjSЉǃ tFCS@Fh uh hPatKCS@FhBPRYdCS@ЃjFHPFIfFJFLfFX FhjAuFP~`1DžF\h hF\PRPjhFHPvF` uhS'Fhjjv\YuhbJDžSSv\Dƅ PSv\ufFd/vF`PPBЃt V訅 $t .5.} tU 21h[^_ÉUWVSuE~`tuEPEPv\ht}u Ef;Fdt8^\SǃF`PPBЃ SWW F`PPBЃF`F\FhVe[^_UjuÍvU WVS}1.tHCPW迥u,St .SP ދue[^_UEU@PtMU2Pu^DMM1EPEPt vUEj ]SE@`HE؋URPShEPhjEp`ЉÃ0t)hqEp`#uC cvu ÃuOEU@P肁MU2PulCMM EPEPuuEPh{؍e[^_ÉUS]=`uhh`^t `1]ÍvU6.& ÐUS]=`uEPut`h`'t1h`']ÐUU hBPRuwt 1U,WVSjEP EEUREP\u!URh$pE 1*}u"URh$pE vUUtvE@PuǃuWu7E8 E@PuÃuSu7E EPh$o5.uSuWUR.ЉƋUE 0WevS\v 8vEPh$oU EPh$oEU e[^_ÉULWVS} ]$1=`uE`j tEt"DlPtƃu0hhPn / /DhFXjEPsUfzu(jEPU REP蟃fgUfBE@pUFBF BFB FFEUFV F$F(~T^\F`Fd`3`3E3ẺEEEE E܋UUjWvX^8SeEPSh F]u~tuE0scvFP^LS@ЉFHFPxt S@ЃhhdVuuFLPIRGw O  t Vht W{h1e[^_ÐULWVSEXsLS0UE{u E U$CS E}u } u}$tEC$U ẼVsHC0PVB ЃtDFU RV@Ѓt-UP VPBЃtEPVU҃u{$uC$jVUlEPVUuC$Hv}u 18v} u}$uC$v..E܋GEGEEEVuTEPVZu{$tvU9UuC$PEP[{$ukEJ EPRAЃuC$C(#vuVU҃u {$uC$}t8EPVX#mrUP PB ЃC$e[^_ÍvUEM PB$B(AB,AÐUSE] M@PL@LQRӋ]ÍvUÍvUEMPE H&$BB BAB BBR QBBABAB A vB0vtvHB0teB@]tRB@Jt>B<6t*B<"EEPQ2螼}1ÐUVSu^{t 3bnSPztCLPBЃS&dVde[^ÉUWVS}u 1nvEB=~=Z Sbƃu 1SjVguhV7jxP菹MAQ PT`} PTptpPjjV@P蟹H LjhPhx)‰`l|)ȉC}`C@B`}W)‰XXCO )ȉB} XB@BX\PTP| uTu DžHHt-Hu\E9t V,b}G$8E9t VaE@$LP(SMQu }7 lEtu-G(6G$E/UB(B$E([^_ÉU WVS} u~=VWE0kÃuUB(B$v)߅ċEe[^_ÐU=huh`hhUWVSuEÅu 1vVEPVBЃu.Pu hhS²߰Ѝ\@}E$vu>Ph+U)PSp{uƃhISb߰Ѝ\ tVhRvuh`vuuh SWbuuhSCbEƀ ƀEe[^_ÍvUu uPhRhPaÍvUEv  ÍvUuPhRhPÉUVSuÅu 1v/ tuM5/x5/<P5/TPVh8hS$5/+PVhEhSƃ ƃ؍e[^ÉUu4PhRhP8ÉUEv1PÍvUu uÉUWVSu uMDž|u|PVEP ^|jEPav^u+DžlDžhDžpDž|Et".%Džl)DžhDžpDž|~^|fukDžxxPtPhPlPEPkà jpPhPlPEPà |||VEP Ãfu]G8t)jtPhPlPEP農 E9t"|PVEP葴}8؍H[^_ÉU VSlu$j@jFÃu 1l{<ux. .K PS@C SCC (ujjC(PV^LSVHN C PV8NFV@ЉC:u~/t>/tj.Vt1u D&>:uF>/ЉDžSװ҉PSehgSkf VS^fj.V# t DžtjVpLjVÃEPSbE%f= hPS=cƃS c RQ Sk} PWG RBGQ0G ?2LB5+r 2 ;GtU ;Jt)É؉)} WG@BG 91E ;p}+Ã􋕄RIFM ;q|1] ;s}1ځGM ;A5F;q|1] ;s}n} L􋅄PCB{CB;G FM ;q|1] ;s }%ځLGFE ;p |U ƄL1;2}>M L􋽄W'WC FE ;0|1U ;r}HM Lt"B Cz vdB F} ;w|1E ;p}FM LtBCzv 몍vBF} ;w|1h[^_ÍvUMAtƒЃ v,t -t+u߉ÍvUVS]ut= Ѓ w01҉TP9C Ѓ v;U| E 1[^ÉUS] hjEPut[U)9:uLAj;jEPQ\t(E+E9:u!AjQщU)Ѝ9Eu)Ѝ9Eu)EE}2;VNE1ۋM ;Y}OPu L*C} ;_}$;8Puߋ8L؉EE1ۋE ;X}SU Pt L+vCM ;Y}$ PtߋL؉E1ۋ} ;_}E PEu UЉUMԉMv}; }9};E \u#1tXu E+EE+EM Lڋ}<8tUvUCE ;X|MًU LǂPǂT}߉`ǂdE@h8EU BBMىLǂPǂTE@} G }t UċMDG }  /] LEPURS.)]C}tMQ}WS )E1e[^_US]Sh@8tjSh@]U=@|5@hjthDÉUWSh/MÃu =@~Sh@Ul߰H=%@tSh@V;u=̼Լh@hV?hSt,;:tjhSth6e[_ÍvU WVSE}E~t;F}1ҍP<t6B;V|1,;V}E;F|NvB;V};}2LWV3EP6SW CL\G(e[^_UVS]u 5VjS=e[^US]h`jS`]ÍvUVSu ]=DuDh`JSh`Vut C(Q vC(e[^ÉUh`ju`ÐUS] Sjuh؋]ÐUh`u uG`U,WVSU1E IuP}썲LL};EuUB};D~E}tW~SA2@93u5u2B93u)E~!I:@9;u 2@93t؋EXIUU E.‰)ЉEU))E )yMQx vEQų )‹uV)))ЉF))EM$I)))ȉF}FEEM)Ћ}Dž}O+]؍؍؍G}GwuQ։U)))4EHyEEHEQmӉU)))))E}}E1ۋMu>QщU)Ѝ9Eu)Ѝ9EuM; }ǔu~NF;|MA)EAAu;4}E@}G G U W$[^_ÉUuPU8u EPuaPÉUSEM  9%1[ÐU WVS] M;| 3 Й։)Vue[^_ÉUSUM AZ)É؅u@AZ)É؅u2A Z )É؅u$AZ)É؅uAZ)É؅u)‰[ÐUWVSE}ԋu jMALؙ]u!!jVSqMуu E@UBz0t"Ѓ@9B0tr07MA0E` ߋ})tP'^u(U9zr :)z=MQEP8"u$URE URPUrMуu"u=t EPlSUz0t"Ѓ@9B0tr06MA0UBBb ߃=t R1x[^_ÍvU WSE] EǰHEUBUE=t S襺EPSǃ=t S薺e[_ÐUVSu] =t STKyC;C|< tSV+ƃ=t S'e[^ÉUVSEPu e]ƃt+Åt huu辥} fC 1D7;Es5^SURW0]߃B;}v!}t M(+E e[^_ÍvUShPuu uAà t$uuPtÍvUShSuCtuuuu SÍvUVSu] 9s!@tсt t@9w1([^UEރ:w$hv1UE߃]%ÉUUBvB ÍvUWVSEEU9EEU2u%t =tl~UBU9t.UPBUuǃPFf 9uWKuԋE8u@>u E+E _vU:u(2؃? Ћu Ӡ(*vFTEE9E0觠e[^_US] jEPu1C@ ~CCjSEP]ÉU WVSEu }xu]x uW@@ X;tA)B9} &)63X;ue[^_ÍvUEM UttRQ"RQ蓟/ÉUWVS}EEuEeShTZƒt1TB=wW}u/E}FE.u7}t1}t+FEGu}~UE v1e[^_ÉU,WVS]ECCC mEE8:u @E8:yUUEE2EvV_W]uVpWGt e) E܁}Ey:uG}}}u}]XC;EECE܈CEE-.s;uSUR&*}7G}*}tC;EvnECE܈C}t,+u9M)ى)ڋ}::C9~];]u"EU EBEBEB 1e[^_ÉU WVS߾fjSEPj؍e[^_ÐUEPuuEÍvUWVS]1菜jEPSs8"tM9]tHE4]tM<.u t0GC6v RX 4%@u1v1vtt&tIwʁ}wEpvw}w}wEUCw}y}l}_EU ЋU ƃ} tU e[^_USM< @ }'B+v1;}; | ;J~@;|[ÉUS]jEPXy} tEE]ÍvUME EUBEjjEPQjRDt1vÐG.v̀rÐUVSuUt$] CAuJtvAJuvJu[^ÍvUSE]|+;8}#S4u 19r"]ÉU,WVSu|;58} yv跙}ٍ]bp)Ȋ8Cхu}-ChRh -/E9r KB9s e[^_ÉU WVSuӃS ǃtSVW%v1e[^_ÉUWVSuEFӁvR 4%@uҀ-u E+uF}t}u0u>xt>Xu ^E}uE 0uE1uEU1EÉ©=w%1tnӁvRv4%ۉځvSv4%tCC;E}=}| ;}wu;E~ EE}NJF€&}}B" }t߃} tE}tFU e[^_Ív$FreeBSD: src/lib/libc/i386/string/bcmp.S,v 1.5 1999/08/27 23:59:29 peter Exp $WV|$ t$1L$u L$t@^_ÐUu u\t1Uu u8t1Uj@u u t v1Uj@u ut v1Uj@u ut v1UE hPPuUt 1UE hPPu)t 1UVSu] SVtACPV,t-CPVtC PV,t1e[^ÍvUVSu] SVt-CPVtCPVt1e[^ÍvUVSu] SVTtCPVht1e[^ÍvUVSu] SVtACPVt-CPVtCPVt1e[^ÍvUVSu] SV\tCPV4t1e[^ÍvUVSu] SVt-CPVtC PVt1e[^ÍvUVSu] SVtCPVDt1e[^ÍvUVSu] SV|tCPV`t1e[^ÍvUVSu] SV8ttuCPVu1e[^UVSu] SVtCPVt1e[^ÍvUVSu] SVthjCPVt1e[^ÍvUVSu] SV`thjCPVt1e[^ÍvUu ut1UVSu] SVtCPVt1e[^ÍvUu u$t1UVSu] jSVtjCPVt1e[^ÍvUVSu] SV|t.tu"CPVCPVou1ve[^UVSu] SV,t-CPV,tC PVt1e[^ÍvUu ut1Uu ut1UVSu] SVtJt"wt :t#2CPVCPVCPVu1ve[^UVSu] SVHtJt"wt :t#2CPV'CPV[CPVu1ve[^U WVS}uE uSt uGjV3ËU uh@hP1u_SVtNCPV t:CPVt&C PVtCPVv1e[^ÍvUUE w:$|v8 0 ( @PÉUUE tu@PÉUVSu] Ftt"0~u fSv4Sv FCtwt ( t!FCFFC FCF Ce[^ÐUVSu] CCC t{uSuLC);S|SBu+1KB;St C t uSte[^ÍvUSE] MUtt!RQS) vRQS}v߀/1]ÉUWVSU} ]BPBPBPPhuVv 9wVW 1e[^_ÍvUlWVS}1EEEUUME<M)ȹ)ȍ M E}~E]EEU<uu Ӿ Ft}t;u~]uE}~t}t;u~]u}t }E]E}t&M9M|E9E}9E:C}t:C}u\}uV}t}uJ}uAEЉ)¸.)PSE P:߰Ѝ\*EU4hS ÃE}?}tEEu:CCUЉ);EwRM QE ~1e[^_ÍvUWVS} u]tVtACtJuutAu)H[^_ÍvU(UE EPEPÐUÉUSM] t$r t5;vEQEPQB#AURQЅt E1]ÐUSM] t$r t5;vEQEPQB#AURQЅt E1]ÐUUM trt"(BQR@BQR 1UUM trt"(BQR@BQR 1USM] t$r t5;vEQEPQB#AURQЅt E1]ÐUSM] t$r t5;vEQEPQB#AURQЅt E1]ÐUVS]u tGrvFEUBCRS@Ѓt^CURS@NCURSЃt6CURSЅt#E1҉Ӊ1ɋE1 Ӊ^1e[^ÍvUVS]u tGrvFEUBCRS@Ѓt^CURS@NCURSЃt6CURSЅt#E1҉Ӊ1ɋE1 Ӊ^1e[^ÍvUSM] t$r t6;vEQEPQB"AURQЅt Ef1]ÐUSM] t$r t6;vEQEPQB"AURQЅt Ef1]ÐUSM] t$r t6;vEQEPQB"AURQЅt Ef1]ÐUSM] t$r t6;vEQEPQB"AURQЅt Ef1]ÐUSE] UURPt E1]ÐUSE] UURPt E1]ÐUSM] t,r tFKv;%EQEPQB*AURQЅt}%1]ÐUu uÉUVSuM UӃt )؉Ã>u.FRQV@ЃtRtUFSh`V@F>u/FRQV@ Ѓtt"FShV@ >t1ve[^U WVS}uE VW6;uv?uwt rFtQgvu[u,VsËE uh hP#)VSWvtS3E 1e[^_ÉUE hPPu-ÍvU WVSu} ]WVLt{t9t{u}u1$jEPVCvjURVUҍe[^_ÐU WVSuE t u߰HEEPV;E9Ew|UBt rBtNhtZu,RËE uh:hP迒5EuSV\ SE v1e[^_ÉUju u UhEU fEfEEEEEEPREP#‹EÍvUE@(X@,1ÐUEU} ut@0 tH ÉUM U}ttEtA vtÍvU= ‹BBB BBBBB B$B(B,B0B4B8 =$t(‹BB$ÐUSE$hjjhg5hPà u=t5b؋]ÉUX=tUj juuUSE hjjh5 hPà =55k¡ 5Q¡5:¡ 5 ¡5  ¡  5¡5¡ 5¡؋]ÉU帀=tU|WVSE U }uuutVEP}щ=.5.SPhS URShS uSjS.iǃ DPW t0uP vPV螸ƅEPV|2PSW ;u;uwW@ugx u[PS@U9|@E9@|%@U R5@V}E 1/DžVWU x[^_ÉUVSEu 19sj Ph@C9r؍e[^UWVSU]1;u }װ‰F;u |[^_ÉUVSut>u >v:;:-uz1uCBr=w%1t B=w%1tB  u9tvCB:i[^v̀rÐUWVSuEFӁvR 4%@uҀ-u E+uF}t}u0u>xt>Xu ^E}uE 0uEE}tEE1uEU1EÉ©=w%1tnӁvRv4%ۉځvSv4%tCC;E}=}| ;}wu;E~ EE}NJF€&}}}tGl" v}t߃} tE}tFU e[^_Ív$FreeBSD: src/lib/libc/i386/string/strcpy.S,v 1.5 1999/08/27 23:59:34 peter Exp $L$T$QtLBAtBBAt8BAt.BAt$BAtBAtBAuX$FreeBSD: src/lib/libc/i386/string/strcat.S,v 1.5 1999/08/27 23:59:33 peter Exp $W|$T$ W1OtLBAtBBAt8BAt.BAt$BAtBAtBAuX_ÐUE9vMQSU҃ MQWU҃‹E} v؉E}uMMMEJv}&u]MNvu]MvCAN}}}E HEEEEmueE}uME}&u]vNvu]CANEE};}URWMуs|uqE}uEMMEH}&u]MNvu]MvCANU)UM)M;}EPURMуa;}wl}uMD}&uMvNvuMCANE}E)E}UUUE EE9E EEEЉ}ev}u+U Jv+E}%uvNvuCAN+};}vW+EPMуEEU9UiE EEEU+U+E9~Ѕ~E)ƒ}$]щNvƋ]ѐCANU+UE+E+E9vЅ~CU)ƒ}!ыNvƉщCAN+E;EvMQUR1uPMQE+E;EvU)‰U1uE e[^_UjuÍvUWVSEPEP@$E%f=@tbvjUR*[DžEPS{E%f=@t5bnjjP<Mj o2it DžU tFPSR8tuvR=kR0t%C$PSW&t E8 vE1e[^_ÐU WVS}=u EPu &ƃt5jjWh,Ã|ڃtE9tQ1?#tfp Et uH fx@@$ @,$ @(h @ e[^_ÐUE URPjujhVUS]SEt K]ÐUUB f t1 ROÐUS]=.uCC C uMC uP vC t&Sc CCK 6{0t.C@9C0ts0C0Ct36m)KC =~I_v~tFC4~t F ~tFE~t~t ~uFCMQSu1e[^_ÉUVS]E H{4@}P(SDAK C$jP @PSpQ t QVS0S(uC,K@C<Й{@PC(;C~CPS e[^ÉU WVS}E4jWx-t GEtN04uуWt}u -GE1;}*8<0t40pC;|܃teWA}u1FUe[^_ÐUSE} tF?tX4t+jjS3,uӃSuǃ01]ÉU WVS}4aGj h ЉG@SW0 jjjVut6hSVat=t"EOE,Bv1ۍ8<2t"jjXP42W M uC~1[^_ÉUSEX}uuu jS Eǃ,]ÐUSEUXt$tDǃ,GvuDǃ,vuu uPSl]ÍvUSEX}vhDǃ,/tju jS"7Dǃ,]ÐU,WVSEp URUM MjjRQPmPEP@&EuUUXMMIEXUE9U.vf{v5)9EuuMy׋MHsEf{uAjEPPUR%EX MEEp f{URMQEPURMQUE EEEPURPVfju%PMQ$E~XEEUr E9E} w/} r)URMQEPURE E`;Ub,v} r,} t} vMavEXUf|SwjMQRPEPUUDSMAMECDK)‹MQEPURMQ>uEPURMQEPDtXUbSMQEPUR>t02vMaE` Ub1e[^_ÍvU WVSEUpt*t%t @dž,$|udž$dž(dž 1 u^$ Cdž(;^(w#jjSV"ƒt zf?t͉$;^(~dž$A x(f|GuA=C=A>CEA?A@EUBA@BAABABEAC1ҍyD]vECDDCDECDFEDGVfEEQEQB~[^_ÍvUWVSu1Lhhxt#x=x~ttth Džt|uDž|x}uEď}uNLECDž|xDžlDžhLUDžtEďDžx}t }h$胾à 1ǃEǃ|Eǃj$$Ɖso1 󫋅L9t ^FXUFiF LF ,MFcF܄FlV}tWE  tt uU RMQ.-vE  jj0oEPRE EjEP'}b1u  EddBEBEBEdEE``BEBEBE`EE\\BEBEBE\EEXXBEBEBEXEETTBEBEBETEEPPBEBEBEPE}b1}U=EE_xE EEdxu0Ex=w Džxxv Džxhu  ǃǃ xlt*xI#ltlBl!‰lx9lsllO1Nj1tffw fǃWjI uSh8QhM3JStRM t!@E@t!}}"[vK2v;2Ot7{ts萺tSj18[^_ÐU WVS}jj7Jƃt jV181EP7AIƃt|EP7*IÃte}u_CCfCfCC jV蒽jV7MK jS7=K1e[^_ÍvU0VS1 uh=Ã؅uPhhVB ]SV EPSj0 V à t V<jEPj ؍[^ÐUtt  1USEX{tjs3:JC u v/]ÍvU WVSEX{tjs3IC}t/}EPu S<ƃu[}uj63I@jPujjVS6?ǃ !@tj63JICe[^_ÐU|WVSEU } uRUӋEUBBCBCECCEUBCBCBCECCEUBCBC BC EC C EUBC BC BCECCfEECECCfEECECCfEC 1f;u/CEUUEEU܉U}ؐ֍ EfEEDSEDSU EUBBABAEAEUBBABAEAt?AE܋UBBABAE܈AE؊GGAGAE؈AfFf;uCQC @1f;u4CEUЉUẺEUȉU}ĉ֍ EfE֊E׈DSEֈDSU EЋUBBABAEЈAE̋UBBABAËAAtDEȋE@E@AE@AEȈAEĊGGAGAEĈAtDEUBBABAEAEUBBABAEAfFf;ux[^_ÉU|WVSEU } uRCfEC 1f;u1CEUUMMEE}vƋUB EUBBABAEAEUBBABAEAt?AEUBBABAEAEGGAGAEA֋MQfEEDSEDSfFf;uCQC @1f;u4CEUUMMEE}܉ƋUB EUBBABAEAEUBBABAEAAtDEE@E@AE@AEAE܊GGAGAE܈AtDE؍U؊BBABAE؈AEԍUԊBBABAEԈA֋MQfEҊEӈDSE҈DSfFf;uE̍ŮBBCBCËCCEȍUȊBCBCBCEȈCCEčUĊBCBC BC EĈC C EUBC BC BCECCfEECECCfEECECx[^_U$SMEUBBABAEAYAEUBABCBCECYAEUBABCBCECY A EUBA BCBCECYAEUBABCBCECYAEUBABCBCEC[U WVS}w~tjv6AFjW6A~tv贯F Ft%茯dždžt%^dždžV8W/ S;1҅tЍe[^_ÉUSEX{tjs3@C} te&C t11 tS"t3@u ]U VSujj6C>ÃtZEb1EEEE %EjEPS;jS6?1ve[^Wv\̀rÐUdSMU Ӆt S}EfEfEMMUUPuEPfE…tEЋ]ÍvUu jEPutUÐUjjEPuvtUÉUS]jjjSN1҅tډЋ]ÍvUS]jjjS&1҅tډЋ]ÍvUuÐUlWVSu} t}tC$l;tC;u+]K9r.%))ŠK;XtύSU} u }tMvK9vC;/uEPV/E%f=@t#} t.hh VU }*b#8tQ}thV0uָlEPV_t#8%D];t79t3Pht@8u 0CӍvCv1e[^_ÉUWVS}jEPEjjh 2à |jtEPS"SE|Džxw 0_ˈwxw|GG02G 0xx~X[^_U= u+1vB@=~@A h@ÍvUWVS}u = u @1ۍv@@BAȈEؙE:A@ABBABC~[^_ÉUS= u@@B AAB@BABB@@B AAB@BABB @@B AAB@BABB @@B AAB@BABB É[ÍvUM19s v@9rÍvUVSu1ۋM Itۍ1Fs%0))É[^ÍvUSM] 1iGuWEP"jWE0l(vESG9`SG9u.%CPWE PEPƃtsf{uECfKftSE PEPktGtIjWE0'}p1EjWE0'.jWE0'WEP,e[^_ÍvU WVSVj6E0k%ÃvfuESB<GtG PUR!ƃDCu^;u!fCUfCC SEPSUR"v7 C؃)RPP-"fsUCuWEPEPEPQ]SWWEPEPEPVEP ƅEBFf9Es'%U)PЍDFPЍDFPfFEUԋB tdw tbMVF)fFfJEB0WMQS2UԋCMVF)fFfJEB0}u M܋vEЉUԋE܊H CEЅuU܋PE܃ PSMAq ]S f}tEDF0vEPTPEP U؋CMVF)fFfJEB0MQ UԋC vf}tEDF0vEPTPMACMVF)fFfJEB0UBC/v}M 9u9] }uuQS]vuuE PURt}jMQ]3rjEP3b E,U9tv1ۅjuM1 ju]31ejEPU2jMQ]3 juE0juU2 Mqe[^_ÐU WVSEPEPƃu 1qvMfFUfF] CFFC F {u:]] C9u$KfFEfU]3E7ǃujVU21v] GCGfGUfGC G {t?js2ÃuW辇1pCjSU2[u]SVWE PURà EWU R9u] WYU EE0؍e[^_ÉUWVS}EPW#ƃtEPW Ãu1jEEFCCFfCfFfCfFU B C F uuSVRW‹E0EЍe[^_ÉU WVS] }UfCfCC4G t G WwFCfCfCC4E@ tBEP4UFfCc K jSE01e[^_ÍvU WVSu UMfFfFF0CF tuUBNj F)fFfFF0C7G PSGtbw MQuKiEP‹ F)fFfFF0QRSSUC vfFf N jVM1f1e[^_UuPvv36xF3C P66G GC }Ct.EPUREP PEPuM} u E!@tzC@U;Bv>:u PDvC@PE0wuPUC@Bs PU2lCUBUUvCUB É1e[^_UVSuEfxuyuA u v1A t@QB@uv@QB@tX P UEt6PPEPSV t vEEPu Ѝe[^ÉUWVSu} W;VvVr:t)‰ACsGv)Ɖ[^_ÉUWVS}E P;WvWE r:tCAFsGU ;Bs@[^_ÍvUWVS} ]ujWEPjGPEPE U;Es;>uutu65u |vEUEU> ߋFEjuE0ƃt];]v]SFPWjVU2<E)؉E u1e[^_ÍvUWVSE UMEUx MM]EPEPÃu ECCC fCfCu9vVURCP@}tMAjQE0g U)]jSM1A1e[^_ÍvUVSu] jSEPjSEP ju6ƒu \vB tjR6Bvju6ƒt)]BERV9]w1e[^$NetBSD: bcopy.S,v 1.6 1996/11/12 00:50:06 jtc Exp $vVW|$ t$L$)9rL$D$ _^ONL$D$ _^ÐUMU BB jR1ÉUVS]u t9j3ƒtB  V3e[^ÉUlWVS} uEPW<{uE%f=t1lh(jeÃt[1ҐDDD B~E 1RPEЋURP؉e[^_USEU M] $[ÍvUS]uhhPosS u1YQE AAHTt HJ QACA CACA]ÍvU WVSU E;r1vE PURÃCHUL;t CBCACtXYK{tSC B vC UBS CCUBC BCBKvURÃ1E U1jWVz99Es&yU;t[OE CCE HULtXYKCUBC BCBtss$АCe[^_ÐUE U`P1ÐUS];t4 yt QA B A CQ AQm;u̓Sm1]ÐUVSut"vCtSVt"[u1҅tЍe[^ÍvUVSu; rrtlCu^CtSVtyCHT;tvCBS{t SC B C FS C4[uPkÅtCC1e[^ÍvU WVS} tE pp$ ЃU B1jVSw9u39u/E pyv;u U b1e[^_ÍvUU BE9Ptu1Ð_wv_̀rÐUVSu uVjÃt VS]؍e[^$FreeBSD: src/lib/libc/i386/string/bzero.S,v 1.5 1999/08/27 23:59:30 peter Exp $vWS|$ L$1~ڃ)Ӊك[_ÉUEPu uÉUS] {tSuP'CC C1]ÉUlWVS}M UG $fEGfEGEċG,EԍEEEEERQuVBÃ|VTtE@tO @؍[^_UVSMEU] t txv w K0 }K%)щʀ0gfffK)Ѝ)щʀ0u=K$0u}t(<0t$K0Kȃu lv[^ÉU WVS]u MEUυwRURPQS t#vwu wOjj VSe(0v(Ojj VSH(0jj VSb(É֍vOjj VS`0jj VSjÉ։ uOvO$0 u}t0?0t+O0%O؃ u Wkve[^_ÉULWVSkkDž =tEP<UB tzu2MQNt=t EPUB f uDfz|==t RMQE PUR_DžM Dž$DžEuuEEDž t%%t  t%u⋝+tLS^]E}~EPMQ u DžDžDžDžƅ  X$8uƅ 뵍v1ۋƒЃ w\BBЃ v⋅8$$u)0$$PQE Pr$t$EURAEv$t#$BvEMIvƅ+v *1ۋƒЃ w!v\BBЃ v⋅8$uw$u)0$$PQE P$t$ vEUZA5$t$BEMYWDžH1ۋ & \BЋ ȃЃ vԉDž1ۉ \BЋ ȃЃ vԃ$uC$0$$PRM QltR@Ft /" P$t$AEMA  tw$t*$H!EUBRt $uIj@t2$t$/EMI=$t#$BvEMI} ƅ- u u Džu Džt<$t$(ݝ:E MiݝB$t#$ݝBvEE@ݝ t+ܝEuƅ-Džv tDžF  t _Dž  PP RPPQP,0 gt Gu?~9~E gue vDž g eA QEPV fu;~&u tW|9K@;|Njt%"+ Gƅ- tI$t$AEUBHtE$t$BEMA?v@tE$t$BEMAf$t$AEUBv t[$t.$HvEUBRtA$t$JvEMI@tF$t!$B^EEPEv$t#$AvEE@ $t#$BvEMIDž ߀Dž x$t#$BvEMIu Dž|>PjR6t+;Ѝx tZ$t-$HEUBRtA$t$JvEMI@tF$t!$B^EEPEv$t#$AvEE@ Dž$ Dž  t[$t.$HvEUBRtA$t$JvEMI@tF$t!$B^EEPEv$t#$AvEE@t& t t tƅ|M tK u twQPRPQR=vu t1QPRPRn +x1  P Pƅ9}tt9}+~E8FEE}~EPMQ u8^]E}~EPEP]utFEEtcƅ0 ff FEE}~EPMQVu%=+~~~CHFEE}~EPEPkuH^]E}~EPUR-u)~EHFEE}~EPMQ`uH^]E}~EPEP"uu~} eG݅D@5FEE}~EPEPu;|FEE}~EPEPKuKH~CHFEE}~EPURwuH^]5FEE}~EPEPuFEE}~EPMQ`uۅ~~~CHFEE}~EPEPuH^]E}~EPURQuFE;FEE}~EPMQau)Å~FvHFEE}~EPEPuH^]E}~EPUREuFEE}EPURFEE}~EPEPCuFEE}~EPEPvu)N)‰EE}EPMQ-BBFEE}~EPEP;u݅E@t@JVEHEE}EPMQK~CHFEE}~EPEPuH^]E}~IEPUR)FEE}~EPEP/uUNME}~EPEPou+~u~D8FEE}~EPMQu8^]E}~EPEPu]}tEPMQu4Eu}tEPEP~uE t mLUB @t Dž=tMQ$t09$t$L[^_ÐU,WVSEEUUEEE@M EE/%u"E1MAMBX$1ҋu TPFЃ v>$];]|EPEPS;]~]E]jvE@E*1҉vTPFЃ v>$u9];]|EPEPS*;]~]E]Fu;]|EPEPS;]~]ECBЃ MAMBЃ v1ɉLBЋE@EBЃ v$v@t sk t1;]|EPEPS?;]~]E Cvt0;]|EPEPS;]~]EC@t0;]|EPEPS;]~]EC;]|EPEPS;]~]ECft0;]|EPEPSf;]~]EC.;]|EPEPS6;]~]E C t0;]|EPEPS;]~]E Ct0;]|EPEPS;]~]E C@t0;]|EPEPS;]~]ECV;]|EPEPS^;]~]EC& @;]|EPEPS;]~]EC;]|EPEPS;]~]EC t0;]|EPEPS;]~]E Cbt0;]|EPEPSb;]~]EC*@t0;]|EPEPS*;]~]EC;]|EPEPS;]~]EC}~UPkEMU;M~Ewj$UE U NvUE U :vUE U &vUE U vUE U A;M~}tE9Et uEe[^_ÍvU WVSE EE84?E@9}ƃu,V{DÃuHWSEP^VEPgÃuQH)PjPIE E0e[^_ÍvUWVS]M}u fu vetEuC]EuE]-vu(EPEPWSRu ugtGuEtK fu90uEE@t@ED@uU E0E9UrE$U)ʉȍe[^_ÉU<WVS}] Ew}G-wv+F ~AIgfff)Ѝ)Ӊڀ0à I09sAF9r 0F0F)[^_UWVS}E xG tuWF*U  MrUG t^EEUrUtvPMQwG,ЉÃl])ދU B)؉BuPG *M MEpEtG %Bf=BuB9ws=W)ӍOOPRGÉ_G t&9s~SEP7F)_v;Gv-9v)SURPFW, Dv_9r!SMQwG,ЉÃXSEP7OF)_])ދU B)؉BEEu EM MEpEt}u3Vj UR#ƒtEH)‰U vNMEU9vG_Ë;Gv'9~#SURPEW+ uw>_9|SMQwG,ЉÃ~TӃSEP7KE)_)]uW5+u"E])ދU B)؉B1 O @e[^_ÍvUEPEURPEU RP*,EUÉUjEURPEU RP,ÉUU1Bf%=uBu}tUE1ҋ@%=u }ЉÍvUVSuu Vm@Ãu t V?؍e[^É$FreeBSD: src/lib/libc/i386/string/memchr.S,v 1.8 1999/08/27 23:59:31 peter Exp $W|$D$ L$uG_Ð1_É$NetBSD: bcopy.S,v 1.6 1996/11/12 00:50:06 jtc Exp $vVWt$ |$L$)9rL$_^ONL$_^ÐUVSuP=pX@@ e[^ÐUug>ÐU WVSuFE^1M ME ЉUȉG;}|ɅtOM;N|7F@PDËFK V PRQHB V\ލFMU BVe[^_U WVS]} M98)1Ҹ~ vB9R‹EBB  ~$ PCj RƒF9|C! vPCj RƒF;u|Ѝe[^_UU1uuuu|@@u ÉUMt't1`t NB1fuuuuu @u US]jdX@]ÐU}ԋuEE}tl}$}tU3U96+EE,v]K9|) )]]1EĉEȅ} )EUUUjE~}~EE9~}ȋU)U))U}~h}tL~4VEPEURPà UR2]])t#SuVvEPURU WVS]i=t S5$װHPRj װHPRj HPVj߰HPSje[^_ÍvUVS]jG SM u/ +P ;rRu1ve[^ÍvU WVSu p=jjjhj Pjà t=P5S 5WPwd1e[^_ÉU\WVSE}u6j?}Whtdń>"}uhÃ.O;F> $v-znbVJ>2&5h5CE}>=t&EEEj EP=t =t jjjhjhje uh?j =u % jYe[^_ÉU WVSE]1 v t29Yruy9tABQMvyA)Y uSǃtW +59sv1A9r=t PhW }t"=u EvEPXe[^_ÉUWVSEwEHEuU<shENMEU9~.}WÃuEP1v]MfCfK MfC fC}{CE1vS E)w;u} {v F;u|;[uD1}~<{ME쐉!fK fKU)UF}ՋE +Mu 1v}K{u9t1u Ft1fK u}A)K =tCPhCPe Ce[^_UVSu=tc v9s1$w V VsÃ=tt VjS ؍e[^U WVS}=t + wh v;vh v;u[thF;t=9u 9E ;v{@Ht h`n%J MƃM#t h{2p=u-9u s(9E wuxh1KvE P4Ãt1} t"t;u sV M QWS W ؍e[^_UWVS}<=uh!=M +  wh; vh EuhvthnEthFQkƒ|u1A1<t =tVhUR =tjVMQ3}=uj|UPx p=u@v}M9K s;tE9C s;u9{vSPCPjU9S u<S KK;tw;PugE@ C EHKUtSXE9{u sMK4;uXh;C;vuC ; ujj 9 uUS‰S CRC s +5F9wA; v}@UR/}K CHEth`MSM#th{=tCPhEP DfC S f{ u2:t%8tʃ:t 9t @;CrOC f;CuE9t9uC +s9t SVe[^_ÐU VSu=thS=t/h =t 1=u=t u1VÃ=tEu]j EP  =t =tu h<؍e[^ÍvUS]=thR-=th5SS=t]EEj EP =t ]ÉUWVS]} E=thQ9=t0h =t 1vt=u h1ۃ=uO=tuSM1,u W' WSƃЉU=t]}uj EP  =t =t}t hJe[^_UWVSEE}tu=@uj+@UX]vC;t;=u+]]=@/v]utNt9t CA8tuA<=tu1[^_ÍvU WVS}tw=@ul+@E X]vC;t;=u+]]=@/v]utNt9t CA8tuA<=tu1[^_ÍvU$S=.t.Ѓ]S jS jSjPjhUP^T jj;jSjP j9UP/Tj$FreeBSD: src/lib/libc/i386/string/memset.S,v 1.5 1999/08/27 23:59:32 peter Exp $WS|$ D$L$W~$ĉ Љڃ)ӉكX[_$NetBSD: bcopy.S,v 1.6 1996/11/12 00:50:06 jtc Exp $vVW|$ t$L$)9rL$D$ _^ONL$D$ _^Ð$FreeBSD: src/lib/libc/i386/sys/brk.S,v 1.7 1999/08/27 23:59:38 peter Exp $D$9v D$̀rD$ )UEU RPjuuuu ujh*US]uu CP| șCPSTfc ȋ]ÍvUS]C tjjjCPfc uu CPD]ÍvUS]uE URPCPiuu fc vK CPST]ÐUE@PU WVSEt1v_wNxvf{ tSU EXNy?uҋEe[^_ÍvUu ht,@uPÐU[u Ou1[^_UWVS] UB;] wME ;EwBUBuUBUB%9t1vOhRSE PURǸ |ÍC;E wS轺ƃS诺 URURPVP8 cO[^_ÉUlWVSEU,u} c,u !.t(hh蘀hu uq Dž,u } ~ DžDžDžDž<1#}}!b0hhPvDž Dž;,| 􋕨R8t 3xu Džx%s =Lto11ۍvPURMQE PEPPLЃ w$0􋕤R C)~􋍤QK t,tKj"jjhh P uh @Phh~3,Dž=<|A=Dt*At@9H=<|S @HjjP?<}7``0hhP v`R5<:?}7f`S`0hhPrDPE PvEEEEE EjEP5<:‹E  9t7__0hhP(vufDžPV5<-Ã~)ffuɅ]T_D_0h hP 6Dž^ MQ蔵U9~4,thh|DžMf ff wA,tPh.h{Dž(vu vf)ft PV5<Ãͅ!^^0hAot^J+Mfft?fwSP5<OÃ~ f)uf;-,u !. hJhzh;E~EPEPY =<|=Du@9Htv=DtN@HjjP;<}6\\0hghP@,=,t=@uWQ5<:}+$\0hrhPC@ju u5<[;E [0h~hP9=@tIƅDžfDžjP5<B:@k[Qju u5< ;E t+,[0hhPK,~ =, DžBR)ЍjP 9Bz?B~B=<}jh<fDžfDžDžDžDžPjPjPRtà Y8jP78;u;|z;}j)B)ȉB}B@Bv)ЍY0hu0,thh1vDžvXDžPPjEPUR5<]9 (X0hhP[2Dž =,th.hxuDž(f;t$,u !. h,u[P8uE,u !. Ohhth;E~EPURm,usEEPMQE EPuyuR,u !. hhnth;E~EPEP: Bt tuY,t5hh th;E~EPMQ = .S, u>Bt2,thhsDž,u .%!=!uhh\s,u !. t5h-h5sh;E~EPMQ t,tu ,u=PtJ11ۃPEPURu uPЃ $DC)t􋅤P;,; ,Pc􋅤Pu(uT=T<vT[^_ÍvU=<|65<<@DHÐU WVS}u h`Vqu,#GtSPhpVMq uNx   Vj 5e[^_ÐU, WVS]E# .= .tEx #= 1PVE PEP30tpwS8tgS0耹Pht8+!. Kx  Sj ]u1t(!.tWE PRPhSp } uMPRPPPtPhSo0jhPjjPEPy }"OR0hPhS|o&SPSj Y F|[^_ÐUhuUu huÐULWVSu,u|EPu u#-}$Q0覷PhVn@]# E#H LU}MމMMMMMă= .t !.ut R44hV@n = .t !.t)NyF;F|;Vj;= .t !.IhVmE# thVmE# thVmE# th!VimE#  $th%VBmE#( ,th)VmE#0 4th-VlE#8 <th1VlE#@ Dth5Vl= .t !.t{WSjPh9VvlEPSjPhBVXl MQSjrPhBV7lEPSjTPhBVl = .t !. t"Nx Vj Vjj]SVj jS Vj@jSVhjS u1}u+}u%}uNx  Vj e[^_ÐU WVS}E ]hRWURP菢ƃ }1Iu+KyC;C|.!Sj. vSPl>[^_ÉUuhu uSÐU WVS]EPSEPEPu ƅ|&߰ЍPt|.tB;E|1fEe[^_UVShVhu ujà tuV蕞1[^U WVS]} u{t)sWBu t {uׅte[^_ÍvUSEU ]xt;ut@, xuRhB h`t`]USEU ]xt;ut@, xuRhB httt]Ujuht0ÉU} ujuPÉUjuhLÉUE= wbw+wB2 wv@=w/=w=== w=v=@=@E J P _ ye qt iz a Y Q I A 9 1 ) ! Ph hÉUS]j(hS/}Sh h`]ÉUVS]fо f1fʃf1f<`Q)QRh he[^UWVSu11ۋ=w%1tTPAѐ9.u]A=w%1t8A=w%1t\A1;dr`G;\s14` ~ Љ%[^_UWVS1EEEEv=w%1t|PCѐvR̿v4%@tCύv=w%1=w%1tETPЉUCˍvvR8v4%@tCύv=w%1J=w%1tETPЉUCˍv;.C=w%1t~EC=w%1tFUBEC=w%1tUTЉUCvRv4%@tщvRȽv4%@tCύv2wt$ )U4)U4)U4<+u)U)‹E)Ѝ)v12w"$vU E  U CvRڼ 4%@tӉvR謼v4%@tCύvEe[^_ÐU,WVSE1EEEEEEEEǰH}ǃEPEPÃEPEPƒ EEu+}u}u ]Uv}u}u]U1E8-u EEE8+uEvE=w%1tUtBōvE8.uyEE=w%1tOEEEE=w%1tEUTЉUEU]؁ÀvEvR轺 4%@u 9}sEȋEvR腺 4%@t9}5E9}'EP#EEvR- 4%@u 9}sEȋEvR 4%@t9}E9}EPEEvR蝹 4%@u 9}sEȋEvRe 4%@t 9}sE9}sEP EE UPUPUPEU BEBEBEBEBEB EB EB B B BZe[^_ÍvUP= EH"A$}$6u4u0u jE4PE0PU,RE PE PUR` vE4PE0PPu ]ƃu E4PE0PjhGE4PE0PRlE4PE0PE,PE PU REP E4PE0Pjh{E4PE0PU,RE PE PUR PE4PE0Pjh1DžU )ЃR ÃE E4PE0PjhP Sh]SƃE4PE0PVS E4PE0PPjVJ  E4PE0Pj hm Džu WÃE E4PE0Pjh0 u4u0Sƃ E4PE0PV*E4PE0PRjV  E4PE0Pj h * Džu 覎ÃE E4PE0Pjh u4u0S3ƃc E4PE0PVyE4PE0PPjV * E4PE0Pjhy Džu ÃE E4PE0Pjh< u4u0Sƃ E4PE0PVE4PE0PRjV7 y E4PE0Pj h Z Džu DÃE E4PE0Pjh u4u0Sƃ E4PE0PVE4PE0Pjh*< E4PE0PPjVg  E4PE0Pj h- }$b u gE Ph8]Sƃ E4PE0PVSK E4PE0PU,RE PE PUR^ }$ u E Ph8]Sƃ E4PE0PVSI E4PE0PE,PE PU REP  E4PE0Pjh E4PE0PU,RE PE PUR d vE4PE0PPu ƃD  u 9U  }4]0vWSPu [ ƃ u 9U  WSjh<9E r Su U$RE4PE0P߰HPSwv}$N u4u0u j膲E4PE0P}0HPk  Su E4PE0P߰HPSv}$u ׉ÃE u ƉE  PSh<hSƃE4PE0PVS E4PE0PRu ƃSu E4PE0Pjh ZE4PE0PPu ƃ6u E4PE0Pjh| E4PE0PRu F ƃu E4PE0Pjh0 E4PE0PE,PE PU REP }$ju oƃE u ^ÃE  u JE PSVhC4Sgƃ0E4PE0PVS )E4PE0PU,RE PE PUR< vE4PE0PE,PE PU REP E4PE0Pjh% E4PE0PU,RE PE PUR }$^u4u0u j薯E4PE0P}0HP{ E  E PhM]STƃE4PE0PVS E DžDž9U E4}0UE E v}|u+PWjhT Dž RhZP虺ƃRWVP Ui9E NE4PE0Pjh^}$u E E E E E PRQh`]Sƃ0E4PE0PVS hP+E Pu r ƃ]~,E4PE0PjhmbDžp Dž19U4E0RPHPR`PR)؃0~0P+P*09|v}$zu ƃE E E E 8E u tE  PSVPht]Smƃ E4PE0PVS/EP9u E P Ph]S ƃ0E4PE0PVS=u ÃE PPh]Sķƃ0E4PE0PVSu bE Ph8]S脷ƃ E4PE0PVSFE4PE0PU,RE PE PURY hP+E Pu ƃ~.E4PE0PjhmBDžp vDž19E4U0PRHPR|^PR)؃0~0P+P|,09|E4PE0Pjh*kE4PE0PE,PE PU REP |΋+U 1ۉ9}؅}CE ؅}C$)t9SPhW腵ƃ E4PE0PVWGC9| Ph]S1ƃE4PE0PVSa9E DžU4E0U]hS˴Ë+} ~19}!E PhS薴ÃF9|PR+PP?YRPjh^RPRj0+@P ]hS19}[CE u7vRv4%t E .F9|PR+PP<} 9U mE0+[^_U WVS]} ހ;tAtWSfu )9v&H#C;t;\u C;t퐀;.uC;u)e[^_ÐUWVS]}]EEUEPWjhL;] s\3D3;E wPFPhN tURWjhR|E Es!F@tFLrF kF lF@FXkFujj3+ƒtcB ub J jjR3,t$t! ujSЃtCSHt V}t|P詤1h[^_ÉUSEX{tjs3,C!u v]ÍvU WVSEX{tjs3+CEHwq$U 0t]svC(ts$Fd]C(ts$NuP! ujSЃvt;vB\N)Ãr2PGfFEf+Xp0PGfFf>E)fLFf\Fe[^_ÍvUWVSE pUEf|FwU REPv}t UDVUB NjUf+|VEH9trLFˋE XډUUDV)PSEPU5f|VuVfDVfDVVfDVDVfDV;U~DFUfVfDVfDVfEH8U J1e[^_U}EPPEPURM QEPgUbMaIEH UJ HM؉ˋBEfEEf|svsE؉EUމUs)‰ЉEPuMQ;E u\f+EtHf|sDsU)‰PDsEPEP4fsf+DsMfKf|K|sE6DsE؉E sDsU)JREPEPfETsfUރ9Mf) E)fLCf|CE`Ub1e[^_ÍvU\WVSEE܋XURU؉]EMfM;Of;;CfHfw{EPu VEp PURMQuV CEE5URUԋMMuvu؋EE܅kU܋ZMMf|C CEf)Uu)ftSUfTCjuVQEPE܃U܋ZMI fME}tuVEP U܉UЋMI fMοf;;f{uuȍEEĐS؉EMS)uȉNDS؉E SDS)uĉNTSfU΃EpuURK;E u{Mfyv)FuFTQ9wEPVQ6vURMQEuvuԃEPURVLMIuf~v6EEMAUBETF9UwQMQV E@<\tPU\@jؙ]K t1RPEPPut/URV]Stt;Et2Of}u)f9u#fEP fV]C fFExt~}t:X 19}lMvEAADADEDB9|>fEEEA9uQfEFQEDQB9~1e[^_UWVSu }E@ EUuR[G]]Extj}t:X 19}XMvEAADADEDB9|*19MVfEAVEDVB9~}t$UZG~j1hj莇aEx ED  UB H9EuhE}MQj PEPEDC~[GrUz ЃD  12EE}E}$M)M U4ÉyC؅}C$)M UB ƍ\;Z$|KJ$19}E;XD~ DF9};tU+\@ %1e[^_ÉU WVSuU B f ft‰T@JQ;V$}V$NF H!Í8uQVƒ؅}C؅}C$)!U RVbe[^_ÉU0VSu]SeEPSjB ht"h?jj jEPj1ue[^ÍvUWVS]fELSfMD{fEM AtS)ft{q1PEf+pf4{p0PMf EfD{fD{MAM fAM)fLSftCe[^_ÐU WVS]E ;}ms x8M tMjjjU PP847S u78M 4ty1e[^_ÉU,WVSEU z}M@EEEURU"%U9~fUDG)fESMQEEPh)]]7FEfwFf7uM)fLWUfTGfwM QEPBE [7}uzf|wtkTwE9~fEDGf+EfEfw]SUREEP])]fDwMf)LGUfTG vfDwM y}IDGf}ȋU9~fU%;EuUE;PufMDGf+EfE]SMQEEP)]]7FEfwFf7uM)fLWUfTG}t5fwM QEPE u 3U z}fwM IDGf}1e[^_ÍvUWVS}] ]1KEJDAfEKjSEPWÃt VWޅtjK}tfyt'AffwEfyuf|AtELAfMUJ~!EfAfACBviUBEEfUUUW +UfTAW JfTAEHt SW9t VWO81e[^_UWVSE PUMM]]ur}_ )É;Evf|runu}w4}uvE)EjE PUMDQP]S9E tOPUEBu^ );Mfzt;Mu}]{4}t Ee[^_ÐUVS]u jQDPPSt)Afxuۃtfuǃ $jU RDFPS  @f8uL$ǃ :jE PDFPSƒtUEPEEPRSǃ~:EU 9B u#EPFBPEPe[^_UVSu]uuju V"Ct1e[^UWVS}E pFW )‰UE @ fE]FffwTtpSoUREPjU RW t:sjE PDFPW3tWURURSPWAà ~;EU 9B u$EPFBPEPf{e[^_UWVS]jEPEPuEP u`uuUR誩;EЉUEPEPU fB ft,juB PEPIU BuE @E }tEHXX|CLC3F֋EfSFfCf3f|CfLCEU E BEXHf;vGsLC|CffLCf|CuUR$u/}t } tFs$!jU RVjSe[^_U,WVS}UM9AvFEPQRUUMAEE]CBEMEU E;w tu vPM Q]Su .ptItEU E;s7PSMQǃujS]3_FExCS)ЍW9s2PWURMQjS]SvCf9s)RDCPPfC΍SC)fCfJC؋MQU@q1PQM jS1|1e[^_ÉUS=tvЃ;u[ÐUfixit_crunch%s: %s not compiled in usage: %s ..., where is one of: %sgrepexviewvitelnetftpmount_cd9660mount_msdosumountswaponrrestorerestorerebootmountmknodfdiskdmesgdisklabelclrichgrpchownsyncsleeprmdirrmmvmkdirlslnkillexprechodfddcpchrootchmodcat@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/cat/cat.c,v 1.14.2.7 2002/04/24 13:36:45 asmodai Exp $benstuvusage: cat [-benstuv] [-] [file ...] stdoutdddddddddddddd ,DX-stdin%sr%6d buffercat@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/chmod/chmod.c,v 1.16.2.3 2001/08/01 01:21:09 obrien Exp $HLPRXfgorstuvwxthe -R and -h options may not be specified together.invalid file mode: %s%s: %s%s%s fts_read(((((((((((((((Ȍ(Ԍ((((((((((((((((((((((((((|}}usage: chmod [-fv] [-R [-H | -L | -P]] mode file ... @(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/usr.sbin/chroot/chroot.c,v 1.4.2.1 2002/03/15 22:54:59 mikeh Exp $.%sSHELL/bin/sh-iusage: chroot newroot [command] @(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/cp/cp.c,v 1.24.2.5 2002/01/01 06:32:04 mckay Exp $HLPRfiprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%sD`|ԑ%s: %s%s: directory causes a cycle..%s%s: name too long (not copied)chmod: %s%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).%s -> %s fts_read$FreeBSD: src/bin/cp/utils.c,v 1.27.2.5 2001/12/15 14:07:05 mckay Exp $%s(y/n [n]) overwrite %s? %snot overwritten readlink: %sunlink: %ssymlink: %smkfifo: %smknod: %sutimes: %schown: %schmod: %schflags: %s cp [-R [-H | -L | -P]] [-f | -i] [-pv] src1 ... srcN directoryusage: cp [-R [-H | -L | -P]] [-f | -i] [-pv] src target%s %s $FreeBSD: src/bin/dd/args.c,v 1.25.2.2 2001/01/23 14:20:03 asmodai Exp $\@@`pȦ ئ@@ئ@@|skipseekoseekofobsiseekifibsfilescountconvcbsbsunable to allocate space for the argument "%s"unknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsseek offsets cannot be larger than %qdbs must be between 1 and %dcbs must be between 1 and %dcount cannot be negativefiles must be between 1 and %qdibs must be between 1 and %dobs must be between 1 and %dJ D= 9 3+#     unblockucasesyncswabsparseosyncoldibmoldebcdicoldasciinotruncnoerrorlcaseibmebcdicblockascii,unknown conversion %s%s: illegal conversion combination%s%s: illegal numeric value%s: %sPƨƨƨƨƨƨƨ`ƨpƨƨƨƨƨƨƨƨƨ%s: illegal offset$FreeBSD: src/bin/dd/conv.c,v 1.15 1999/09/13 21:47:10 green Exp $%s: short input record$FreeBSD: src/bin/dd/conv_tab.c,v 1.10 1999/09/12 16:51:53 green Exp $    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/dd/dd.c,v 1.27.2.3 2001/08/01 01:37:35 obrien Exp $stdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffertruncating %sư>%s: seek error creating sparse file%s: end of device%s: short write on tape device%s: short write on character device$FreeBSD: src/bin/dd/misc.c,v 1.18.2.1 2001/08/01 01:40:03 obrien Exp $%qu+%qu records in %qu+%qu records out blockblocks%qu odd length swab %s %qu truncated %s %qu bytes transferred in %.6f secs (%.0f bytes/sec) ư>?@$FreeBSD: src/bin/dd/position.c,v 1.17.2.2 2001/01/23 14:23:55 asmodai Exp $%siseek/skip%s: illegal offsetskip reached end of inputoseek/seek%s: write failure@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/df/df.c,v 1.23.2.8 2002/04/05 00:25:14 iedowse Exp $ufsabgHhiklmnPt:BLOCKSIZE=512BLOCKSIZE=1gBLOCKSIZE=1k-l and -t are mutually exclusive.BLOCKSIZE=1monly one -t option may be specified%s/tmp/df.XXXXXXstrdup failedmkdtemp("%s") failed$@\lx?@ 0BBKMGTPE %5.0f%c %5.1f%c$@ SizeAvailUsedFilesystem%-*s %-*s %*s %*s Capacityifreeiused %*s %*s %%iused Mounted on %-*s %*ld %*ld %*ld %5.0f%% %*ld %*ld %4.0f%% %s Y@ df: %lld: %s usage: df [-b | -H | -h | -k | -m | -P] [-ailn] [-t type] [file | filesystem ...] sysctl failedmalloc failed$FreeBSD: src/sbin/mount/vfslist.c,v 1.4 1999/08/28 00:13:27 peter Exp $malloc failed@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/echo/echo.c,v 1.8.2.1 2001/08/01 02:33:32 obrien Exp $-n%s$FreeBSD: src/usr.bin/yacc/skeleton.c,v 1.28.2.1 2001/07/19 05:46:39 peter Exp $B[aim3O (                      !"   (:%&)*+%-/*+-/:<=>:%&)*+-)/%&)*+-/<=>%&*)<=>/%&)*+-:/&|)+-<=>&)<=>&)+-|<=>&|)&|)<=>&)&)<=>|<=>|<=><=>|&)%&|*+-/|<=>:<=>||%&|*+|-/:<=>%*+-/||:<=> malloc() failedoverflow%lld|&=<>+-*/%:()%lld %s syntax errornon-numeric argumentdivision by zero%syacc stack overflow$4H`x,@Th@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/kill/kill.c,v 1.11.2.1 2001/08/01 02:42:56 obrien Exp $-lillegal signal number: %s%s -soption requires an argument -- s0illegal process id: %s%ssigunknown signal %s; valid signals: kill -signal_number pid ... kill -signal_name pid ... kill -l [exit_status]usage: kill [-s signal_name] pid ...%s %s %s %s @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/ln/ln.c,v 1.15.2.3 2001/08/01 04:38:44 obrien Exp $linkfhinsv.%sLdpd%s/%sreplace %s? not replaced %s %c> %s link file1 file2 ln [-fhinsv] file ... directoryusage: ln [-fhinsv] file1 file2%s %s %s $FreeBSD: src/bin/ls/cmp.c,v 1.9.2.1 2002/03/28 01:28:14 joe Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/ls/ls.c,v 1.32.2.5 2002/03/28 01:28:14 joe Exp $COLUMNS1ABCFGHLPRTWabcdfghiklnoqrstuwCLICOLORCLICOLOR_FORCEColor support not compiled in. 8PHlxH`l$0<T%s: directory causes a cycle%s: %s %s: %s: fts_readLS_COLWIDTHS0:0 %lu : %lu : %lu : %i : %i : %i : %llu : %lu %u-%lu%quDNXbipw$FreeBSD: src/bin/ls/print.c,v 1.19.2.5 2002/03/28 01:28:14 joe Exp $%stotal %lu %*lu %*lld %s %*u %-*s %-*s %-*s %3d, 0x%08x %3d, %3d %*s%*lld %e %b %T %Y %b %e %T %Y %e %b %R %b %e %R %e %b %Y %b %e %Y %s/%s ls: %s: %s -> 0B%*s BKMGTPE%*lld%c ?@$FreeBSD: src/bin/ls/util.c,v 1.20.2.4 2002/03/28 01:28:14 joe Exp $h4,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,dusage: ls [-ABCFHLPRTWabcdfghiklnoqrstu1] [file ...] @(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/mkdir/mkdir.c,v 1.19.2.2 2001/08/01 04:42:37 obrien Exp $m:pvinvalid file mode: %s%s%s usage: mkdir [-pv] [-m mode] directory ... @(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/mv/mv.c,v 1.24.2.3 2001/08/01 04:44:36 obrien Exp $fiv%s: destination pathname too long%s(y/n [n]) overwrite %s? %s override %s%s%s/%s for %s? %snot overwritten %s -> %s cannot resolve %s: %scannot rename a mount pointrename %s to %smalloc failed%s: remove%s: set owner/group (was: %lu/%lu)%s: owner/group changed; clearing suid/sgid (mode was 0%03o)%s: set mode (was: 0%03o)%s: set flags (was: 0%07o)%s: set times-PRpv-PRpmv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rm mv [-f | -i] [-v] source ... directoryusage: mv [-f | -i] [-v] source target%s %s @(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/rm/rm.c,v 1.29.2.4 2001/08/01 05:15:56 obrien Exp $unlinkdfiPRrvW!!!!!!!!!!!!!!!!!!!!|!!!!!!!!!!!!!!!!!!!%s: %s%s %sfts_read#$$@#$$#$$8#%s: is a directorymallocremove %s? override %s%s%s/%s %s%sfor %s? "." and ".." may not be removed unlink fileusage: rm [-f | -i] [-dPRrvW] file ...%s %s @(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/rmdir/rmdir.c,v 1.9.2.2 2001/08/01 05:16:47 obrien Exp $p%susage: rmdir [-p] directory ... @(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/sleep/sleep.c,v 1.9.2.1 2001/08/01 05:23:25 obrien Exp $usage: sleep seconds @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/bin/sync/sync.c,v 1.9.2.2 2001/08/01 05:43:30 obrien Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/usr.sbin/chown/chown.c,v 1.15.2.1 2000/08/07 02:03:09 ps Exp $HLPRfhvthe -R and -h options may not be specified together%s: %s%s fts_read 2 2 2 2 2 2 2 2 21 2 2 21 2 2 21 21 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 21 21 2 2 2 2 2 2 2 2 2 2 2 2 228333X3333333333groupuser%s%s: illegal %s nameyou are not a member of group %s chgrp [-R [-H | -L | -P]] [-f] [-h] [-v] group file ... chown [-R [-H | -L | -P]] [-f] [-h] [-v] :group file ...usage: chown [-R [-H | -L | -P]] [-f] [-h] [-v] owner[:group] file ...%s %s %s @(#) Copyright (c) 1990, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/clri/clri.c,v 1.4 1999/08/28 00:12:32 peter Exp $usage: clri filesystem inode ... %s%s: can't read superblock%s: superblock magic number 0x%x, not 0x%x%s is not a valid inode numberclearing %d @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/disklabel/disklabel.c,v 1.28.2.9 2001/08/01 06:07:14 obrien Exp $DOC2KVinumCCDfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownvinumbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunusedBNRWb:enrs:w/dev/%s%s%c%s%s%sioctl DIOCWLABELr;;;8:;;;;;;;;;;;d:;;;:;;;;:;;;;;;;;;;D:;;:;;;;;;;;:;;;:T:;;;:?<=D==l>>?auto%s: unknown disk type/boot%s/%swrite to disk label supressed - label was as follows:ioctl DIOCSDINFOwriteioctl DIOCWDINFO%s: no disk label on disk;add "-r" to install initial label %s: label magic number or checksum is wrong!(disklabel or kernel is out of date?) %s: open partition would move or shrink%s: '%c' partition must start at beginning of diskbad pack magic number (label is damaged, or pack is unlabeled)ioctl DIOCGDINFO%s/boot1%s/boot2%s too largebootstrap doesn't leave room for disk label# %s: type: %s type: %u disk: %.*s label: %.*s flags: removeable ecc badsect bytes/sector: %lu sectors/track: %lu tracks/cylinder: %lu sectors/cylinder: %lu cylinders: %lu sectors/unit: %lu rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %lu # milliseconds track-to-track seek: %ld # milliseconds drivedata: %lu %u partitions: # size offset fstype [fsize bsize bps/cpg] %c: %8lu %8lu %8.8s%8d %5lu %5lu %5.5s %5lu %5lu %5u %5lu %5lu %5d%20.20s # (Cyl. %4lu- %lu) wcan't create %scan't reopen %s for readingre-edit the label? [y]: you have too many processesforkEDITOR/usr/bin/viline %d: syntax error typeWarning, unknown disk typeline %d:%s %d flagsremoveableeccbadsectline %d: %s: bad flag drivedata%d partitionsline %d: bad # of partitions disklabelbytes/sectorline %d: %s: bad sector size sectors/trackline %d: %s: bad %s sectors/cylindertracks/cylindercylinderssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: partition name out of range a-%c: %s line %d: too few numeric fields line %d: %s: bad partition size line %d: %s: bad partition offset line %d: Warning, unknown filesystem type %s line %d: %s: Unknown disklabel field sector size 0 sectors/track 0 tracks/cylinder 0 cylinders/unit 0 revolutions/minute 0boot block size 0 boot block size %% sector-size != 0super block size 0 super block size %% sector-size != 0number of partitions (%lu) > MAXPARTITIONS (%d)Too many '*' partitions (%c and %c)unknown size specifier '%c' (K/M/G are valid)partition %c not an integer number of sectorstotal percentage %d is greater than 100 %ld sectors available to give to '*' and '%' partitions Offset %ld for partition %c overlaps previous partition which ends at %ld Labels with any *'s for offset must be in ascending order by sector Offset %ld for partition %c doesn't match expected value %ldpartition %c: size 0, but offset %lupartition %c: offset past end of unit partition %c: partition extends past end of unit partition %c is not marked as unused!partition %c doesn't start at 0!partition %c doesn't cover the whole unit!An incorrect partition %c may cause problems for standard system utilitiespartitions %c and %c overlap! unused partition %c: size %d offset %luY@"auto" requires the usage of a canonical disk namecannot open %sboot overlaps used partition %c marked as FS_BOOTboot overlaps partition %c, %scannot install boot programWarning, (to write disable/enable label) disklabel [-NW] disk (to restore label and boot program) disklabel -R -B [-n] [ -b boot1 [ -s boot2 ] ] disk protofile [ type ] (to write label and boot program) disklabel -w -B [-n] [ -b boot1 [ -s boot2 ] ] disk type [ packid ] (to install boot program with existing label) disklabel -B [-n] [ -b boot1 [ -s boot2 ] ] disk [ type ] (to restore label with existing boot program) disklabel -R [-r] [-n] disk protofile (to edit label) disklabel -e [-r] [-n] disk (to write label with existing boot program) disklabel -w [-r] [-n] disk type [ packid ] (to read label)usage: disklabel [-r] disk%s %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s @(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/dmesg/dmesg.c,v 1.11.2.3 2001/08/08 22:32:15 obrien Exp $_msgbufpaM:N:kern.msgbufsysctl kern.msgbufmalloc faileddmesgkvm_nlist: %snamelist%s: msgbufp not foundkvm_read: %skernel message buffer has different magic number%susage: dmesg [-a] [-M core] [-N system] $FreeBSD: src/sbin/i386/fdisk/fdisk.c,v 1.36.2.11 2002/04/25 21:02:21 trhodes Exp $/dev/da0/dev/ad0BBT (Bad Blocks Table)DOS 3.3+ SecondaryConcurrent CPM or C.DOS or CTOSBSDI BSD/386 swapBSDI BSD/386 filesystemNetBSDNEXTSTEPOpenBSDFreeBSD/NetBSD/386BSDSuspend to DiskBSD/OSAmoeba bad block tableAmoeba filesystemLinux filesystemLinux swap or Solaris x86Minix 1.4b ... 1.5.10Minix 1.1 ... 1.4aPCIXNovell Netware 3.xxNovell Netware 2.xxISC UNIX, other System V/386, GNU HURD or MachSpeedGBCP/M or Microport SysV/ATDMQNX 4.2 TertiaryQNX 4.2 SecondaryQNX 4.2 PrimaryVENIX 286plan9OPUSExtended DOS, LBAPrimary 'big' DOS (> 32MB, LBA)DOS or Windows 95 with 32 bit FAT, LBADOS or Windows 95 with 32 bit FATOS/2 Boot Manager or OPUSAIX boot partition or CoherentAIX filesystemOS/2 HPFS, NTFS, QNX-2 (16 bit) or Advanced UNIXPrimary 'big' DOS (> 32MB)Extended DOSPrimary DOS with 16 bit FAT (<= 32MB)XENIX /usr filesystemXENIX / filesystemPrimary DOS with 12 bit FATunusedBIab:f:istuv1234/dev/dev/%scannot open disk %scannot open any diskcannot allocate buffer to determine disk sector sizeread_s0%s: %d cyl %d hd %d sec SizeStartPart %11s %11s Type Flags %4d: %11lu %11lu 0x%02x 0x%02x ******* Working on device %s ******* Media sector size is %d Warning: BIOS sector numbering starts with sector 1 Information from DOS bootblock is: We haven't changed the partition table yet. This is your last chance. Should we write new partition table? -t flag specified -- partition table not written. hkhkhkhktktktktktktktktktktktktktkjtktktktktktkjtktktktktktktktktktktktktktktktktktktktktktktkkktktktk ktktk,ktktktktktktktktktk8kDkPk\k fdisk -f configfile [-itv] [disk] usage: fdisk [-BIaistu] [-b bootcode] [-1234] [disk] %s%s%d: sysid %d,(%s) (active) start %lu, size %lu (%qd Meg), flag %x%s beg: cyl %d/ head %d/ sector %d; end: cyl %d/ head %d/ sector %d /boot/mbr%s%s: length must be a multiple of sector size%s: unable to allocate read buffer%s: short readThe data for partition %d is: Do you want to change it? The static data for the DOS partition 4 has been reinitialized to: sysid (165=FreeBSD)startsizeERROR: failed to adjust; setting sysid to 0Explicitly specify beg/end address ?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorAre we happy with this entry?parameters extracted from in-core disklabel are: cylinders=%d heads=%d sectors/track=%d (%d blks/cyl) Figures below won't work with BIOS for partitions not in cyl 1 parameters to be used for BIOS calculations are: Partition %d is marked active Do you want to change the active partition?active partitionActive partition number must be in range 1-4. Try again. Are you happy with this choiceDo you want to change the boot code?Do you want to change our idea of what BIOS thinks ?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorscan't get file status of %sdevice %s is not character specialcan't open device %scan't get disk parameters on %scan't get disk parameters on %s; supplying dummy onesunable to allocate buffer to read fdisk partition tablecan't read fdisk partition tableinvalid fdisk partition table foundcan't write fdisk partition table%s [n] yesYESyYSupply a decimal value for "%s" [%d] %s is an invalid decimal number. Try again. unknownERROR line %d: the geometry specification line must occur before all partition specificationsERROR line %d: incorrect number of geometry argsERROR line %d: unknown geometry arg type: '%c' (0x%02x)ERROR line %d: number of cylinders not specifiedWARNING line %d: number of cylinders (%d) may be out-of-range (must be within 1-1024 for normal BIOS operation, unless the entire disk is dedicated to FreeBSD)ERROR line %d: number of heads not specifiedERROR line %d: number of heads must be within (1-256)ERROR line %d: number of sectors not specifiedERROR line %d: number of sectors must be within (1-63)ERROR line %d: incorrect number of partition argsERROR line %d: invalid partition number %dERROR line %d: unable to adjust start of partition %d to fall on a head boundaryWARNING: adjusting start offset of partition %d from %u to %u, to fall on a head boundaryERROR: could not adjust partition to start on a head boundary and end on a cylinder boundary.WARNING: adjusting size of partition %d from %u to %u to end on a cylinder boundaryERROR line %d: size of partition %d is zeroERROR line %d: incorrect number of active args-rERROR: size of partition is zeroWARNING: partition does not start on a head boundaryWARNING: partition does not end on a cylinder boundaryWARNING: this may confuse the BIOS or some operating systemsCorrect this automatically?ERROR: unable to adjust start of partition to fall on a head boundaryWARNING: adjusting start offset of partition to %uWARNING: adjusting size of partition to %u@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/mknod/mknod.c,v 1.13 2000/01/06 17:51:46 obrien Exp $usage: mknod name [b | c] major minor [owner:group] %s%s: illegal %s namegroup must be specified when the owner isgroupowner must be specified when the group isusernode must be type 'b' or 'c'%s: non-numeric major number%s: non-numeric minor numbermajor or minor number too largesetting ownership on %s@(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/mount/mount.c,v 1.39.2.3 2001/08/01 08:26:23 obrien Exp $soft-updatessuiddirnoclusterwnoclusterrunionsynchronousread-onlywith quotasnosymfollownosuidnoexecnodevnoatimelocalNFS exportedasynchronousext2fsffsufsadfo:prwt:uvroonly one -t option may be specifiednorogetmntinforwrqnoautonot currently mounted %s/%s: unknown special file or file system%s has unknown file system type:@nfsr/var/run/mountd.pid%dsignal mountd8888888888888888888888888888888888|888888888888Ћ8‹,/usr/sbin/sbinforceupdateexec: mount_%s %s fork%s/mount_%smalloc failed, exec mount_%s not found in %swaitpid%s: %sstatfs %s%s on %s (%s, %s, mounted by %s, writes: sync %ld async %ld, reads: sync %ld async %ld) %s,%s-ofstabcurrentno mount [-dfpruvw] special | node mount [-adfpruvw] [-t ufs | external_type]usage: mount [-dfpruvw] [-o options] [-t ufs | external_type] special node%s %s %s %s %s %s %s %u %u 1 1 2 2 0 0 syncasync@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/mount/mount_ufs.c,v 1.16.2.3 2001/08/01 08:27:29 obrien Exp $updatesyncforceasyncclusterwclusterrunionrdonlysymfollowsuidsuiddirexecdevatimeautorwrogroupquotauserquotao:ufsvfsload(ufs)ufs filesystem is not available%s on %s: mount table full%s on %s: specified device does not match mounted device%s on %s: incorrect super block%susage: mount_ufs [-o options] special node $FreeBSD: src/sbin/mount/getmntopts.c,v 1.9 1999/10/09 11:54:06 phk Exp $,-o %s: option not supported%s: not a directory%s: %s$FreeBSD: src/sbin/mount/vfslist.c,v 1.4 1999/08/28 00:13:27 peter Exp $malloc failed@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/reboot/reboot.c,v 1.9.2.4 2002/04/28 22:50:00 wes Exp $haltdk:lnpqcannot dump (-d) when halting; must reboot instead/boot/nextboot.confkernel="" ???halted by %srebootrebooted by %sshutdown~SIGTSTP initSIGTERM processesWARNING: some process(es) wouldn't die (can't restart init): %s%sأusage: %s [-dnpq] [-k kernel] vm.stats.vm.v_swappgsinv_swappgsin@(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/restore/main.c,v 1.10.2.3 2001/10/02 08:30:17 cjc Exp $./restoresymtableTAPE/dev/sa0b:cdf:himNRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0%c and %c options are mutually exclusiveillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specified.Begin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure ĨPPPPPPPPPPPPPPPPPPL\PlPxPPPPPPPԨ,8PDī2222222222222222222222822222222`2 222restore -t [-cdhkNuvy] [-b blocksize] [-f file] [-s fileno] [file ...]restore -x [-cdhkmNuvy] [-b blocksize] [-f file] [-s fileno] [file ...]restore -R [-cdkNuvy] [-b blocksize] [-f file] [-s fileno]restore -r [-cdkNuvy] [-b blocksize] [-f file] [-s fileno]restore -i [-cdhkmNuvy] [-b blocksize] [-f file] [-s fileno]usage: %s %s %s %s %s option requires an argument -- %c$FreeBSD: src/sbin/restore/interactive.c,v 1.8.2.1 2001/01/03 14:36:08 iedowse Exp $/addcd%s: not a directory delete%s: not on extraction list extracthelp directory is used If no `arg' is supplied, the current help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%slspwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help QLLLLԴLLLLLLLLLLLLLLLLLLLLLLLLLLLL L0LL LLLLLL LXLLܳrestore > %s/%s%s: out of memory command lines cannot be continued missing %c ../canonname: not enough buffer space ..ls: out of memory directory reopen failed %s: %s%s: name exceeds %d char Warning: undefined file type %d ````|``%*d %srestore interrupted, continue$FreeBSD: src/sbin/restore/restore.c,v 1.7.2.1 2002/03/01 21:32:28 iedowse Exp $leafdir %s%10d %s %s: not on the tape ./%uMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %d) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state 8(<<|NIL|ONTAPE|INOFND|NAMEFND|MODECHGFind unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %d: bad first %s: not found on tape expected next file %d, got %d unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %d type should be LEAF$FreeBSD: src/sbin/restore/dirs.c,v 1.14.2.5 2001/10/15 13:44:45 dd Exp $Extract directories from tape TMPDIR/tmp/%s/rstdir%d-XXXXXXw%s - cannot create directory temporary fopen%s/rstmode%d%s - cannot create modefile fopen/opendirfile: %s Root directory is not on tape .Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %d char lsMangled directory: reclen not multiple of 4 reclen less than DIRSIZ (%d < %d) reclen name too big (%d > %d) bad seek pointer to rst_seekdir %ld error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopen: %s cannot open mode file %s set owner/mode for '.'cannot find directory inode %d error setting directory modes Cannot find directory inode %d named %s %s: cannot create file: %s write error extracting inode %d, name %s read: %s write: %s no memory directory table $FreeBSD: src/sbin/restore/symtab.c,v 1.7.2.1 2001/12/19 14:54:14 tobez Exp $addino: out of range %d duplicate inumdeleteino: out of range %d deleteino: %d not found %s is not a directory %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTcannot find entry in parent listbad name no space for string table Check pointing the restore wfopen: %s cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table .open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table read: %s cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c $FreeBSD: src/sbin/restore/tape.c,v 1.16.2.7 2002/03/01 21:32:28 iedowse Exp $-r/dev/ttycannot open %s: %s /dev/nullCannot allocate space for magtape buffer Cannot allocate space for tape buffer Verify tape and initialize maps %s: %s Tape is not a dump tape Converting to new file system format. .cannot stat .: %s bad block size %ld Tape is not volume 1 of the dump header read failed at %ld blocks no header after volume mark! Cannot find file removal list maxino = %d no memory for active inode map Cannot find file dump list no memory for file dump list Changing volumes on pipe input? Otherwise, begin with volume 1. have no further files to extract. can quickly skip tapes that and work towards the first; restore start with the last volume If you are extracting just a few files,You have not read any tapes yet. %s%s%s%s%s%s%sYou have read volumes: %s%ld, Specify next volume #: Volume numbers are positive numerics Mount tape volume %ld Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) none Cannot open %s tape is not dump tape Wrong volume (%ld) Wrong dump date got: %s wanted: %slast rec %ld, tape starts with %ld sSkipping %ld duplicate record%s. active file into volume 1 End-of-input encountered while extractingWarning: %s %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Dump date: %sthe epoch Dumped from: %sLevel %ld dump of %s on %s:%s Label: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract fifo %s %s: cannot create fifo: %s extract special file %s %s: cannot create special file: %s %s: cannot create file: %s ran off end of tape not at beginning of a file Missing address (header) block for %s at %ld blocks write error extracting inode %d, name %s write: %s seek error extracting inode %d, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s hole in map mid-media short read error. partial block read: %ld should be %ld Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %d continuecontinuation failed: %s End-of-tape encountered partial block read: %d should be %d tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%d) Tape block size is %ld Note: Doing Byte swapping 8l4s31ll2lNote: Doing Quad swapping gethead: unknown inode type %d BB'oldnewVolume header (%s inode format) begins with record %ldDumped inodes map headerUsed inodes map headerFile header, ino %dFile continuation header, ino %dEnd of tape header; predicted %ld blocks, got %ld blocksH0Xh<unexpected tape header unknown tape header type %d resync restore, skipped %ld blocks TH<Checksum error %o, inode %d file %s $FreeBSD: src/sbin/restore/utilities.c,v 1.8.2.2 2001/07/30 10:30:08 dd Exp $mktempname: called with TMPNAMEnot on ino listRSTTMP%s%ld%luwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d symbolichardCreate %s link %s->%s warning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s NODELEAFentry type: %s inode number: %lu flags: %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump core$FreeBSD: src/sbin/dump/dumprmt.c,v 1.14.2.1 2000/07/01 06:31:52 ps Exp $Lost connection to remote host. on %s: %s%stcpkshellshell%s/tcp: unknown service who are you? RMT/etc/rmtlogin to %s as %s failed. Connection to %s established. IP_TOS:IPTOS_THROUGHPUT setsockoptTCP_NODELAY setsockoptinvalid user name %s O%.226s %d C closeR%d readW%d writeL%d %d seekS statusI%d %d ioctl%s: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). @(#) Copyright (c) 1980, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/swapon/swapon.c,v 1.8.2.2 2001/07/30 10:30:11 dd Exp $aswnoautoswapon: adding %s as swap device %s: device already in use%susage: swapon [-a] [special_file ...] @(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/umount/umount.c,v 1.22.2.1 2001/12/13 01:27:15 iedowse Exp $Aafh:t:vonly one -t option may be specifiednfscannot umount %s, %s is mounted there, umount it first/etc/fstab%s+,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,+,,,,+,+,,,,,,,,,,,+,,fstab reading failure/rwrorq%s: unknown mount typemalloc failedstrdup%s: not currently mountedcan't get net id for hostunmount of %s failed%s: unmount from %s Cannot MNT PRCBad MNT RPCcannot remove mounttab entry %s:%scallocT88x7099malloc umount -a | -A [-fv] [-h host] [-t type]usage: umount [-fv] special | node%s %s $FreeBSD: src/sbin/mount/vfslist.c,v 1.4 1999/08/28 00:13:27 peter Exp $malloc failed$FreeBSD: src/usr.sbin/rpc.umntall/mounttab.c,v 1.2.2.1 2001/12/13 01:27:20 iedowse Exp $a/var/db/mounttab%ld %s %s rcan't open %s timehostdirmallocwcan't write to %swrite mounttab entry %s:%scan't remove %s by hostdelete mounttab entry%s %s:%sbad mounttab %s field '%s'$FreeBSD: src/sbin/mount_msdos/mount_msdos.c,v 1.19.2.1 2000/07/20 10:35:13 kris Exp $nowin95longnamesshortnamesupdatesyncforceclusterwclusterrunionrdonlysymfollowsuidsuiddirexecdevatimeautorwrogroupquotauserquotasl9u:g:m:o:L:W:stat %smsdosvfsload(msdos)msdos filesystem is not available%sPD PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUIT%c%c%c421 Service not available, remote server has closed connection.%s: send aborted waiting for remote to finish abort.sentlocal: %s remote: %s -%slocal: %s%s: not a plain file. STORAPPEREST %qdr+w%s %snetout receive aborted waiting for remote to finish abort.receivedRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly.Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: EPSV return code must be 229PASVLPSVPassive mode refused.wrong server: return code must be 227%d,%d,%d,%d,%d,%dwrong server: return code must be 228%d,%d,%d,%d,%d,%d,%d,%d,%d%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dwrong server: return code must be 229%c%c%c%d%cPassive mode address scan failure. Shouldn't happen!setsockopt (reuse address)setsockopt PORTRANGE (ignored)listenEPRT |%d|%s|%d|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dacceptSTOUproxy server does not support third party transfers.No primary connection.PORT %slocal: %s remote: %s abortresetrunique: can't find unique file name.Lost control connection for abort.%cABOR ftphttpFTPSERVERPORT%sftpgateTMPDIR/tmp/FTP_PASSIVE_MODEnopftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumb46adeginpP:s:tUvV%s: %sxPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP,DPPPPPPPPPPPPPPPPPPPPP P8ftp> sorry, input line too long.?Ambiguous command.?Invalid command.Not connected.!$Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-46adeginptUvV] [-P port] [-s src_addr] [host [port]] %s host:path[/] %s ftp://host[:port]/path[/] %s http://host[:port]/file macdefmachineaccountpasswdpasswordlogindefaultHOME.%s/.netrc%s/.netrc: %sr%scan't strdup *anameanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.can't strdup *apassRemove account or make file unreadable by others.can't strdup *aacctMissing macdef name argument.Limit of 16 macros have already been defined.Macro definition missing null line terminator.4K macro buffer exceeded.Unknown .netrc keyword %sAlready connected to %s, use close first. tousage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s asciinon-printstreamfile8SYSTRemote system type is %s. 215 UNIX Type: L8binaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$initsorry, arguments too long.(%s) ftpXXXXXX%s/%sunable to create temporary file %swNLSTarcan't find list of remote files, oops.%s %s? Interactive mode: off.Prompting off for duration of %s. %s: not foundSIZE %sMDTM %s%*s %16s1919%03d%02d%02d%02d%02d%02d%04d%02d%02d%02d%02d%02dCan't convert %s to a time. KMGTP %3d%% **********************************************************************************************************************************************************|%.*s%*s| %5qd %c%c --:-- ETA - stalled -%2d: %02d:%02d ETA.AMKs%qd byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d .A>P?emacsContext sensitive argument completionftp-complete^I0isipv6addr: got %d for %s @(#)commands.c 8.4 (Berkeley) 5/30/95%s sequence challenge /usr/bin/opiekeyfork!^?offwontwilldontdohelpDisplay send options?Send request for STATUSgetstatusPerform Telnet 'Synch operation'synchSend Telnet End of File CharactereofSend Telnet 'Suspend Process'suspSend Telnet 'Abort Process'abortSend Telnet 'End of Record'eorSend Telnet 'No operation'nopintrinterruptintpSend Telnet Interrupt ProcessipSend Telnet 'Go Ahead' sequencegaSend current escape characterescapeSend Telnet Erase LineelSend Telnet Erase CharacterecbreakSend Telnet BreakbrkSend Telnet 'Are You There'aytSend Telnet Abort outputaoneed at least one argument for 'send' command 'send ?' for help Unknown send argument '%s' 'send ?' for help. Ambiguous send argument '%s' 'send ?' for help. sNeed %d argument%s to 'send %s' command. 'send %s ?' for help. ?Need to be connected first. There is not enough room in the buffer TO the network to process your request. Nothing will be done. ('send synch' will throw away most data in the network buffer, if this might help.) Telnet 'send' error - argument disappeared! SENTUsage: send %s "value" must be from 0 to 255 Valid options are: "%s" '%s': ambiguous argument ('send %s ?' for help). '%s': unknown argument ('send %s ?' for help). '%s': bad value ('send %s ?' for help). %-15s %s setsockopt (SO_DEBUG)Will send carriage returns as telnet . Will send carriage returns as telnet . Already operating in binary mode with remote host. Negotiating binary mode with remote host. Already in network ascii mode with remote host. Negotiating network ascii mode with remote host. Already receiving in binary mode. Negotiating binary mode on input. Already receiving in network ascii mode. Negotiating network ascii mode on input. Already transmitting in binary mode. Negotiating binary mode on output. Already transmitting in network ascii mode. Negotiating network ascii mode on output. print hexadecimal representation of terminal traffic(debugging) toggle printing of hexadecimal terminal datatermdatashow option processingviewing of options processing (debugging)optionsprint user readable output for "netdata"output of "netdata" to user readable format (debugging)prettydumpprint hexadecimal representation of network trafficprinting of hexadecimal network data (debugging)netdataturn on socket level debuggingdebuggingdebug recognize certain control characterslocal recognition of certain control characterslocalcharsmap carriage return on outputmapping of received carriage returnscrmodsending carriage returns as telnet crlfsending of binary dataoutbinaryreceiving of binary datainbinarysending and receiving of binary databinaryskip reading of ~/.telnetrc filedon't read ~/.telnetrc fileskiprcsend interrupt characters in urgent modeautomatic sending of interrupt characters in urgent modeautosynchflush output when sending interrupt charactersflushing of output when sending interrupt charactersautoflush%-15s toggle %s display help informationenabledisable%-15s %s %s Need an argument to 'toggle' command. 'toggle ?' for help. '%s': ambiguous argument ('toggle ?' for help). '%s': unknown argument ('toggle ?' for help). WillWon't%s %s. alternate AYT characterforw2alternate end of line characterforw1character to use for XOFFstopcharacter to use for XONstartcharacter to use to erase a wordworderasecharacter to use for line reprintreprintcharacter to cause a Suspend Processcharacter to use for literal nextlnextcharacter to use to erase a linekillcharacter to use to erase a charactereraseThe following are for local editing in linemodecharacter to cause an EOF character to cause an Abort processquitcharacter to cause an Interrupt Processcharacter to cause an Abort OutputflushoutputThe following need 'localchars' to be toggled truefile to write trace information totracefilerlogin escape characterrlogincharacter to escape back to telnet command modecharacter to toggle local echoing on/offechoTelnet rlogin escape character is '%s'. Telnet escape character is '%s'. Format is 'set Name Value' 'set ?' for help. '%s': unknown argument ('set ?' for help). '%s': ambiguous argument ('set ?' for help). onFormat is 'set togglename [on|off]' 'set ?' for help. %s set to "%s". %s character is '%s'. Need an argument to 'unset' command. 'unset ?' for help. '%s': unknown argument ('unset ?' for help). '%s': ambiguous argument ('unset ?' for help). %s reset to "%s". ?Need to have LINEMODE option enabled first. 'mode ?' for help. Print help informationkludgelineDisable literal character echo-litecho+litechoEnable literal character echolitecho-softtabs+softtabsEnable tab expansionsofttabsDisable character editing-edit+editEnable character editingeditDisable signal trapping-isig+isigEnable signal trappingisigThese require the LINEMODE option to be enabled(or enable obsolete line-by-line mode)Enable LINEMODE optionline(or disable obsolete line-by-line mode)Disable LINEMODE optioncharacterformat is: 'mode Mode', where 'Mode' is one of: 'mode' command requires an argument Unknown mode '%s' ('mode ?' for help). Ambiguous mode '%s' ('mode ?' for help). won't %s. %-15s [%s] %-15s "%s" ?Ambiguous argument '%s'. ?Unknown argument '%s'. Deprecated usage - please use 'set escape%s%s' in the future. new escape character: Deprecated usage - please use 'toggle crmod' in the future. %s map carriage return on output. Fork failed SHELL/bin/sh-cExeclConnection closed. fromquitbyeVerify remote special character definitionscheckUse remote special character definitionsimportUse local special character definitionsexportNeed an argument to 'slc' command. 'slc ?' for help. '%s': unknown argument ('slc ?' for help). '%s': ambiguous argument ('slc ?' for help). List the current environment variableslistSend an environment variablesendDon't mark an environment variable for automatic exportunexportMark an environment variable for automatic exportUndefine an environment variableundefineDefine an environment variabledefineNeed an argument to 'environ' command. 'environ ?' for help. '%s': unknown argument ('environ ?' for help). '%s': ambiguous argument ('environ ?' for help). only Need %s%d argument%s to 'environ %s' command. 'environ ?' for help. DISPLAYunix:%s%sUSERLOGNAMEPRINTERCannot send '%s': Telnet ENVIRON option not enabled Cannot send '%s': variable not defined %c %-20s %s Connected to %s. notmuchOperating with LINEMODE option LocalNo%s line editing %s catching of signals Operating in obsolete linemode Operating in single character mode Catching signals locally Remote%s character echo %s flow control No connection. Escape character is '%s'. status?Already connected to %s open (to) -l-a-susage: %s [-l user] [-a] [-s src_addr] host-name [port] %s: %s hostname too long for unix domain socket: %sTrying %s... sockettelnetBad source route option: %s telnet: socketsetsockopt (source route)telnet: setsockopt (IP_TOS) (ignored)bindconnect to address %sUnable to connect to remote hostConnection closed by foreign host. opieenvironzslctoggleunsetsetopenmodedisplaylogoutclose%s> %s ?Ambiguous command ?Invalid command Commands may be abbreviated. Commands are: %-*s %s ?Ambiguous help command %s ?Invalid help command %s HOME/.telnetrcrDEFAULT?Ambiguous command: %s ?Invalid command: %s ?Need to be connected first for %s. @(#)main.c 8.3 (Berkeley) 5/30/95[host-name [port]][-r] [-s src_addr] [-u] [-e char] [-l user] [-n tracefile] [-4] [-6] [-8] [-E] [-L] [-N] [-S tos] [-c] [-d]Usage: %s %s%s%s%s rlog468EKLNS:X:acde:fFk:l:n:rs:t:uxy%s: Warning: -S ignored, no parsetos() support. %s: Warning: -f ignored, no Kerberos V5 support. %s: Warning: -F ignored, no Kerberos V5 support. %s: Warning: -k ignored, no Kerberos V4 support. %s: Warning: -x ignored, no ENCRYPT support. %s: Warning: -y ignored, no ENCRYPT support. -l-s,_```<_````````````L__``````_`l_````|_`````````````_`____````_ `` ````4`@``L```X`h`@(#)network.c 8.2 (Berkeley) 12/15/93select@(#)ring.c 8.2 (Berkeley) 5/30/95@(#)sys_bsd.c 8.4 (Berkeley) 5/30/95hhLhhhhTh\hhdhlhhhhth|hhhSetSockOptmallocsleep(5) from telnet, after select: %s @(#)telnet.c 8.4 (Berkeley) 5/30/95SENTvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvDISPLAYxxxxxxDxxxxxxxxxxxxxxxxxxxxxxxxxxxx|xdxxxxxUNKNOWNTERM%c%c%c%c%s%c%cNo room in buffer for terminal type. %c%c%c%c%ld,%ld%c%clm_will: not enough room in buffer }%%%%%%%`~,0%%%Ālm_will: no command!!! lm_wont: no command!!! lm_do: no command!!! lm_do: not enough room in buffer lm_dont: no command!!! lm_mode: not enough room in buffer localremoteremote defaultSpecial characters are %s values slc_import: not enough room slc_end_reply: not enough room env_opt_start: malloc()/realloc() failed!!! env_opt_add: realloc() failed!!! USERPRINTERSYSTEMTYPEJOBACCTRCVDIn SUBOPTION processing, RCVDȔTؕ<̓ܓXz close Remote side does not support STATUS option @(#)terminal.c 8.2 (Berkeley) 2/16/95@(#)utilities.c 8.3 (Berkeley) 5/30/95IACDONTDOWONTWILLSBGAELECAYTAOIPBRKDMARKNOPSEEORABORTSUSPEOFNEW-ENVIRONENCRYPTAUTHENTICATIONOLD-ENVIRONXDISPLOCLINEMODELFLOWTSPEEDNAWSX.3 PAD3270 REGIMETTYLOCOUTPUT MARKINGTACACS UIDEND OF RECORDTERMINAL TYPESEND LOCATIONSUPDUP OUTPUTSUPDUPDATA ENTRY TERMINALBYTE MACROLOGOUTEXTEND ASCIINAOLFDNAOVTDNAOVTSNAOFFDNAOHTDNAOHTSNAOCRDNAOPNAOLRCTETIMING MARKSTATUSNAMESUPPRESS GO AHEADRCPECHOBINARYEEOLEBOLEWRECROVERINSRTMCEOLMCBOLMCWRMCWLMCRMCLFORW2FORW1XOFFXONLNEXTRPEWSYNCH0-wCannot open %s. (standard output)%c 0x%x %c%.2x%.2x %s IAC %s%s IAC %d%s %s %sEXOPL%d%s %d %dresp DO_DONT %s: %d resp DO_DONT %d: %d want DO %s want DO %d want DONT %s want DONT %d DO %s DO %d resp WILL_WONT %s: %d resp WILL_WONT %d: %d want WILL %s want WILL %d want WONT %s want WONT %d WILL %s WILL %d RCVDSENT%s IAC SB (terminated by %s %d , not IAC SE!) (Empty suboption???)TERMINAL-TYPE IS "%.*s"SEND- unknown qualifier %d (0x%x).TERMINAL-SPEED (empty suboption???) IS %.*s SEND %d (unknown) ?%d?TOGGLE-FLOW-CONTROL OFF ON RESTART-ANY RESTART-XON %d %d (%d)LINEMODE WILL WONT DO DONT (no option???)Forward Mask %x%d (unknown) %dSLC %s NOSUPPORT CANTCHANGE VARIABLE DEFAULT|FLUSHOUT|FLUSHIN|ACK%s%s%s(0x%x) %d;MODE (no mode???)|LIT_ECHO|SOFT_TAB|TRAPSIG|EDIT%s%s%s%s%s (0x%x) ?0x%x? IS IS %s %s %s %d SB SEX-DISPLAY-LOCATION NEW-ENVIRON IS SEND INFO " VALUE " VAR " ESC " USERVAR " %03o %s (unknown)ȺȺȺȺȺȺȺȺȺȺȺȺȺȺȺȺȺȺȺȺȺȺȺȺpȺȺȺ %02x@(#)cl_bsd.c 8.29 (Berkeley) 7/1/96@(#)cl_funcs.c 10.50 (Berkeley) 9/24/96smcuprmcupError: move: l(%u) c(%u) o(%u)xterm]0;%susage: ex [-eFRrSsv] [-c command] [-t tag] [-w size] [file ...] usage: vi [-eFlRrSv] [-c command] [-t tag] [-w size] [file ...] %s@(#)cl_main.c 10.36 (Berkeley) 10/14/96TERMunknown]0;%s/dev/ttytcgetattr%s: No terminal database found %s: %s: unknown terminal type signal-reset%s:%s @(#)cl_read.c 10.15 (Berkeley) 9/24/96x,Xinputlines=%lucolumns=%lu@(#)cl_screen.c 10.49 (Berkeley) 9/24/96016|Vi's standard input and output must be a terminalTERMLINESCOLUMNS%s%s: unknown terminal typetcgetattrtcsetattrcupsmsormsoelcuu1%lu@(#)cl_term.c 10.22 (Berkeley) 9/15/96ywkgeWRPD@>4/>4)'ztrhcursor upkkcuu1cursor rightlkcuf1delete to end of screendGkedscroll upkripage upkpppage downknpcursor lefthkcub1delete lineddkdl1insert at cursorikich1go to sol^khomekendgo to eol$kllscroll downkinddelete to eolDkelcursor downjkcud1delete characterxkdch1insert lineOkil1ykth zlakahajakf%d233|This terminal has no %s keyfunction key %dstderr%s046|messages not turned on: %s045|messages not turned off: %sTERMlinestigetnum: linescolstigetnum: colsLINESCOLUMNS@(#)cut.c 10.10 (Berkeley) 9/15/96@(#)delete.c 10.12 (Berkeley) 10/23/96002|Line length overflow$FreeBSD: src/contrib/nvi/common/exf.c,v 1.3.2.1 2001/07/09 04:58:38 obrien Exp $/tmp%s/vi.XXXXXXXXXX237|Unable to create temporary file238|Warning: %s is not a regular file%s239|%s already locked, session is read-only%s/%s-c option240|%s: remove241|%s: close242|%s: remove243|%s: remove244|Read-only file, not written; use ! to override245|Read-only file, not written246|%s exists, not written; use ! to override247|%s exists, not written248|Partial file, not written; use ! to override249|Partial file, not written250|%s: file modified more recently than this copy; use ! to override251|%s: file modified more recently than this copy252|%s: write lock was unavailableaw254|%s: WARNING: FILE TRUNCATED256|%s: new file: %lu lines, %lu characters315|%s: appended: %lu lines, %lu characters257|%s: %lu lines, %lu characters258|%s expanded into too many file names.%d259|%s: not a regular file260|%s: not owned by you261|%s: accessible by a user other than the owner262|File modified since last complete write; write or use ! to override263|File modified since last complete write; write or use :edit! to override264|File modified since last complete write; write or use ! to override265|File is a temporary; exit will discard modifications266|File readonly, modifications not auto-written@(#)key.c 10.33 (Berkeley) 9/24/96079|No non-printable character found0123456789abcdef01234567,\qq,,qP276|Unexpected character event277|Unexpected end-of-file event279|Unexpected interrupt event280|Unexpected quit event281|Unexpected repaint event285|Unexpected string event286|Unexpected timeout event316|Unexpected resize event287|Unexpected write event x$0xx<HT`@(#)line.c 10.21 (Berkeley) 9/15/96003|unable to delete line %lu004|unable to append to line %lu005|unable to insert at line %lu006|unable to store line %lu007|unable to get last line008|Error: unable to retrieve line %lu@(#)log.c 10.8 (Berkeley) 3/6/96009|Log file/usr/src/usr.bin/vi/../../contrib/nvi/common/log.c010|Logging not being performed, undo not possible011|No changes to undoH,,l,,l,,,4-012|Logging not being performed, undo not possible0.X.----..013|Logging not being performed, roll-forward not possible014|No changes to re-do//0@00x0/0015|%s/%d: log put error267|Log restarted@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1992, 1993, 1994, 1995, 1996 Keith Bostic. All rights reserved. @(#)main.c 10.48 (Berkeley) 10/11/96exnexnviewviewc:eFGlRrSst:vw:only one -c command may be specified.only one of -r and -t may be specified.only one tag file may be specified.-s option is only applicable to ex.window=%s4444444P3`34444444444|33444444444444444 34D3444444p344444333433ex/vi: %s%.*s---c$-s%s: %s @(#)mark.c 10.13 (Berkeley) 7/19/96017|Mark %s: not set018|Mark %s: the line was deleted019|Mark %s: cursor position no longer exists@(#)msg.c 10.48 (Berkeley) 9/15/96020|Error: %s, %d: : %s%.*stABABA8,  299|yanked298|shifted297|moved296|joined295|deleted294|changed293|addedVL301|lines300|line%lu 317|%d files to edit021|new file022|name changed023|modified024|unmodified025|UNLOCKED026|readonly028|empty file027|line %lu of %lu [%lu%%]029|line %luLC_MESSAGESLANG%s%sVI_MESSAGE_CATALOG030|The file %s is not a message catalog268|confirm? [ynq]269|Press any key to continue: 270|Press any key to continue [: to enter more ex commands]: 161|Press Enter to continue: 275| cont?271|Press any key to continue [q to quit]: lOOOOOO@(#)options.c 10.51 (Berkeley) 10/14/96Lw tw8zyph8z]8zUKzEw@y;z60&!y yzyyyzz uj@`WL@C91z@'" zT{ { { {writeanywrapscanwrapmarginwraplenwindownamewindowwarnw9600w300w1200verbosettywerasetimeouttildeoptersetermtagstaglengthtabstopsourceanyslowopensidescrollshowmodeshowmatchshiftwidthshellmetashellsecuresectionssearchincrscrollrulerreportremapredrawrecdirreadonlypromptprintpathparagraphsoptimizeopenoctalnumbernoprintmsgcatmodelinemesgmatchtimemagiclocklistlisplinesleftrightkeytimeignorecaseiclowerhardtabsgtagsmodeflashfilecextendedexrcerrorbellsescapetimeedcompatibledirectorycommentcolumnsceditcdpathbeautifybackupautowriteautoprintautoindentaltwerase   "%&,*024:786~>{=xBu<q?i?gIdNaI^K[LXMwswmwlwiwawttytypettytstotltagswsmdsmslowshsectscrroreparaoptnumodelinesliichtgtexedebdircobfawapaiCDPATH:cdpath=%sTMPDIR/tmpdirectory=%sescapetime=6keytime=6matchtime=7/usr/share/vi/catalog/msgcat=%sreport=5paragraphs=IPLPPPQPP LIpplpipbppath=%s/var/tmp/vi.recoverrecdir=%ssections=NHSHH HUnhshSHELL/bin/shshell=%sshellmeta=~{[*?$`'"\shiftwidth=8sidescroll=16tabstop=8tags=%sscroll=%ldwindow=%lu031|Unable to set default %s optionall032|Usage: %s291|set: the %s option may not be turned off313|set: the %s option may never be turned on034|set: [no]%s option doesn't take a value035|set: %s option isn't a boolean036|set: %s option: %s037|set: %s option: %s: value overflow038|set: %s option: %s is an illegal number314|set: the %s option may never be set to 0039|set: %s option isn't a boolean305|No %s edit option specified%ld%*s no%s%s%s=%ld%s="%s"set %s set no%s set %s=%-3ld set 033|set: no %s option: 'set all' gives all option values@(#)options_f.c 10.25 (Berkeley) 7/12/96040|Screen columns too small, less than %d041|Screen columns too large, greater than %d042|Screen lines too small, less than %d043|Screen lines too large, greater than %d044|The lisp option is not implemented048|The paragraph option must be in two character groups049|The section option must be in two character groups@(#)put.c 10.11 (Berkeley) 9/23/96053|The default buffer is empty054|Buffer %s is empty@(#)screen.c 10.15 (Berkeley) 9/15/96@(#)search.c 10.25 (Berkeley) 6/30/96072|File empty; nothing to search073|Reached end-of-file without finding the pattern074|No previous search pattern075|Pattern not found076|Reached top-of-file without finding the pattern077|Search wrappedXdp|078|Searching...@(#)seq.c 10.10 (Berkeley) 3/30/96 %s@(#)recover.c 10.21 (Berkeley) 9/15/96%s055|Files with newlines in the name are unrecoverable%s/vi.XXXXXX056|Modifications not recoverable if the session fails057|Copying file for recovery...058|Preservation failed: %s059|Modifications not recoverable if the session fails060|File backup failed: %s061|Copying file for recovery...062|Information on user id %u not found%s/recover.XXXXXX063|Unable to lock recovery filePrecedence: bulkSubject: Nvi saved the file To: From: root (Nvi recovery program)Reply-To: rootX-vi-recover-path: X-vi-recover-file: %s%s %s%s %s %s %s%s %s%s %s -r : to this file using the -r option to You can recover most, if not all, of the changes , when it was saved for recovery. on the machine was editing a file named , the user On %s%.24s%s%s%s%s%s%s%s%s%s%s%s%s%s%s 064|Recovery file buffer overrun065|Recovery file.recdir: %srecover.r+066|%s: malformed recovery file%.24s: %s vi: no files to recover. %s/%s067|%s: malformed recovery file068|No files named %s, readable by you, to recover069|There are older versions of this file for you to recover070|There are other files for you to recover/usr/sbin/sendmail071|not sending email: %s%s -t < %s@(#)util.c 10.11 (Berkeley) 9/15/96@(#)ex.c 10.57 (Berkeley) 10/10/96script 170|Interrupted!#&*<=>@~080|Unknown command name1bca1082|%s: command not available in ex mode083|Count may not be zero084|%s: bad line specification085|Internal syntax table error (%s: %s)lr086|Usage: %s088|Flag offset to before line 1089|Flag offset past end-of-file090|@ with range running when the file/screen changed091|Global/v command running when the file/screen changed092|Ex command failed: pending commands discarded093|Ex command failed: mapped keys discardedڴڴڴڴڴڴڴڴڴڴڴڴڴڴڴڴڴڴڴڴڴڴڴڴڴ0l Ht094|The second address is smaller than the first(5$0123456789'\/?.+-^095|No mark name supplied096|\ not followed by / or ?097|Reference to a line number less than 0xxxxxxxx70000000000xxxxx@xxxxxxxxxxxxxxxxxxxxxxxxxxxx098|The %s command is unknown099|Address value overflow100|Address value underflow101|Illegal address combination102|Illegal address: only %lu lines in the file103|Illegal address: the file is empty104|The %s command doesn't permit an address of 0DtP@(#)ex_abbrev.c 10.7 (Berkeley) 3/6/96105|No abbreviations to display106|Abbreviations must end with a "word" character107|Abbreviations may not contain tabs or spaces108|Abbreviations may not mix word/non-word characters, except at the end109|"%s" is not an abbreviation@(#)ex_append.c 10.30 (Berkeley) 10/23/96 273|Entering ex input mode.@(#)ex_args.c 10.16 (Berkeley) 7/13/96111|No more files to edit112|No previous files to edit113|No previous files to rewind114|No file list to display ][%s%s%s@(#)ex_argv.c 10.26 (Berkeley) 9/20/96echo 115|No previous command to replace "!"116|No filename to substitute for %%117|No filename to substitute for #./%s304|Shell expansion failed289|Shell expansions not supported when the secure edit option is setpiperfdopenvfork-c118|Error: execl: %s119|I/O error: %s@(#)ex_at.c 10.12 (Berkeley) 9/15/96@(#)ex_bang.c 10.33 (Berkeley) 9/23/96!!%s 303|File modified since last write.! @(#)ex_cd.c 10.10 (Berkeley) 8/12/96120|File modified since last complete write; write or use ! to overrideHOME121|Unable to find home directory location%s/%s122|New current directory: %s%s@(#)ex_cmd.c 10.20 (Berkeley) 10/10/96"H """" "n"@"!">] [file]wqwrite the file and switch to the next file[line [,line]] wn[!] [>>] [file]wnwrite the file[line [,line]] w[rite][!] [ !cmd | [>>] [file]]writedisplay vi key usage statement[viu]sage [key]viusageedit another file (from vi mode only)[Vv]i[sual][!] [+cmd] [file]enter visual (vi) mode from ex mode[line] vi[sual] [-|.|+|^] [window_size] [flags]2c11visualdisplay the program version informationversionexecute a global command on lines NOT matching an RE[line [,line]] v [;/]RE[;/] [commands]vdelete an input or command mapunm[ap][!] word!w1runmapdelete an abbreviationuna[bbrev] wordunabbreviateundo the most recent changeu[ndo]undorun the tcl interpreter with the commandtc[l] cmdtcldiscard all tagstagt[op][!]tagtopmove to the previous tagtagpr[ev][!]tagprevreturn to the previous group of tagstagp[op][!] [number | file]tagpopmove to the next tagtagn[ext][!]tagnext[Tt]a[g][!] [string]tag[line [,line]] t line [flags]tsu[spend][!]suspendsuspend the edit sessionst[op][!]stopread a file of ex commandsso[urce] filef1rsourcesuspend editing and run a shellsh[ell]shellset options (use ":set all" to see all options)se[t] [option[=[value]]...] [nooption ...] [option? ...] [all]wNsetrun a shell in a screensc[ript][!] [file]scriptsubstitute on lines matching an RE[line [,line]] s [[/;]RE[/;]repl[/;] [cgr] [count] [#lp]]edit the file containing the tag[Rr]ta[g][!] [string]!w1ortagre-edit all the files in the file argument listrew[ind][!]rewindgrow or shrink the current screenresize [+-]rowsc+resizerecover a saved filerecover[!] filerecoverappend input from a command or file to the line[line] r[ead] [!cmd | [file]]readexit ex/viq[uit][!]quitappend a cut buffer to the line[line] pu[t] [buffer]putedit the previous file in the file argument list[Pp]rev[ious][!]previouspreserve an edit session for recoverypre[serve]preserverun the perl interpreter with the command, on each lineperld[o] cmdperldorun the perl interpreter with the commandpe[rl] cmdperldisplay lines[line [,line]] p[rint] [count] [#l]printenter "open" mode (not implemented)[line] o[pen] [/RE/] [flags]openchange display to number lines[line [,line]] nu[mber] [count] [l]numberedit (and optionally specify) the next file[Nn][ext][!] [+cmd] [file ...]!fNnextwrite a .exrc filemkexrc[!] file!f1rmkexrcmap input or commands to one or more keysmap[!] [keys replace]!Wmap[line] ma[rk] keymarkmove lines elsewhere in the file[line [,line]] m[ove] linelmovedisplay lines in an unambiguous form[line [,line]] l[ist] [count] [#]listmark a line position[line] k keykjoin lines into a single line[line [,line]] j[oin][!] [count] [flags]!ca1joininsert input before a line[line] i[nsert][!]insertdisplay help statementhe[lp]helpexecute a global command on lines matching an RE[line [,line]] g[lobal][!] [;/]RE[;/] [commands]globalbring a backgrounded screen into the foreground[Ff]g [file]fgdisplay (and optionally set) file namef[ile] [name]filedisplay ex command usage statement[exu]sage [command]w1oexusage[Ee]x[!] [+cmd] [file]exbegin editing another file[Ee][dit][!] [+cmd] [file]f1oeditdisplay buffers, connections, screens or tagsdisplay b[uffers] | c[onnections] | s[creens] | t[ags]w1rdisplaydelete lines from the file[line [,line]] d[elete][flags] [buffer] [count] [flags]bca1deletecreate a set of tags using a cscope commandcs[cope] command [args]!scscopecopy lines elsewhere in the file[line [,line]] co[py] line [flags]l1copychd[ir][!] [directory]chdirchange the current directorycd[!] [directory]!f1ocdchange lines to input[line [,line]] c[hange][!] [count]!cachangeput a foreground screen into the backgroundbgdisplay file argument listar[gs]argsspecify an input abbreviationab[brev] [word replace]Wabbreviateappend input to a line[line] a[ppend][!]append@ [buffer]@shift lines right[line [,line]] >[>...] [count] [flags]>display line number[line] = [flags]1=shift lines left[line [,line]] <[<...] [count] [flags]<execute a buffer* [buffer]b*repeat the last subsitution[line [,line]] & [cgr] [count] [#lp]s&display numbered lines[line [,line]] # [count] [l]ca1#filter lines through commands or run commands[line [,line]] ! commandS!scroll lines^D@(#)ex_cscope.c 10.13 (Berkeley) 9/15/96v% \%G%B%  %##  ### y#m#g# @#g#Discard all current cscope connectionsresetkill numberKill a cscope connectionkillhelp [command]Show help for cscope commandshelpfind c|d|e|f|g|i|s|t buffer|pattern c: find callers of name d: find all function calls made from name e: find pattern f: find files with name as substring g: find definition of name i: find files #including name s: find all uses of name t: find assignments to nameQuery the databases for a patternfindadd file | directoryAdd a new cscope databaseadd309|Use "cscope help" for helpCSCOPE_DIRS :cscope.out%s/%scscope.tpath%s:pipevforkcd '%s' && exec cscope -dl -f %s-csh/bin/shexecl: %swr310|No cscope connections running%d%s 278|No matches for querysgdct efi311|%s: unknown search type: use one of %scscope: %d lines%1[ ]%s: "%s" %s doesn't match any cscope command Command: %s (%s) Usage: %s cscope commands: %*s: %s 312|%d: no such cscope session1No cscope connections. %2d %s (process %lu) @(#)ex_delete.c 10.9 (Berkeley) 10/23/96@(#)ex_display.c 10.12 (Berkeley) 4/10/96buffersconnectionsscreenstags123|No cut buffers to displaydefault buffer (line mode) (character mode)********** %s%s @(#)ex_edit.c 10.10 (Berkeley) 4/27/96@(#)ex_equal.c 10.10 (Berkeley) 3/6/96%ld @(#)ex_file.c 10.12 (Berkeley) 7/12/96@(#)ex_filter.c 10.34 (Berkeley) 10/23/96piperfdopenvfork-cexecl: %sfilterforkwparent-writerfilter read@(#)ex_global.c 10.22 (Berkeley) 10/10/96124|The %s command can't be used as part of a global or v commandpp@(#)ex_init.c 10.26 (Berkeley) 8/12/96/etc/vi.exrcNEXINITEXINITHOME.nexrc%s/%s.exrc125|%s/%s: not sourced: not owned by you or root126|%s/%s: not sourced: not owned by you127|%s/%s: not sourced: writeable by a user other than the owner128|%s: not sourced: not owned by you or root129|%s: not sourced: not owned by you130|%s: not sourced: writeable by a user other than the owner@(#)ex_join.c 10.10 (Berkeley) 9/15/96131|No following lines to join.?!@(#)ex_map.c 10.9 (Berkeley) 3/6/96132|No input map entries133|No command map entries134|The %s character may not be remapped135|"%s" isn't currently mapped@(#)ex_mark.c 10.8 (Berkeley) 3/6/96136|Mark names must be a single character@(#)ex_mkexrc.c 10.11 (Berkeley) 3/6/96.exrc137|%s exists, not written; use ! to override%swabbreviate map map! 138|New exrc file: %s@(#)ex_move.c 10.10 (Berkeley) 9/15/96139|Destination line is inside move range@(#)ex_open.c 10.7 (Berkeley) 3/6/96140|The open command requires that the open option be set141|The open command is not yet implemented@(#)ex_preserve.c 10.12 (Berkeley) 4/27/96142|Preservation of this file not possible143|File preserved@(#)ex_print.c 10.18 (Berkeley) 5/12/96%6lu TOOBIG $ [ynq]%c@(#)ex_put.c 10.7 (Berkeley) 3/6/96@(#)ex_quit.c 10.7 (Berkeley) 4/27/96@(#)ex_read.c 10.38 (Berkeley) 8/12/96!!%s ! r%s145|Only regular files and named pipes may be read146|%s: read lock was unavailable147|Reading...148|%s: %lu lines, %lu characters@(#)ex_screen.c 10.11 (Berkeley) 6/29/96149|No background screens to display @(#)ex_script.c 10.30 (Berkeley) 9/24/96150|The script command is only available in vi modetcgetattrptyforkemacsTERMemacs:TERMCAPtEMACS-iexecl: %sselectError: timed outError: shell: EOFshell151|No command to execute script-shellttypqrs0123456789abcdef@(#)ex_set.c 10.7 (Berkeley) 3/6/96@(#)ex_shell.c 10.38 (Berkeley) 8/19/96%s -i vfork-cexecl: %swaitpid; core dumped ...%.*s%s: received signal: %s%s%.*s%s: exited with status %d'88 88777777777 7 v7^7Y7 F737 #77 76666666k6T6<6Filesize limit exceededCputime limit exceededWindow size changesVirtual timer expiredUser defined signal 2User defined signal 1Urgent I/O conditionStopped (tty output)Stopped (tty input)SuspendedTrace/BPT trapTerminatedBad system callSuspended (signal)Segmentation faultQuitProfiling timer expiredBroken pipeKilledIOT trapI/O possibleInterruptInformation requestIllegal instructionHangupFloating point exceptionEMT trapContinuedChild exitedBus errorAlarm clockAbort trapUnknown signal: %d@(#)ex_shift.c 10.11 (Berkeley) 9/15/96152|shiftwidth option set to 0@(#)ex_source.c 10.12 (Berkeley) 8/10/96%s@(#)ex_stop.c 10.10 (Berkeley) 3/6/96@(#)ex_subst.c 10.37 (Berkeley) 9/15/96153|Count overflow154|Count underflow155|Regular expression specified; r flag meaningless156|The #, l and p flags may not be combined with the c flag in vi mode169|Confirm change? [n]157|No match found/ L L L L L L L L L L L L L L L L L L L L L L / L L ~ L L L L L L L } L } L L } } } } } } } } } } L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L ~ L L L ~ L L L L ~ L L L ~ L  [[:<:]][[:>:]]^.[]$*([ ]|/\*([^*]|\*/)*\*/)*\^.[]$*+?()|{}RE error: %s          ș ș ș ș ș ș ș ș ș ș            ̛                                ̛       ܛ          @(#)ex_tag.c 10.36 (Berkeley) 9/15/96158|No previous tag entered282|Already at the last tag of this group255|Already at the first tag of this group159|Less than %s entries on the tags stack; use :display t[ags]160|No file %s on the tags stack to return to; use :display t[ags]292|Display too small.%2d ... %*.*s %*.*s* %s%.*s 164|%s: the tag's line number is past the end of the file165|The tags stack is empty166|%s: search pattern not foundrxxglobal -%s '%s'r162|%s: tag not found%s 163|%s: corrupted tag in %smunmapclose%s/%s@(#)ex_txt.c 10.17 (Berkeley) 10/10/96 |  0  P     P 8  < < < <  < < <  < < < < < < < \ %c%6lu %.*s@(#)ex_undo.c 10.6 (Berkeley) 3/6/96@(#)ex_usage.c 10.13 (Berkeley) 5/3/96To see the list of vi commands, enter ":viusage" To see the list of ex commands, enter ":exusage" For an ex command usage statement enter ":exusage [cmd]" For a vi key usage statement enter ":viusage [key]" To exit, enter ":q!" The %.*s command is unknown Command: %s Usage: %s ^D%*s: %s The %s key has no current meaning Key:%s%s Usage: %s %s @(#)ex_util.c 10.23 (Berkeley) 6/19/96167|%d more files to edit168|Buffer %s is empty144|%s: expanded into too many file names283|The %s command requires the ex terminal interface272|That form of %s requires the ex terminal interface274|Command failed, no file read in yet.173|The %s command requires that a file have already been read in171|No previous buffer to execute172|No previous regular expression230|This screen may not be suspended290|The %s command is not supported when the secure edit option is set284|That form of %s is not supported when the secure edit option is set174|Usage: %s     ( 4 @ L T d @(#)ex_version.c 10.31 (Berkeley) 8/22/96Version 1.79 (10/23/96) The CSRG, University of California, Berkeley.@(#)ex_visual.c 10.13 (Berkeley) 6/28/96175|The visual command requires that the open option be set%luz%c%lu%luz%c @(#)ex_write.c 10.30 (Berkeley) 7/12/96! 253|Writing...%s@(#)ex_yank.c 10.7 (Berkeley) 3/6/96@(#)ex_z.c 10.10 (Berkeley) 3/6/96---------------------------------------- @(#)ex_tcl.c 8.10 (Berkeley) 9/15/96302|Vi was not loaded with a Tcl interpreter@(#)ex_perl.c 8.10 (Berkeley) 9/15/96306|Vi was not loaded with a Perl interpreter@(#)getc.c 10.10 (Berkeley) 3/6/96177|Empty file 4  4  @(#)v_at.c 10.8 (Berkeley) 4/27/96 %lu@(#)v_ch.c 10.8 (Berkeley) 3/6/96\ l x        178|No previous F, f, T or t search179|%s not found@(#)v_cmd.c 10.9 (Berkeley) 3/28/96" "@T"cc@  bbbb  b`b\ ] y copy text to motion into a cut buffer[buffer][count]y[count]motion x delete character[buffer][count]x w move to next word[count]w u undo last changeu t before character in line forward search[count]t character s substitute character[buffer][count]s r replace character[count]r character p insert after cursor from buffer[buffer]p o append after line[count]o n repeat last search m set markm[a-z] l move right by columns[count]l k move up by lines[count]k j move down by lines[count]j i insert before cursor[count]i h move left by columns[count]h f character in line forward search[count]f character e move to end of word[count]e d delete to motion[buffer][count]d[count]motion c change to motion[buffer][count]c[count]motion b move back word[count]b a append after cursor[count]a ` move to mark`[`a-z] _ move to first non-blank_ ^ move to first non-blank^]] move forward section]][[ move back section[[ZZ save file and exitZZ Y copy line[buffer][count]Y X delete character before cursor[buffer][count]X W move to next bigword[count]W U Restore the current lineU T before character in line backward search[count]T character S substitute for the line(s)[buffer][count]S R replace characters[count]R Q switch to ex modeQ P insert before cursor from buffer[buffer]P O insert above line[count]O N reverse last searchn M move to screen middleM L move to screen bottom[count]L J join lines[count]J I insert before first nonblank[count]I H move to count lines from screen top[count]H G move to line[count]G F character in line backward search[count]F character E move to end of bigword[count]E D delete to end-of-line[buffer]D C change to end-of-line[buffer][count]C B move back bigword[count]B A append to the line[count]A @ execute buffer@buffer ? search backward?RE[? offset] > shift lines right to motion[count]>[count]motion < shift lines left to motion[count]<[count]motion ; repeat last F, f, T or t search[count]; : ex command:command [| command] ... 0 move to first character0 / search forward/RE[/ offset] . repeat the last command. - move up by lines (to first non-blank)[count]- , reverse last F, f, T or t search[count], + move down by lines (to first non-blank)[count]+ ) move forward sentence[count]) ( move back sentence[count]( ' move to mark (to first non-blank)'['a-z] & repeat substitution& % move to match% $ move to last column [count]$ # number increment/decrement[count]# +|-|# ! filter through command(s) to motion[count]![count]motion command(s) move right by columns[count]' '^^ switch to previous file^^^] tag push cursor word^] ^\ switch to ex mode^\^[ exit input mode, cancel partial commands^[ ^Z suspend editor^Z^Y page up by lines[count]^Y^W move to next screen^W^V input a literal character^V^U half page up (set count)[count]^U^T tag pop^T^R redraw screen^R^P move up by lines[count]^P^N move down by lines[count]^N^M move down by lines (to first non-blank)[count]^M^L redraw screen^L^J move down by lines[count]^J^H move left by characters[count]^H^G file status^G^F scroll down by screens[count]^F^E scroll down by lines[count]^E^D scroll down by half screens (setting count)[count]^D^C interrupt an operation (e.g. read, write, search)^C^B scroll up by screens[count]^B^A search forward for cursor word[count]^A@(#)v_delete.c 10.9 (Berkeley) 10/23/96@(#)v_ex.c 10.42 (Berkeley) 6/28/96207|The Q command requires the ex terminal interface <>suspend180|No previous file to edit!307|No ex command to execute@(#)v_increment.c 10.12 (Berkeley) 3/19/96ddddd%#0*lo0x%0*lx0X%0*lX%+ld%ldabcdefABCDEF181|Cursor not in a number182|Resulting number too large183|Resulting number too small@(#)v_init.c 10.8 (Berkeley) 3/30/96@(#)v_itxt.c 10.16 (Berkeley) 10/23/96@(#)v_left.c 10.7 (Berkeley) 3/6/96@(#)v_mark.c 10.8 (Berkeley) 9/20/96@(#)v_match.c 10.8 (Berkeley) 3/6/96184|No match character on this line185|Matching character not found@(#)v_paragraph.c 10.7 (Berkeley) 3/6/96@(#)v_put.c 10.5 (Berkeley) 3/6/96@ D H L P T X \ @(#)v_redraw.c 10.6 (Berkeley) 3/6/96@(#)v_replace.c 10.17 (Berkeley) 6/30/96186|No characters to replace           @(#)v_right.c 10.7 (Berkeley) 3/6/96@(#)v_screen.c 10.10 (Berkeley) 4/27/96308|Enter to execute a command, :q to exit187|No other screen to switch to@(#)v_scroll.c 10.9 (Berkeley) 4/27/96@(#)v_search.c 10.18 (Berkeley) 9/19/96search+%lu188|Characters after search string, line offset and/or z command[[:>:]][[:<:]]%s%s%s189|No previous search pattern190|Search wrapped to original position@(#)v_section.c 10.7 (Berkeley) 3/6/96@(#)v_sentence.c 10.7 (Berkeley) 3/6/96d* * * * * * * * * * * * * * * * * * * * * * * k* T* \* * * * * \* * \* * * * * T* * * * * * * * * * * * * * * * * T* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * \* @(#)v_status.c 10.9 (Berkeley) 5/15/96@(#)v_txt.c 10.87 (Berkeley) 10/13/96191|Abbreviation exceeded expansion limit: characters discarded 192|Illegal character; quote to enterx7 7 7 @ \7 $7 \7 \7 \7 \7 D7 G 0B B G lG G G H; @ G G H; G G G C F G . conflicting matchers specifiedGREP_OPTIONSinvalid context length argumentegrepfgrepgrepreadskiprecurseunknown directories method-without-matchunknown binary-files type2.4d%s (GNU grep) %s Copyright (C) 1988, 1992-1998, 1999 Free Software Foundation, Inc. This is free software; see the source for copying conditions. There is NO warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. default@p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p 4p k k k k k k k k k k 4p 4p 4p 4p 4p 4p 4p k k $l 4p hl tl l l p 4p 4p n 4p 4p 4p 4p 4p Sm 4p 4p @p l 4p l 4p o 4p 4p 4p 4p 4p 4p o l l l tm m 4p n n 4p 4p  o 4p 0o 4p 4p @o Sm \o 4p @p lo |o o n o 4p 4p 4p 4p 4p o memory exhaustedmemory exhaustedfgrepawkegrepgrepdefaultmemory exhausted^\(\(^\|[^[:alnum:]_]\)\(\)\([^[:alnum:]_]\|$\)\)$^((^|[^[:alnum:]_])()([^[:alnum:]_]|$))$\\#$FreeBSD: src/lib/libutil/logwtmp.c,v 1.14 2000/01/15 03:26:54 shin Exp $0123456789invalid hostname%d/var/log/wtmp%d%02d%03dT                                              ƙ    h            (    H  t                                \          <      |yvspmjgda^[XUROLIFC@=:74xrptNLMTncnsbsYGYFYEYDYCYBYAhlutccNDNPNRHC5inxxoulhzxtesosmsmidbdainhskmhcgneoxnxsxbambwʗǗė|yvspmjgda^[XkndTdBdNdCugYpYoBTYnYmYlYkYjYiYhYgYfYeYdYcYbYaNCpaCoMWmalwlhNlwsvtpbsglmliitco ޢۢآբҢϢ̢ɢƢâ~{xurolifc`]ZWTQNKHEB?<9630-*'$!  ߡܡ١֡ӡС͡ʡǡġ|yvspmjgda^[XUROLIFC@=:741.+(%"  ݠڠנԠѠΠˠȠŠ }zwtqnkheb_\YVSPMJGDA>;852/,)&#  ޟ۟؟՟ҟϟ̟ɟƟß~{xurolifc`]ZWTQNKHEB?<9630-*'$!  ߞܞٞ֞ӞО͞=ʞǞĞ|yvspmjgda^[XUROLbxmumlGCGVGHGDGUGLGRG4G1G3G2kobcnlrsi2sLsAXvXtXrXoXlXhS8S7S6S5S4S3S2S1YZYzYyYxYwYvZzXys3s2s1s0cidvxlABAFGmRQMiKmZyZxZwZvZuZtZsZrZqZpZoZnZmZlZkZjZiZhZgZfZeZdZcZbZaZZZYZXZWZVZUZTZSZRZQZPZOZNZMZLZKZJZIZHZGZFZEZDZCZBZASbSfspIpIcocopu9u8u7u6u5u4u3u2u1u0WAPAfhPUTOQDDIHUWGCWRCDKSCLfMRMLMCcbFrFqFpFoFnFmFlFkFjFiFhFgFfFeFdFcFbFaFZFYFXFWFVFUFTFSFRFQFPFOFNFMFLFKFJFIFHFGFFFEFDFCFBFAF9F8F7F6F5F4F3F2F1RF!3!2!1%j%i%h%g%f%e%d%c%b%a#4#3#2#1*0*9*8*7*6*5*4*3*2*1&0&9&8&7&6&5&4&3&2&1%0%9%8%7%6%5%4%3%2%1@0@9@8@7@6@5@4@3@2@1LFLOeAXFXNRASARXSXkBpnacrPpOK5K4K2K3K1iPhuuctstawistsasrsfsccvrcrfr3r2r1rppopfpspxplpkUPSRRILEALSFICDODLDCpcnwmmmol9l8l7l6l5l4l3l2lal1l0kskekukTkRkFkrkPkNkHklkAkIkhk9k8k7k6k5k4k3k2k;k1k0kSkEkMkdkLkDktkCkakbipalicifi3isi1fsffvbueseeiedtemeaeecussomrmpmkimmhdmtimdmbashddsdldcvsupllndveCMlevihodocmCCchcdceclctcscrblbtNCURSES_NO_PADDINGCOLORFGBG A$@$  % 8% d% % x2d2d2dJ2d<2d,2d2d  Out of memory%dF4 4 4 F4 4 4 4 4 4 4 4 4 4 4 3 4 4 4 4 4 4 4 4 4 4 4 3 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 3 4 4 4 4 4 4 4 4 4 4 3 3 4 4 4 4 4 4 4 4 4 4 3 4 4 4 3 4 4 4 4 3 05 P5 P5 P5 P5 05  5 P5 P5 05 05 P5 05 P5 05 P5 P5 P5 P5 P5 P5 P5 P5 P5 P5 P5 P5 05 05 05 P5 P5 05 P5 P5 P5 P5 P5 P5 P5 P5 P5 P5 P5 P5 P5 05 5 P5 P5 P5 P5 P5 P5 P5 4 P5 P5 P5 P5 P5 05 P5 P5 P5 P5 4 4 P5 P5 5 P5 <5 P5 P5 4 05 P5 4 4 P5 P5 4 P5 P5 P5 P5 4 P5 P5 5 05 P5 05 7 6 6 7 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 ? @ @ @ 7 = |: @ @ ; : @ H; @ ; @ @ @ @ @ @ @ @ @ @ @ @ > > T? @ @ < @ @ @ @ @ @ @ @ @ @ @ @ @ = 9 @ @ @ @ @ @ @ 7 @ @ @ @ @ <> @ @ @ @ 7 7 @ @ H: @ <@ @ @ (8 h< @ 7 l9 @ @ 8 X@ @ @ @ 7 @ @ : = @ ? NCURSES_NO_SETBUF2Kn,X   `  %KLINESCOLUMNSTERMTERM environment variable not set. TERM environment must be <= %d characters. Not enough memory to create terminal structure. terminals database is inaccessible '%s': unknown terminal type. CC'%s': I need something more specific. '%s': I can't handle hardcopy terminals. @(#)termcap.c 8.1 (Berkeley) 6/4/93TERMCAPTERMPATHHOME.termcap /usr/share/misc/termcap/usr/share/misc/termcap:|:Out of memory|terminal names must start with letter or digitName collision between %s %sresolution of use=%s failedexit_standout_mode but no enter_standout_modeenter_standout_mode but no exit_standout_modeexit_underline_mode but no enter_underline_modeenter_underline_mode but no exit_underline_modeexit_alt_charset_mode but no enter_alt_charset_modeenter_alt_charset_mode but no exit_alt_charset_modeenter_alt_charset_mode but no acs_charsexit_alt_charset_mode but no acs_charsenter_blink_mode but no exit_attribute_modeenter_bold_mode but no exit_attribute_modeenter_ca_mode but no exit_ca_modeexit_ca_mode but no enter_ca_modeexit_delete_mode but no enter_delete_modeenter_delete_mode but no exit_delete_modeenter_dim_mode but no exit_attribute_modeexit_insert_mode but no enter_insert_modeenter_insert_mode but no exit_insert_modeenter_secure_mode but no exit_attribute_modeenter_protected_mode but no exit_attribute_modeenter_reverse_mode but no exit_attribute_modeto_status_line but no from_status_linefrom_status_line but no to_status_linemeta_on but no meta_offmeta_off but no meta_onprtr_off but no prtr_onprtr_on but no prtr_offrestore_cursor but no save_cursorsave_cursor but no restore_cursorexit_xon_mode but no enter_xon_modeenter_xon_mode but no exit_xon_modeexit_am_mode but no enter_am_modeenter_am_mode but no exit_am_modelabel_off but no label_onremove_clock but no display_clockdisplay_clock but no remove_clockset_color_pair but no initialize_pair/usr/share/misc/terminfoTERMINFO%s/%s%c/%.*sTERMINFO_DIRSEntry does not start with terminal names in column oneprimary namealias%s `%.*s' may be too longusetc%s (%s termcap extension) ignored%s (%s termcap extension) aliased to %s%s (%s terminfo extension) ignored%s (%s terminfo extension) aliased to %sextended capability '%s'unknown capability '%s'maMTbooleanstringnumericunknownwrong type used for %s capability '%s'unknown token typeн˽Ƚýzwqnjga^XUPMHEB<kcuu1uptakhtsstkentnlkcuf1ndkcub1lekICimkich1ickhomehokrmireikcud1dokdl1dlkdch1dctbcctkclrclkelcekedcdkcbtbtkil1al  %s$<%d>hardware tabs with a width other than 8: %dhardware tabs with a non-^I tab string %sunknown capability `%.*s' in ko stringko translation table is invalid, I give upno value for ko capability %s%s (%s) already has an explicit value %s, ignoring koacsc string synthesized from XENIX capabilities``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~acsc string synthesized from AIX capabilitiesHOMEOut of memory%s/.terminfo@%&*!#Illegal character (expected alphanumeric or %s) - %spremature EOFempty longname fieldwhitespace in name or alias fieldslashes aren't allowed in names or aliases$[]!*?dubious character `%c' in name or alias fieldSeparator inconsistent with syntaxMissing separator after `%s', have %sno value given for `%s'Missing separatorIllegal character - %sPremature EOFIllegal ^ character - %sAllow ^? as synonym for \177Non-octal digit `%c' in \ sequenceIllegal character %s in \ sequenceVery long string found. Missing separator?r                                                                                        ̽    ܽ            Ľ Խ  Can't backspace off beginning of line     |xsnic_YUQMHC= 8!4"/#*$%"      . D}yspmic _ IZ U O JD>961+&"  !"#$%&'()*+,-./01;2L345678~9bx:r;m<g=a>]?Y@UAQBLCHDDE@F<G=8H4I0J,K&L MNOP Q RST7UiVWQXYZ[\]^!_`abc^defghijklmnopqr{s3utqumviwexay]zY{U|~R}O~KHDA=941-*'! 6Fzupkfa\WRMPHC>94/*e%   H+zupk f!a"\#W$R%M&HC(>)9*4+/,*-%. /02 3456789:<=>?@ABCD F G H I OL~xs%mid^YSNHC@= :!7"4#1$.%+&('%(")*+,- .E/0123456789:;<N=>?@ABCDpEFGHIzJtK5oLiM/bN]OXPSQNRJSET?U9V3W.X(Y#Z[X\]^|_`ab[cdefWghijklmnmopqrstuvwxxqytkze{_|Z}RU~OIC=70*$ !%&'"# ()$%&*+<{yvqlbox1memumemlOTGCOTGVOTGHOTGDOTGUOTGLOTGROTG4OTG1OTG3OTG2OTxrOTptOTmaOTkoOTknOTdTOTdBOTNLOTMTOTbcOTnlOTdNOTdCOTncOTnsOTbsOTugOTrsOTi2slengthsgr1evhlmethlmerhlmelohlmelhlmehhlmscesascescpctrmrmscsmscrmpchsmpchdispcslinessetcolorendbidefbicolornmbicrbinelbirepsmgtbsmglrs3dss2dss1dss0dscsindevtpfxlsetabsetafgetmreqmpminfokmouscsnmzeromdocrsupcssubcsrcsdrbimscsdsbimsmgtpsmgtsmgrpsmglpsmgbpsmgbscsmcuumcufmcubmcudpordermcuu1mvpamcuf1mcub1mcud1mhparumrsupmrsubmrshmrmicmrlmritmrwidmsumssupmssubmsshmsnrmqsnlqsmicmslmsitmsdrfqswidmdefccvrchrlpicpisetbsetfscpinitpinitcocopu9u8u7u6u5u4u3u2u1u0waitpausehookpulsetoneqdialdialhupwingocwinrmclkdclksclkflnsmgrsmglmgcel1kf63kf62kf61kf60kf59kf58kf57kf56kf55kf54kf53kf52kf51kf50kf49kf48kf47kf46kf45kf44kf43kf42kf41kf40kf39kf38kf37kf36kf35kf34kf33kf32kf31kf30kf29kf28kf27kf26kf25kf24kf23kf22kf21kf20kf19kf18kf17kf16kf15kf14kf13kf12kf11rfikUNDkSPDkSAVkRESkRITkRPLkRDOkPRTkPRVkOPTkNXTkMOVkMSGkLFTkICkHOMkHLPkFNDkEXTkEOLkENDksltkDLkDCkCRTkCPYkCMDkCANkBEGkundkspdksavkreskrstkrplkrfrkrefkrdokprtkprvkoptkopnknxtkmovkmsgkmrkkhlpkfndkextkentkendkcrtkcpykcmdkclokcankbegrmlnsmlnenacsxoffcxoncrmamsmamrmxonsmxonkcbtplnacscrmpmc5pkc3kc1kb2ka3ka1iproghuuctslhtwindhtssgrriindscvparcrfrs3rs2rs1repmc5mc4mc0pfxpflocpfkeycuurincufcubilindnichcuddldchpadnelsmmrmmlf9lf8lf7lf6lf5lf4lf3lf2lf10lf1lf0smkxrmkxkcuu1khtskrikindkcuf1kppknpkllkcub1kil1kich1khomekf9kf8kf7kf6kf5kf4kf3kf2kf10kf1kf0kedkelkrmirkcud1kdl1kdch1kctabkclrktbckbsipil1ich1ifis3is2is1fslffflashrmulrmsormirrmdcrmcupsgr0rmacsechsmulsmsorevprotinvissmirdimsmdcsmcupboldblinksmacshddsldl1dch1cvviscuu1llcuf1cnormmrcupcub1civishomecud1cupcmdchhpaedelcleartbccsrcrbelcbtbitypebitwinbtnswidcscpsorviorhiorlorcnpinsmlsmcsmjumpmaddrspinhspinvbufszncvpairscolorswnummalwlhnlabwslvtpbxmclmlinesitcolslpixcpixsamxvpadaisycrxmxhpahlsbcecccndscrnpcnrrmcchtsmc5inxonxonulhzxteslokosmsgrmirdbdainhskmhcgneoxenlxhpxsbambw\@@pHhTl$H x,D t<h `8@dP 4dDXL,lLd(|(H0P\|(|P00t(lX,TtL<8p4xL<$0XD`l4 \X8( x$T$x\<PXdDPDx|t4xTL<p 0`h`plL8,Tt||$<0,\pp4p@H |( @ D (lLX      | !"#$"     }zwtqnkhe b_\YVSPMJ G D A > ;8526/,)&#  !"#$%&'(m)*+,-./0f123456789:;<=>?@ABCDEFGHIJKLMNOPQRS~T{UxVuWrXoYlZi[f\#c]`^]_Z`WaTbQcNdKeHfxEgBh?i<j9k6l3m0n-o*po'q$r!stuvwxy z {|R}O~H*'%u~tamd |yvv`spWmjgda^[XUROLIFC@=:741.+(%" z .'X(/56789:;<=>?@ABDE^}zwtqn k h e b _\YVSPMJGDA>;852/@= :!7"4#1$.%+&('%(")*,+),&-#. /0123450 6789 : ; < = > ? @ A B C Dg E Fh G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d~ e{ fx gu hr io jl ki lf mCc n` o\pU] qZ rW sT tQ uN vK wH xE yB z? {< |9 }e6 ~f3 g0 h- i* ' $ !        ! % & ' " #  ] ( ) $ % & { * +              bxmumlGCGVGHGDGUGLGRG4G1G3G2xrptkokndTdBNLbcnldNdCncnsbsugrsi2sLsAXvXtXrXoXlXhS8S7S6S5S4S3S2S1YZYzYyYxYwYvZzXyMTs3s2s1s0cidvxlABAFGmRQMiKmZyZxZwZvZuZtZsZrZqZpZoZnZmZlZkZjZiZhZgZfZeZdZcZbZaZZZYZXZWZVZUZTZSZRZQZPZOZNZMZLZKZJZIZHZGZFZEZDZCZBZASbSfspIpIcWAPAfhPUTOQDDIHUWGCWRCDKSCLfMRMLMCcbFrFqFpFoFnFmFlFkFjFiFhFgFfFeFdFcFbFaFZFYFXFWFVFUFTFSFRFQFPFOFNFMFLFKFJFIFHFGFFFEFDFCFBFAF9F8F7F6F5F4F3F2F1RF!3!2!1%j%i%h%g%f%e%d%c%b%a#4#3#2#1*0*9*8*7*6*5*4*3*2*1&0&9&8&7&6&5&4&3&2&1%0%9%8%7%6%5%4%3%2%1@0@9@8@7@6@5@4@3@2@1LFLOeAXFXNRASARXSXkBpnacrPpOK5K4K2K3K1iPtstawistsasrsfcvr3r2r1rppopfpspxplpkUPSRRILEALSFICDODLDCpcnwmmmol9l8l7l6l5l4l3l2lal1l0kskekukTkRkFkrkPkNkHklkAkIkhk9k8k7k6k5k4k3k2k;k1k0kSkEkMkdkLkDktkCkakbalici3isi1fsvbueseeitemeaeecussomrmpmkimmhdmtimdmbasdsdcvsupndveCMlevihodocmCCchcdceclctcsblbtYpYoBTYnYmYlYkYjYiYhYgYfYeYdYcYbYaNCpaCoMWNlwssglicoYGYFYEYDYCYBYAhlutccNDNPNRHC5inxxoesmsmixnxsxbHPx  0p X,  $Px   0X <@`p ` 4l p8< @   Lh0x\  |, t\|\`$d t 4|  TDP   @ t,d8(  <|  L|l  `   H L  X \h t 8`PH<dh l0H@4 `\  tpD (  H,X  $ (  T  Ddd tp x pHh L t  ( <8XD l  L lhl   $ 8|D 4TX \dT P \ 8<8 d|0 4 l@Pp\ $PTh PD l3$/$,$'$$$>'$!$5'$$'$'$'$$'$$$$$ $#$ $>$$5$$$$$#$#$#$#$8$#$$u$#$#$#$#$#$#$#$#$#$#$#$#$################# ###BCKFKEKDKCKBTekKAIRISHSIBMkqGGGcGvGhGdGuGrG8G5G7G6RTPSPNPDLDHMENCOCFGSGEXENIXEEXSDSCVCIAT&TBOBSDsb$#$#$#$#$#$#kselkbtabfont3font2font1font0Out of memorystring too complex to convertI'm confused%'%{string may not be optimal%Pa%ga%p%{96}%^%{127}%^saw %%r twice in %ssaw %%m twice in %ssaw %%n twice in %s%i%{10}%/%{16}%*%{10}%m%+%{2}%*%-%?%>%t%+%;%+%-%*%/%+%c%s%-%c%c%2d%3d%d%\unknown %% code %s (%#x) in %s$</>, t t t t t  t `  t  t   t t  t  t t t t t ( t t t  t  t t t t t t t t t t t t t t t t t t t t t t t T t t t t  H t  t < t t  t t t l  t t t H @ t \  h                 \%03o%>%%%%?%%{%d}%%>%%t%%{%d}%%+%%;%%?%%{%d}%%>%%t%%'%c'%%+%%;%%?%%'%c'%%>%%t%%{%d}%%+%%;%%?%%'%c'%%>%%t%%'%c'%%+%%;%B%%{%d}%%+%%c%%'%c'%%+%%c%D%n%mdoxX.%.%r H H H H H H H H H H 0 0 0 0 0 0 0 0 0 0 H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H H   H H H H , H H H H H H  H H  Out of memory.///////////////////////////}/z/w/t/q/o/m/k/i/g/e/c/a/_/]/[/Y/W/U/S/Q/O/M/K/I/G/E/C/A/?/=/;/9/7/5/3/1///-/+/)/'/%/#/!////////// / / /////........................................................}.z.w.t.q.n.k.h.e.b._.\.Y.V.S.P.N.L.J.H.F.D.B.@.>.<.:.8.6.4.2.0...,.*.(.&.$.". .......... . ......--------------------------------------------------------~_~^~]~\~[~Z~Y~X~W~V~U~T~S~R~Q~P~O~N~M~L~K~J~I~H~G~F~E~D~C~B~A~@^?~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"! ^_^^^]^\^[^Z^Y^X^W^V^U^T^S^R^Q^P^O^N^M^L^K^J^I^H^G^F^E^D^C^B^A^@(null)(cancelled)\%03o"%s", line %d, col %d, terminal '%s' 11}1y1t1q1n1k1h1e1b1_1\1X1S1P1J1G1D1A1=18131.1(1$11111 11100000000000OTxrOTptOTNLOTMTOTncOTnsOTbslpixcpixsamxvpadaisycrxmxhpahlsbcecccndscrnpcnrrmcchtsmc5inxonxonulhzxteslokosmsgrmirdbdainhskmhcgneoxenlxhpxsbambw 544444444~4k4^4Q4@4-4!44333333333u3j3Y3@3033 32222222v2b2P2<2return_does_clr_eolhas_hardware_tabslinefeed_is_newlinegnu_has_meta_keyno_correctly_working_crcrt_no_scrollingbackspaces_with_bslpi_changes_rescpi_changes_ressemi_auto_right_marginrow_addr_glitchhas_print_wheelcr_cancels_micro_modecol_addr_glitchhue_lightness_saturationback_color_erasecan_changenon_dest_scroll_regionno_pad_charnon_rev_rmcuphard_cursorprtr_silentneeds_xon_xoffxon_xofftransparent_underlinetilde_glitchdest_tabs_magic_smsostatus_line_esc_okover_strikemove_standout_modemove_insert_modememory_belowmemory_aboveinsert_null_glitchhas_status_linehas_meta_keyhard_copygeneric_typeerase_overstrikeeat_newline_glitchceol_standout_glitchno_esc_ctlcauto_right_marginauto_left_margins6p6j6g6c6`6]6Y6T6Q6N6K6F6?69656/6)6#66666 6665555555555555OTknOTdTOTdBOTdNOTdCOTugbitypebitwinbtnswidcscpsorviorhiorlorcnpinsmlsmcsmjumpmaddrspinhspinvbufszncvpairscolorswnummalwlhnlabwslvtpbxmclmlinesitcolsk9a9j6Q9=9+9998888888888o8]8N8?8/8 8887777777z7d7U7E7077number_of_function_keyshorizontal_tab_delaybackspace_delaynew_line_delaycarriage_return_delaymagic_cookie_glitch_ulbit_image_typebit_image_entwiningbuttonswide_char_sizeprint_rateoutput_res_vert_inchoutput_res_horz_inchoutput_res_lineoutput_res_charnumber_of_pinsmicro_line_sizemicro_col_sizemax_micro_jumpmax_micro_addressdot_horz_spacingdot_vert_spacingbuffer_capacityno_color_videomax_pairsmax_colorsmaximum_windowsmax_attributeslabel_widthlabel_heightnum_labelswidth_status_linevirtual_terminalpadding_baud_ratemagic_cookie_glitchlines_of_memoryinit_tabscolumnsGGGGGGGGGGGGGGGGG|GyGtGnGiGeGaG^GXGRGMGGGBG>G9G3G.G*G%G GGGG GGGFFFFFFFFFFFFFFFFFFFFFFFFFFFFF{FwFsFoFiFcF^FXFTFPFLFFFAF=F8F2F-F(F$F FFFFF FFFEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE|EwEtEpEmEjEdE`E\EXETEPEKEGEBE>E9E3E-E(E#EEEE EEEDDDDDDDDDDDDDDDDDDDDDDDDDD|DwDrDmDhDcD_D[DVDQDLDGDBD=D8D4D/D*D%D DDDD DDDCCCCCCCCCCCCCCCCCCCCCCCCCC|CwCrCmChCcC^CYCTCOCJCEC@C;C6C1C,C'C"CCCCC CCBBBBBBBBBBBBBBBBBBBBBBBBBBB}BzBwBtBqBnBkBhBeBbB\BVBRBMBHBDB@BX6X.X&XXXXXWWWWWWWWWWWWWWWW~WvWnWfW^WVWNWFW>W6W.W&WWWWWVVVVVVVVVVVVVzVpVbVUVGV;V4V)VVBBVVUUUUUUUUUUUUUUU{UlU]UKU9U)UU UTTTTTT|TjTUT>T,TTTSSSSSSSvSkS_SMSDS6S&SSSRRRRRRRpR`RMR>R,RRRQQQQQQQQQ}QqQcQVQIQ %s ""[]no inputemacsvi%s -> %s %-15s-> is undefined %-4s to %-7s-> %s Standard key bindings Alternative key bindings Multi-character bindings Arrow key bindings %s %s %s: Invalid switch `%c'. %s: Invalid \ or ^ in instring. %s: Invalid \ or ^ in outstring. %s: Invalid command `%s'. < < < < P< < < < < < (< `< < < < < < 4< < < < @< historyA A A A A A A A XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB XB lA xA XB XB A A XB XB XB XB XB XB XB A XB XB XB A XB A XB A XG lG hG G =G  G G xG (G *[]?Y Y (Y Y (Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y `Y pY sends cursor end@7sends cursor homekhcursor up multipleUPcursor right multipleRIcursor left multipleLEinsert multiple charsICcursor down multipleDOdelete multiple charsDCvisible bellvbend underlineuebegin underlineuscursor up oneupcursor to status linetsbegin standoutsoend standoutsenon destructive spacendend attributesmebegin boldmdsends cursor upkusends cursor rightkrsends cursor leftklsends cursor downkdinsert paddingipstart insert modeiminsert characterichome cursorhocursor from status linefsend insert modeeiend delete modeedstart delete modedmdelete a linedldelete a characterdcclear screenclcursor to horiz poschclear to end of linececlear to bottomcdaudible bellbladd new blank linealMTTab chars destructivextHas meta keykmNumber of columnscoNumber of lineslihas physical tabsptOut of termcap string space. TERMdumbCannot read termcap database; No entry for terminal type "%s"; using dumb terminal settings. downleftrighthomeend Your terminal has the following characteristics: It has %d columns and %d lines ano It has %s meta key not It can%suse tabs (empty) %25s (%s) == %s yessettc: Bad value `%s'. %s %d tabsmetabaud%lu rowslinescolsechotc: Termcap parameter `%s' not found. echotc: Warning: unknown termcap %% `%c'. echotc: Warning: Extra argument `%s'. echotc: Warning: Missing argument. echotc: Warning: Too many required arguments (%d).                                                                              chars:lflag:cflag:oflag:iflag:timeminstatuslnextdiscardreprintdsuspsuspwerasestopstarterase2eol2eoleofkillerasequitintrextprocaltwerasenokerninfoiextenpendinflushoechokeechoprtechoctltostopnoflshechonlechokechoeechoicanonisigmdmbufcrts_iflowccts_oflowclocalhupclparoddparenbcreadcstopbcignorextabsonlretonoeotonocrocrnlonlcropostimaxbelixoffixanyixonicrnligncrinlcristripinpckparmrkignparbrkintignbrk%s: Unknown switch `%c'. %*s%c%s %s %s: Invalid argument `%s'. > C < ̞ p C > <   C ( 4 L  C C | l  ̟ ؟ <   C C < ( Unmatched ) or \)Regular expression too bigPremature end of regular expressionInvalid preceding regular expressionMemory exhaustedInvalid range endInvalid content of \{\}Unmatched \{Unmatched ( or \(Unmatched [ or [^Invalid back referenceTrailing backslashInvalid character class nameInvalid collation characterInvalid regular expressionNo matchalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitL + + + + + + + + + + + + + + + + + + + + + + + + + ܣ + + + $ 8   + + h + + + + + + + + + + + + + + + +  + + + + + + + + + + + + + + + + + + + + + + + + + + + D  +  + + + + + + + + + + + + + + + + + + + + + + + + + + + + p `                            P                              0  p                         $ $ * l      ` * * * *   < <    *    L p * * * * 8  d    p , `   $   P 8   4 D \      \ <         t             <         No previous regular expression$FreeBSD: src/lib/libkvm/kvm.c,v 1.12.2.2 2000/08/23 08:53:00 kris Exp $%s: : %s : %scan't allocate %u bytes: %sexec file name too longbad flags arg/dev/mem%s/dev/null%s: not physical memory device/dev/kmem%s: %s invalid address (%x)kvm_readshort readkvm_writeshort writekvm_write not implemented for dead kernels$FreeBSD: src/lib/libkvm/kvm_i386.c,v 1.11.2.1 2001/09/21 04:01:51 peter Exp $cannot allocate vm_kernbase_IdlePTDbad namelistcannot read IdlePTDcannot read PTDvatop called in live kernel!_kvm_vatop: lseek_kvm_vatop: readinvalid address (%x)1.1.3%c%c%c%c%c%c%c%c%c%c: 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-unknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data check 1 :pHs deflate 1.1.3 Copyright 1995-1998 Jean-loup Gailly "" "$% $%$% $% $% $%1.1.3q     invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeat+`--/0 2C5666incompatible versionbuffer errorinsufficient memorydata errorstream errorfile errorstream endneed dictionary1.1.3       L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c         (08@P`p  0@`  0@`invalid literal/length codeinvalid distance codeWkX\YYZ[ \]~]] inflate 1.1.3 Copyright 1995-1998 Mark Adler  #+3;CScspp !1Aa  0@` oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengthsinvalid distance codeinvalid literal/length code$FreeBSD: src/lib/libc/string/strtok.c,v 1.2.6.1 2001/07/09 23:30:07 obrien Exp $$FreeBSD: src/lib/libc/string/strspn.c,v 1.1.1.1.14.1 2001/07/09 23:30:07 obrien Exp $$FreeBSD: src/lib/libc/string/strmode.c,v 1.1.1.2.6.1 2001/07/09 23:30:07 obrien Exp $-csh/bin/sh./%s: illegal option -- %c %s: option requires an argument -- %c $FreeBSD: src/lib/libc/stdtime/strftime.c,v 1.25.2.4 2002/03/12 17:24:54 phantom Exp $@(#)strftime.c 7.38@(#)strftime.c 5.4 (Berkeley) 3/14/89%c?%02d%m/%d/%y%2d%Y-%m-%d%03d %H:%M%ld%lu%H:%M:%S %d%04d%e-%b-%Y+-}}(~~~0L0dāP@d}p~~hp~0PH܁88܄Ѕ shut up gcc*** unknown regexp error code ***invalid argument to regex routineREG_INVARG"can't happen" -- you found a bugREG_ASSERTempty (sub)expressionREG_EMPTYrepetition-operator operand invalidREG_BADRPTout of memoryREG_ESPACEinvalid character rangeREG_ERANGEinvalid repetition count(s)REG_BADBRbraces not balancedREG_EBRACEparentheses not balancedREG_EPARENbrackets ([ ]) not balancedREG_EBRACKinvalid backreference numberREG_ESUBREGtrailing backslash (\)REG_EESCAPEinvalid character classREG_ECTYPEinvalid collating elementREG_ECOLLATEinvalid regular expressionREG_BADPATregexec() failed to matchREG_NOMATCHREG_0x%x0%dxdigitupperspacepunctprintlowergraphdigitcntrlblankalphaalnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNULD|xxxh[:<:]][:>:]]tp `\4DDDTRSHtcpshell%drcmd: getaddrinfo: %s rcmd: socket: All ports in use rcmd: socket: %s %s: %s connect to address %s: Trying %s... rcmd: write (setting up stderr): %s rcmd: too many files rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: accept: %s socket: protocol failure in circuit setup. rcmd: %s: %s 0r/etc/hosts.equiv/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts owner.rhosts writeable by other than ownerISO_ISOEUCja_JPeucJPko_KReucKRzh_CNeucCNASCIIUS-ASCIICPOSIXdxDDDDD,4<L\l|40%X%X                        /var/run/dev.db/dev/$FreeBSD: src/lib/libc/gen/strtofflags.c,v 1.18.2.1 2000/06/28 01:52:24 joe Exp $nouunlinknouunlnknoopaquenodumpnouimmutablenouchangenouchgnouappendnouappndnosunlinknosunlnknosimmutablenoschangenoschgnoarchivednoarchnosappendnosappnd ,stringlist: %mtplgc^YUQLHC?:50,'" usr2usr1infowinchprofvtalrmxfszxcpuiottouttinchldconttstpstopurgtermalrmpipesyssegvbuskillfpeemtabrttrapillquitinthupSignal 0tܿ׿ÿvcSG;0ӾlT@,User defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangup , | | | | | | | | | | | | | | @ | | | | | | | @ | |    @ |  8 /dev/tty %ur+sh-c/bin/shHOME.$FreeBSD: src/lib/libc/gen/getvfsbyname.c,v 1.5 1999/08/27 23:58:45 peter Exp $BLOCKSIZEGKM%s: unknown blocksizemaximum blocksize is %ldGminimum blocksize is 512%ld%s-blocks/kernel...//dev/ : xxswufsswap ,rwrqror/etc/fstabfstab: :%d: $ xdQ7 qbQ3`A `7 `;$uYA `SB. ~hN;"R<Illegal byte sequenceOperation canceledValue too large to be stored in data typeNo message of desired typeIdentifier removedNeed authenticatorAuthentication errorInappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisc quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0W$FreeBSD: src/lib/libc/gen/disklabel.c,v 1.9.2.1 2001/03/05 08:40:47 obrien Exp $DOC2KVinumCCDfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownvinumbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth Edition4.1BSDSystem VVersion 7Version 6swapunused/etc/disktabb0b1tyremovablesimulatedsfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdx./$FreeBSD: src/lib/libc/string/strncat.c,v 1.1.1.1.14.1 2001/07/09 23:30:07 obrien Exp $$FreeBSD: src/lib/libc/string/strcspn.c,v 1.1.1.1.14.1 2001/07/09 23:30:06 obrien Exp $authunix_create: out of memory auth_none.c - Fatal marshalling problem/usr/bin/rshrcmdsh: unknown user: %s localhost%drcmdsh: getaddrinfo: %s rcmdsh: socketpairrcmdsh: fork failedrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: setuid(%u): %s /bin/sh-c-lrcmdsh: execlp %s failed: %s $FreeBSD: src/lib/libc/locale/setlocale.c,v 1.25.2.5 2002/03/12 17:20:53 phantom Exp $LC_MESSAGESLC_TIMELC_NUMERICLC_MONETARYLC_CTYPELC_COLLATELC_ALLLANGC/PATH_LOCALE/usr/share/localenoyes^[nN]^[yY]LC_MESSAGESpasswd.byname%upasswd.byuid/etc/pwd.db/etc/spwd.db%s: %mpasswd.adjunct.byname:##master.passwd.bynamemaster.%s%s/etc/netgroupr%c*%s.%s%s.**.%s*.*netgroup.byusernetgroup.byhost), , netgroup%s %sgroup.byname%dgroup.bygidr/etc/group: :/%s.dbtcr@pxhXxxxxxxxPxxx`xHxxxxxxxxxxxxx@pxhXxxxxxxxPxxx`xHPATH/usr/bin:/bin:.execvp: : path too long sh/bin/shg4444̵4444444444g4444444444444444444444444444444444444444gg$FreeBSD: src/lib/libc/gen/err.c,v 1.6 1999/08/27 23:58:33 peter Exp $%s: : %s |ukcZQMIEA=95.' |ukcZQ%I:%M:%S %pmd%a %b %e %H:%M:%S %Z %YPMAM%a %b %e %H:%M:%S %Y%m/%d/%y%H:%M:%SSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJanLC_TIMECPOSIXPATH_LOCALE/usr/share/locale//LC_CTYPErNONEUTF2EUCBIG5MSKanjiRuneMagi`llllllllllllllllllllllllllllllllllllplllllllllllllllllllTTlllllllllllllllHllplllllllWWWlllldl4llKL$PPPPPPPll<h<hh4444444444hhhhhhhhhhhLhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhL$FreeBSD: src/lib/libc/string/strcoll.c,v 1.11.2.1 2001/07/09 23:30:06 obrien Exp $$FreeBSD: src/lib/libc/stdlib/strtouq.c,v 1.4.8.1 2001/03/02 09:45:20 obrien Exp $$FreeBSD: src/lib/libc/stdlib/strtoull.c,v 1.5.2.1 2001/03/02 09:45:20 obrien Exp $$FreeBSD: src/lib/libc/stdlib/strtoq.c,v 1.4.6.1 2001/03/02 09:45:20 obrien Exp $$FreeBSD: src/lib/libc/stdlib/strtoll.c,v 1.5.2.1 2001/03/02 09:45:20 obrien Exp $xdr_array: out of memory CPOSIX//LC_COLLATEr1.0 __collate_substitute__collate_strdup: udptcp%d%u/etc/host.confrhostslocalfilefilesdnsbindnis# /etc/hosts0123456789abcdefip6.intin-addr.arpa;; res_query(%s, %d, %d) ;; res_query: mkquery failed ;; res_query: send error ;; rcode = %d, ancount=%d HT<0TT;; res_querydomain(%s, %s, %d, %d) %s.%sHOSTALIASESr;; res_mkquery(%d, %s, %d, %d) /&LOCALDOMAINr/etc/resolv.confdomain searchnameserver%dsortlistoptionsconfRES_OPTIONSenv;; res_setoptions("%s", "%s")... ndots:;; ndots=%d debug;; res_setoptions("%s", "%s").. ;; debug inet6insecure1insecure2no_tld_queryedns0dx`ttcpudpUnknown errorResolved protocol is unknownInvalid value for hintsSystem error returned in errnoai_socktype not supportedservname not supported for ai_socktypehostname nor servname provided, or not knownNo address associated with hostnameMemory allocation failureai_family not supportedNon-recoverable failure in name resolutionInvalid value for ai_flagsTemporary failure in name resolutionAddress family for hostname not supportedSuccess# /etc/host.confrhostslocalfilefilesdnsbindnisGAI# /etc/hostsEEEEEE%s.%s%d/%sservices.byportservices.byname%.*s %s/%sr/etc/services# ,/nisyellowpagesypdomaindnsbindhtablehosttable/etc/hostshostsr/etc/host.conf ,:;$FreeBSD: src/lib/libc/string/strsep.c,v 1.2.12.1 2001/07/09 23:30:07 obrien Exp $ hosts.bynamehosts.byaddrr/etc/hosts# gethostby*.gethostanswer: asked for "%s", got "%s"gethostby*.gethostanswer: asked for "%s %s %s", got type "%s"size (%d) too big Too many addresses (%d) Impossible condition (type=%d) res_search failed (%d) %u.%u.%u.%u.in-addr.arpa%x.%x.ip6.intres_query failed (%d) static buffer is too small (%d) syslog: unknown facility/priority: %x<%d>%.15s %s[%d]: %m /dev/console /var/run/log/dev/log$FreeBSD: src/lib/libc/string/strstr.c,v 1.1.1.1.14.1 2001/07/09 23:30:07 obrien Exp $$FreeBSD: src/lib/libc/string/strpbrk.c,v 1.1.1.1.14.1 2001/07/09 23:30:07 obrien Exp $$FreeBSD: src/lib/libc/string/strcasecmp.c,v 1.2.8.1 2001/07/09 23:30:03 obrien Exp $$FreeBSD: src/lib/libc/yp/yplib.c,v 1.34.2.2 2002/02/15 00:46:53 des Exp $SuccessInternal ypbind errorDomain not boundSystem resource allocation failureUnknown ypbind error: #%d /var/yp/binding%s/%s.%dclnttcp_createYP: server for domain %s not responding, retrying clntudp_createfcntl: F_SETFDyp_match: clnt_callyp_first: clnt_callyp_next: clnt_callclnttcp_create failed yp_all: clnt_callyp_order: clnt_callyp_master: clnt_callyp_maplist: clnt_callRequest arguments badRPC failureCan't bind to server which serves this domainNo such map in server's domainNo such key in mapYP server errorLocal resource allocation failureNo more records in map databaseCan't communicate with portmapperCan't communicate with ypbindCan't communicate with ypservLocal domain name not setServer data base is badYP server version mismatch - server can't supply service.Access violationDatabase is busyYP unknown error %d $0<DLT\dlt|$FreeBSD: src/lib/libc/yp/xdryp.c,v 1.9.2.1 2002/02/15 00:46:53 des Exp $clntudp_create: out of memory H0l4Иܘș444,clnttcp_create: out of memory 4XlԠ%s: %s; errno = %s ; low version = %lu, high version = %lu ; why = %s (unknown authentication error - %d) ; s1 = %lu, s2 = %lu |(|U<`,RPC: Unknown protocolRPC: Failed (unspecified error)RPC: Program not registeredRPC: Port mapper failureRPC: Unknown hostRPC: Remote system errorRPC: Server can't decode argumentsRPC: Procedure unavailableRPC: Program/version mismatchRPC: Program unavailableRPC: Authentication errorRPC: Incompatible versions of RPCRPC: Timed outRPC: Unable to receiveRPC: Unable to sendRPC: Can't decode resultRPC: Can't encode argumentsRPC: SuccessRPC: (unknown error code)%s: %s - %s %s: %s $ pFailed (unspecified error)Invalid server verifierClient credential too weakServer rejected verifierInvalid client verifierServer rejected credentialInvalid client credentialAuthentication OKGMT/etc/localtime/usr/share/zoneinfo/mnposixrulesTZSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%.3s %.3s%3d %02d:%02d:%02d %d : 0808888888880888888888888088880888888888888888888888888888001234567890123456789abcdef0123456789ABCDEF[inet_ntoa error]$FreeBSD: src/lib/libc/string/strncpy.c,v 1.1.1.1.14.1 2001/07/09 23:30:07 obrien Exp $$FreeBSD: src/lib/libc/string/strerror.c,v 1.2.14.2 2001/12/20 06:31:26 wes Exp $Unknown error: 0123456789$FreeBSD: src/lib/libc/string/strdup.c,v 1.2.14.1 2001/07/09 23:30:06 obrien Exp $$FreeBSD: src/include/rpcsvc/yp.x,v 1.12 1999/08/27 23:45:12 peter Exp $xdr_reference: out of memory xdrrec_create: out of memory h@HPX`%u.%u.%u.%u%x$FreeBSD: src/lib/libc/string/strlcpy.c,v 1.2.4.1 2001/07/09 23:30:06 obrien Exp $xdr_bytes: out of memory xdr_string: out of memory ed(.LC_NUMERIC,,,,-,,--------LC_MONETARYCPOSIX/union/usr/bin:/bin:/usr/sbin:/sbin:' (''(( (,(((((((((($(,(%$sniglet^&TMPDIR/tmp%s/bt.XXXXXXXXXX0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzC!/dev/urandom$^^^^p^]^J^7^^S_F_9_,____8L8LL8 L $$mpool_new: page allocation overflow. InfNaN0123456789abcdef(null)0123456789ABCDEF0`ܮܮtܮܮܮܮܮܮܮܮDPPPPPPPPPܮܮܮܮܮܮܮܮܮܮdܮܮܮܮܮԢܮܮܮܮܮܮܮ,ܮܮܮܮܮܮܮܮܮܮܮܮkkܮܮܮxܮtܮ3ܮܮ׹׹׹׹P׹lHHDoHHHLoT\@Th|$FreeBSD: src/lib/libc/i386/gen/isinf.c,v 1.6 1999/08/27 23:59:21 peter Exp $@?5?55?5?InfinityNaN0?aCoc?`(?yPD?$@@@?4; error: warning: /etc/malloc.confMALLOC_OPTIONSunknown char in MALLOC_OPTIONS mmap(2) failed, check limits 4Ph$D\tjunk pointer, too low to make sense junk pointer, too high to make sense modified (page-) pointer modified (chunk-) pointer chunk is already free pointer to wrong page page is already free freelist is destroyed malloc() has never been called in malloc():recursive call out of memory in free(): in realloc():No address associated with nameUnknown server errorHost name lookup failureUnknown hostResolver Error 0 (no error): Resolver internal errorUnknown resolver error?res_send: %s ([%s].%s): %s res_send: %s: %s ;; res_send() kqueue;; Querying server (# %d) address = %s socket(vc)connect/vcwrite failedread failed;; response truncated ;; undersized: %d read(vc);; old answer (unexpected): socket(dg)connect(dg)sendsendtos out-of-boundskevent;; timeout recvfrom;; old answer: ;; not our server: ;; wrong query name: server rejected query: ;; truncated answer ;; got answer: P0 6'''6;; res options: %s;; ns_parserr: %s ;; %s SECTION: .;; %s, type = %s, class = %s ;; ns_sprintrr: %s ;; ns_initparse: %s ;; ->>HEADER<<- opcode: %s, status: %s, id: %d ; flags: qr aa tc rd ra ?? ad cd; %s: %d, %s: %dNONEANYHESIODHSCHAOSIN ADDITIONALAUTHORITYANSWERQUERYl_XUPDATEPREREQUISITEZONE@ 8 5 ) &                 `  I 5  /                   } t 5 p f b ^ [ G B           _ @ !,  "          #{ f ` "any"URN Naming AuthorityNAPTRmail agent (deprecated)MAILAmailbox-related data (deprecated)MAILBzone transferAXFRincremental zone transferIXFRATM address (unimplemented)ATMAserver selectionSRVNIMROD locator (unimplemented)NIMLOCendpoint identifier (unimplemented)EIDnext valid name (unimplemented)NXTlocationLOCIPv6 addressAAAAgeographical position (withdrawn)GPOSmapping informationPXkeyKEYsignatureSIGNSAP_PTRnsap addressNSAProuterRTISDN addressISDNX25 addressX25DCE or AFS serverAFSDBresponsible personRPtextTXTmail exchangerMXmailbox informationMINFOhost informationHINFOdomain name pointerPTRwell-known service (deprecated)WKSnullNULLmail renameMRmail group memberMGmailboxMBstart of authoritySOAcanonical nameCNAMEmail forwarder (deprecated)MFmail destination (deprecated)MDname serverNSaddressA%dinitdebugaaonly(unimpl)usevcprimry(unimpl)igntcrecursdefnamstyopndnsrchinsecure1insecure2noaliasesinet6no-tld-queryedns0?0x%lx?%u%ld.%.2ld788888888788887888788888888888887888888887888878887(848484848484848488484848488484848(848484848484848484848484848(848484848484848488484848488484848(8?; error: unknown LOC RR version%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %sm%04d%02d%02d%02d%02d%02dZONEREFZONEINIT131211109876UPDATENOTIFYCQUERYUCQUERYMIQUERYQUERYNOCHANGE14ZONEERRNOTAUTHNXRRSETYXRRSETYXDOMAINREFUSEDNOTIMPNXDOMAINSERVFAILFORMERRNOERRORADDITIONALPREREQUISITESZONE. @ %s %s ( %lu; serial ; refresh ; retry ; expiry ); minimum %u %u %u %u %u %u %u ( %d )0x%04x %u %u ( %s %d %lu %s %sunknown RR typeRR format error\#( ; %s %02x ; \BxBRRxBCxBxBxBR4LxBBK0GHK0G\HB0GIROMGRDIIQRR(KRI" "\\len <= *buflen/usr/src/lib/libc/../libc/net/ns_print.c ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=assertion "%s" failed: file "%s", line %d Weeeeaeeeeeoeeeeee}eeeeLe%d%crklkllkklkHASH: Out of overflow pages. Increase page size d<Hdtd@ޝ۝֝ѝ,̝ɝƝ\ -^3^0^-^(^"^^^^ ^^@]] ]@]]]]]]]a$a"aaaaa a aaaaasend account command to remote serverappend to a fileset ascii transfer typebeep when command completedset binary transfer typetoggle mget upper/lower case id mappingchange remote working directorychange remote working directory to parent directorychange file permissions of remote fileconnect to remote ftp servertoggle carriage return stripping on ascii getstoggle/set debugging modedelete remote filelist contents of remote directoryterminate ftp sessionexecute macrotoggle command line editingset file transfer formattoggle gate-ftp; specify host[:port] to change proxytoggle metacharacter expansion of local file namestoggle printing `#' marks; specify number to set sizeprint local help informationget (set) idle timer on remote sidechange local working directoryprint local working directorylist contents of remote directorydefine a macrodelete multiple fileslist contents of multiple remote directoriesget multiple filesmake directory on the remote machinelist contents of multiple remote directoriesset file transfer modeshow last modification time of remote filesend multiple filesget file if remote file is newer than local file nlist contents of remote directoryset templates for default file name mappingset translation table for default file name mappingview a remote file through your pagerenter passive transfer modetoggle use of PORT cmd for each data connectiontoggle preservation of modification time of retreived filestoggle transfer progress meterforce interactive prompting on multiple commandsissue command on alternate connectionprint working directory on remote machineterminate ftp session and exitsend arbitrary ftp commandreceive fileget file restarting at end of local fileget help from remote serverrename fileclear queued command repliesrestart file transfer at bytecounttoggle restriction of data port rangeremove directory on the remote machineshow status of remote machinetoggle store unique for local filessend one fileescape to the shellsend site specific command to remote server Try "rhelp site" or "site help" for more informationshow size of remote fileshow current statusset file transfer structuretoggle store unique on remote machineshow remote system typeset tenex file transfer typetoggle packet tracingset file transfer typeget (set) umask on remote sidesend new user informationtoggle verbose moderFrLvr>rr<rDr<r8Xr<rW{r=ritr+=r`WprDr~kr`=r hr=frnar=r̈[r>Xr4}Rr>r~Or`>r0Ir>rmBr>frp>r>;rr0r>r~+r?ri&rDr~!r"?rWr'>r rE;r_r@?rkr?rxm r?rir?rq @r~q+=r`Wq`@qoq Cfrq@r zq@;rrq@rq@qqqAqPtq-Aqr q CfrwqFCrTnqCrmeqDrhk^q DrkXq`DVqRqFr8XNqDryIqDr~CqDr{>qE;r_8q@E;r^1qE.qLr(qErd qEr,qFr,qiErD~ q@Ffr{qgFfrpFrpFr8XpCrDkpGr |pcGfr\p|GrepGrXpGrpGrpGrWpHrip1Hr\Up`Hr}pHrTxpHr kp?rT~wog `ݍٍǍc,`@< ˌŌ`A  Ӌ0/΋0/ˋ,Ƌ-8-X-`] X]A] 0˘0l1`/ E Lt/oi_/]@1`  •@2΋2 THmc@`oo?T8Td@9T0TooƝ3T`5TB >T:Tœ6T`4T>%ZX?ɯ[BYWįZ'deprecated command -- use 'toggle crmod' insteaddeprecated command -- use 'set escape' instead΋W]=E\p>""""ݻ׻ӻлͻɻƻûd_[ID=1,'" ݼҼte^RJE>8/& ͽǽӻлͻɻƻûĽ}yupk(standard output)/etc/gettytab\^:   }) 0/dev/ptyXXiy y y yP yt y y y y@ yx y y ?A؀GɀBbCcdEfnlZLMF?F:.i"nxhsZzqrevqaUuVHtw\  Ћ  Ћ  Ћ  Ћ Ȏ \  $FreeBSD: src/lib/msun/src/s_ilogb.c,v 1.6 1999/08/28 00:06:49 peter Exp $\]^7ba_`c8V9Mdefg:U;J<H=>LhW?O@NiAB CD  !"#$%E &'()*+,-./F 0123456789G :;<=>?@ABCH D E F GIJKjkLMKNIOP[lmcnoQRpqRSrZstuvwxSyz{|}~TPUQVTWDT  %%p%c%%{10}%%/%%{16}%%*%%p%c%%{10}%%m%%+@(#)history.c 8.1 (Berkeley) 6/4/93%b0 x  < ,  H D h      l 8    ,   h             $ @' ,# 4!  & # ' ' D" "  & ' # & (' & 0$ ! \   ē  ܘ    ,  ,  $   $ @  \  t М    `  |  Ԕ \ ܛ (  Ę ` vyF@yyGxxIxyxJ\xIxD xxEww8wxw9_wNw@ wwOvvPv|vS@vvTuu:uu?uu6udu7@uu<ut>ttUtZtXFt9tY%tt;ssZss=`sEsBsrArrRrrQlrVrM rqNqqCqlqH@q+qVqpWppK`pDpLpo'oo&`oDo5 o o,nn-npn%@nn)mm0m|m4@mm#ll.lal1Jl9l(ll3kk/ksk2@k!k$kj*jj+j}jhj^jDj0jjiii ii `iEi iihh hjh@hhhgggg_gDg6g"g gffffffwfhfRf?f! fe ee eeeme@e-ee edddd`dPd2ddccc\cKc>c+c ccz1 ' ""   !,-5/"""""""""""""""""""""""""""""""$""""""""""""""""""""""""#&"0"""""."""""4"%""""""""#&"0""""".""""""4"%"""""""B=   !A;""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" "" """   !"A""""/""" """ """"""L"RZK"""Q"7I: UH""@""NG"PTWY"D"""" ""6J9<>C"? "M"F"OSVX"E"""""8""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""bt; b ~ x|) bD{ bT| b, ? fwdbck:jWTGD41߀܀΀ˀxuifUR@=.+}gdVSC@2/" ~~~~~~~~~~|~y~h~Ӂpm[1~[4~OAOBOCODko(!@ (@!@ a(@!  = =,A"'B" """"܇Շ·LJ @ }w pi@c[TNG@ :@3( @܆@Ԇ ͆Ɔ ~ y@rlg`[ U@ME?84/@(#)tokenizer.c 8.1 (Berkeley) 6/4/93O4щve@҈E:9.!9`@` `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`??@$FreeBSD: src/lib/libc/stdio/asprintf.c,v 1.6 1999/08/28 00:00:55 peter Exp $qWL1$ ۰İtiP E1 '   ݯϯ įmb@"ݱױѱ˱ű   ִҴδʴƴ´       x u e b_[WSOKGC?;840,)%" !"#ܳ$ϳ%ų&'()*+~,w-j-c.Y.S/K/F0B1>28334.5*6$789: ;<=ܲ>β?@[\\}]r^`^U_L_?`4{!{|}}~/dev/3)"ݻӻ̻»L@(#)getbsize.c 8.1 (Berkeley) 6/4/93ID:0'  $OpenBSD: dirname.c,v 1.4 1999/05/30 17:10:30 espie Exp $dd@ddewCCCCCCC  L<K @?B@   XxDl(0@(#)localtime.c 7.57WILDABBRQQ@(#)asctime.c 7.7$FreeBSD: src/lib/libc/net/ns_netint.c,v 1.2 1999/08/28 00:00:14 peter Exp $$FreeBSD: src/lib/libc/net/ns_name.c,v 1.2 1999/08/28 00:00:14 peter Exp $0123456789X$|8lH0H0HRuneMagiNONEXBBBBB@(((((((((((((((          (((((((    ((((((    ((((  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~C^ 0000000000000000}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMD7yACnF?O8M20HwZ