IPL1 1fffQRfB@f  1Ҵfff0fff%f&$ZfYˁtu1ɠ$<0t6<t%< t< t & G 1҉)׉։>6f[fXRead error No bootable partition PUWEVfd1440?-?@ WEVN @ @  f)Ȏ؎ffggggggffgffI,)( RUVSu1] tPPC~jjx|t p5h1 t)Ë` uuA9|hhh =Ht3hhhDh }Y[t HHhu PpaP54hPD$u*R+u2R5|5xhh;XD%0Dth-uFj .=HGt65HhXZ$hDh-밃5UWVS$Ej PqMэvL tDt<Ȇ%=t'=t = t=thae[^_= t=tf  u1‹}Wp5HaP54hPh hmuhuW. uXZt FuuhuV uuh |ut )؉jEVP5'ujSh?uV ]jSu jVSEЃPjh,EЃuVm l  á ápH ÍuУDh5@HpTu)BAuIBAuhh'h)<hhh'WVh9-h@DS PWUVS] uEHuVS De[^ UVSUu < t< u B< t< t<-Btq< t< t=t28uF8At:u:B< w ƒ0C<,u C;B<w ƒapCtC<)u;Vwddkfdwtdaboot.config/boot/loaderboot.config: %skernel*specify_a_kernel_name*/dualserialinternal >> FreeBSD BOOT @ 0x%x: %d/%d k of memory, %s%s console Boot default: %d:%s(%d,%c)%s %s boot: Can't find %s Invalid format! Booting %d:%s(%d,%c)%s @ 0x%x Start address too low text=0x%x data=0x%x bss=0x%x symbols=[+0x%x+0x%x+0x%x+0x%x+0x%x] total=0x%x entry point=0x%x No keyboard found Keyboard found bad disklabel Error: D:0x%x C:%d H:%d S:%d %s Unknown device @O7|/-\ 08@\>@ <   \>2VJ@  $( /mnt $( \>@ @@@<@T 08@\>@ <   \>2VJ@  [> [>\>@ @@@<@TU \> #H S,8\>A\>\>\>H|p%A[>[>\>Ai7A[>[>\>B&_pA[>[>\>Ct[A[>[>\>DRF!A[>[>\>Egc3A[>[>\>F1A[>[>\>G?< A[>[>\>IT)[>[>\>J| # ... ... ... ... ... ... ... . .. dev!stand binsbin# etc mntmnt1mnt2mnt3 mnt4 tmp( usr @.profile ...: # $FreeBSD: src/release/fixit.profile,v 1.9 2001/10/29 16:13:29 brian Exp $ export BLOCKSIZE=K export PS1="Fixit# " export EDITOR="/mnt2/stand/vi" export PAGER="/mnt2/stand/more" export SCSI_MODES="/mnt2/usr/share/misc/scsi_modes" # the root MFS doesn't have /dev/nrsa0, pick a better default for mt(1) export TAPE=/mnt2/dev/nrsa0 alias ls="ls -F" alias ll="ls -l" alias m="more -e" echo '+---------------------------------------------------------------+' echo '| You are now running from FreeBSD "fixit" media. |' echo '| ------------------------------------------------------------- |' echo "| When you're finished with this shell, please type exit. |" echo '| The fixit media is mounted as /mnt2. |' echo '| |' echo '| You might want to symlink /mnt/etc/*pwd.db and /mnt/etc/group |' echo '| to /etc after mounting a root filesystem from your disk. |' echo '| tar(1) will not restore all permissions correctly otherwise! |' echo '| |' echo '| Note: you might use the arrow keys to browse through the |' echo '| command history of this shell. |' echo '+---------------------------------------------------------------+' echo echo 'Good Luck!' echo # Make the arrow keys work; everybody will love this. set -o emacs 2>/dev/null cd / 2uje[^_þ;u}ڃ=Сtу=D=uF;u}=Сu몋E 40_Zt܃=E =@E 1;twQRE =4tZPN=u=\xhкhպD_ZtB뤃=u{R(YcE 4"'[C1}Ĺ ]SjhE 4|u}uE 4h Sթ }ԅt,t&=Сt=u#tt =СuEP葩X|PE 0\Y[t̃==@19tsPR=7tZP=u=\thкhպZYt>뤃=uRe'[n7%ZRhE PEP E 0h5d5 2Uhju u4US ùuzyQju u]UWVSh}EEEtH}q}~)E 0h`5d艸 1e[^_ËE xpƅXt׃}t'= ==@}t5=Lu5dj/jh 덍EPS>Z}YtttNuE 1;xt:RuWSh蔕V E2;XujE pZYt9E|EɅxEċUȣvSh~ [_S4%XS#XV!XhźE PEP xmhE PEP VAU BEBEUj=\Xtjh5dŶ $ jh|nU=VSt =\ue[^5|hպ5fZYt5뵉5UWVShE~HZU |E2&u=LEhI5jgjh|Emj5Tu ' >o=Сb=tVE 0hZYt=+==@}19jPס ǹuzyQVSh荒="=\h-hպ^_t=cYEPSY_uEċUȣ'Sh9y{ XZS!XSS XVX\uje[^_,65dj/jh虲 h2E PEPR E 0h?5du UWVSQQEEu t$6hW5dA e[^_hve DžXZtr )EuEzyjh,jjW t$;u S [؉^ujVu}e[^_t vhlOU}tQø4U}VSС@5tRh5dD =Tp5@<8uP5x$h5d 5`Z$5L$h 5dԱ $hhh h`h`5d譱 5D$5$5$5<$h5de 05ȡ$5$h5d6 5$$h 5d 5ijr$5d$h5d ,=h,hhλ5d° =@hhh5d蘰 5 $5P5$h`5dc 55H5H$h5d9 (545D5D$h5d 55`h 5d $5G$h5dϯ =0`P58$h5d螯 5$h5d耯 (h2h<hE5dc =(~F5djjhU11 ;5(}%ShF5dF  ;5(|e[^ø95dj jh^ҭ E5dj jhj蹭 j=С^t&5h5d蝮 j[Y5djjhxi 5djjhP E 0ha5dF 0UEWVSu] }t|t3h5d e[^_hQsV ZYu,t6?$Wh5dƭ h4sU ZYu1>Uhhu uIUhȼhu u*Uhռhu uUES] t!3h5d ]hQsU YZ54$h5d輬 =u45djjh{2茫 t  |5Ph5df h4shT YZues-Z~ PDsh@1=+Uhh<u uUhhu uUh3h u ux= t Uh@hu uCUVS]ۋu t~#6h5dM e[^Ãhvh A < A =t><t8u05dj6jh轩 n5@<8uP5$h5d} vL @YDhQvlR ZYuKh4vJR ZY%1=UhQhDu uUhZh$u uUES] t~!3h5d褩 ]Ãtd1==tA 55$hv5dK 1=뛃%hQs3Q YZu h4sQ YZulsZVshUEHtqE ph5rYZttX=u܃=<uE phqYZ5dj)jh@7 hE PEP rE 0hý5d jUVSUM t1h߽5dƧ e[^qÅXtS^xLhV ZYt&Vh5d} S2 Shn Y^Sh AbUEt3.HtE phphE PEP uՋE 0h'5d UWVSQE HE hI5j|njh|E^jju 2 ;to=tSE 0_ZtSho[=^u=\th>hպ@ZYtsduje[^_;>h2E PEPw E 0hF5d蚥 UEtHts}~R}~!E 0h`5d` ËE ph}nYZuE phnXZhE PEP thE PEP toUWVS EEE EEEEEE;pE؍4#u=HE}tj}E蟾u+E؍48E誾tE课}~ E@E}~ E@E}E Etf}~`}u}tHE0h5d }t}tEEe[^_ e[^_ËE0h붃}u_ut.E8|t&PE^tPh;Y[tEjjhzyuuuih虼_t8u1ӍCPE|SVE@P E5dj,jhۡ E-UWVSEH}U EPUU@ֿt9M9|t1QEZtPh;^_ue[^_ËE ޿hI5(j‰E|jh|EZ=ttEH9}l=Сtczyt|mjjPE 4}u踯uPf=u =\uKG=tEH9} =Сuuj2XZU9Uu XE 0hպ5OY[t5xhźE PEP 7E 0h5dנ nh2E PEP} tUWVS}u'E 0h5d茠 e[^_jj7ÅXZtE~PbY9ZuVj ^C_t hg Y뛻SC9X~jjh j/SZ Y^t@hPV趣 =t5dSΞ 5dj ɤ O~j5h$VS7 jVS) Shg j {'bUWSPE1ۅtHcEv&E 0h@5d e[_ËE ph/hZYtJt5djjh7ĝ Džu}tС묋E p hF9hY[ۃ}E phNhY_u}Q5dj jhVX 5dy 5jO]SP t61D E X EE p hFg_Z"5djjh 5h`urU BEX9hkE PEP} U}S<u$E 0ha5d蓝 ]hu<gZt<ف=u5dj)jh2 htfUS}u$E 0ha5d ]hSfZYt Shy5dל hRd YUEt|wHt[E ph!fYZtÁ=u=<uE pheXZ5dj)jh9 hE PEP uE 0h5d UEt|wHt[E phƿzeZYtÁ=u=<uE phſLeYX5dj)jh 蒚 hE PEPH uE 0h5do UEt.Htu uhhͿE PEP uՋE 0h5d UEt.Htu uh<hE PEP uՋE 0h5d轚 UWVShu} Pu 9|+PhdH^_te[^_j[eH[thE4Vx G 9|C9|hhsVW UEtHt]}~<}~!E 0h5d ËE pph6_chE PEPv thE PEP[ tUESU <t4H<trhGbXZ<]hUbY2h`5d; UUBSM <w4J<tqhsbXZ<]hxbY1h5dј UESU <t4H<trh)bXZ<]hbY2ha5dk U}E u"t0ha5d= Ã=Сt jj%XZjq=СYt jj XZj: U}E u"t0ha5dؗ Ã=СthKaY鵼UUҋE t~0h5d莗 ÃthlZE EF`@Uj=TXuj蝐Y1=Сj脐jh|]OUWVSSEzHVE p貪E@Y,}Ex u&5djjh跕 e[^_jh|N_ZuhTj]jM y t =Сt{h^hY^~&1)QPhg ME PPEHPQXZ1=СjfSjA5djjhڔ j>Sj5djjh5djjhhE PEPY E 0h5d| Uh$hu u(UWVSu1ۀ>t;3Ё B4D4%t1C<3tvŅƃ BtW1ۀ= BtL BwS4D4%t! Bw)44 BC Bue[^ B_Re ^R6 _R- ZYUh1hiju u,UVS]ۋu t~#6h`5d6 e[^ÃtAjv@h tjvh,֗ ,5dj jhK豒 UWV1=,S FtF,t~M9t511Ҁ=t8t+Bt~uCA9u[^ F_9}ۊ,CUESt}~$E 0hX5d ]j 5@^ Ã=TXZtC; tj S= YXh5hy C; thSh` hrE PEP F;5dj jhy@" @3UWVSM11DŽd@~tLE8t@=t7ƒ$\:t1t9tA;tC9t;uɅu9t DŽd= J Jt'1[[$t'AC;u= Ju Ee[^_ø JC=wYtC<0t(pσdtT;TtBA;Tu됋U:tBA:ux1뱃\h{aCVC$#t4,t/]t*\$tCAt<,t<]uր;tCKuC,t]KCt<]t;\t-Ct<]u;5djjh {tCC=wl_C<0t3pσdLT;T>BA;Tu-U:!BA:u1CC=wfC<0t4pσdT;Tt BA;TuU:tBA:u1C8<{00CC8t!pdLAt8CuLCUES] t!3h5d蠎 ]hQs6 YZuL`5`$5$h 5d> h4s96 YZu h4rs6 YZJ`y1=`^U=<t'Ph8u uo01Uhhu uBUhhȡu u#UWVS ]u Q}>hNvEE!5 _ZS4EjjjjEtP}uEH}t =<t-55H5H$h5dq tP}uED4}t =<t-545D5D$h5d ujVj1e[^_v Y }t6h5dҋ 6hvEZh)v3 ZYhv3 Y_ut u5djjhM RPh`5dF j EPsу ɉxE8tsh5d 뉉 x5dj/jhֈ HU}S<u$E 0ha5d載 ]h,<+S<UEVSt=(}HT}~&E 0h15dV e[^Ã=j E pk(P ( `k`t"s¾< Ft=CF`u裾 u&@t 薾 u5dj(jh蕇 J@(k;t&>tF먉@(5dj!jhk@65dj;jh  hGE PEPȲ 5dj.jh`=UEVSt}xHt\jE p袶։ÃXZt=VSE phR5d裇 ~ e[^Åxw1uhE PEP" uE 0h'5dI UQEtsnHtRjE p1EY@Zt-EPt $L $E ph[5d 1}hE PEP胱 uE 0h'5d誆 UEU t#HtBE Ea PEiP2hn5d\ UShzyj] Su\u]ssh5d UWVSWWEHE pIE^h"E[t8uEы}1ˋ}Ӎ4 VVuPw VhsS跉 VuS證 (S负S$ u e[^_hźE PEP 4E 0h5d UWVSQQEHh3EZt8uEU1ӍCP|Suƍ@P苈 jj<hEE pV=h< b(=}V=< e[^_hE PEPĮ E 0h'5d U}VSu t#6h5d軃 e[^h6+ [ZukvZtt?t`t55`h 5dN 6h5d0 [h60+ ZYzh6+ Y[*ZUEVSu tt6h5d贂 e[^v躛ÅXtPCu9vC=<Yu P3h5dc P CXvh녃=tCuP3j h&5d ;uU}VSu t6h/5dށ e[^vÅXt5Cu3hA5d证 Pe CXvhU}S<t>=@u5dj,jhL ]hR<J<ߋE 0ha5d& UUBSM <wS=Ht4J<tqhWqJXZ<]h=ZJY5dj,jh  1h5d蝀 UMASU <w]=@t><trrh_I <]rhjIXZ5dj,jh` 2hr5d 붐UE E EE铥 UWVS1҈Ћ}эqMIɉ#} M ljэYDž9sm<1I9Ήs-<:8 u1BI9r9s9r9w65dj h ljMq1Ԑ ue[^_)SPhSS5@D@뿋M0>uЉىIQVhSfS5~@DnUWVSP)ƃ1}I=M𻠖t1I9MvN;uVu u <tjVre[^_hs56~@ZYuֿuRu6X u3V_XUWVStj/]S8 ZY>9)@PSP ~P+ X1I ÅXtIst#stC9踥 ÅXu膚 u w<tj`qe[^_hPS hhuSG h0S2 $PS&[_xfsff%f=@t%P5E|@ZY[Qƅ/S,V SP V踩ÅXhSV# S ƅ/ƅƅ.ƅUWVSPƃ1}I=Mt1I9MvN;uVu u <tjVoe[^_hs5 {@[ZuֿuRu U u3VyY_UWVS j/}WDžNDž45 ƅXZ>/)CPWP} F =Xu = N N NDžPjPD tD=tـ;t*j/S4 Y_t@PP5 N 뮉랋tPh?5d,y e[^_hPh@N| X 1ҡ N;PDžsH1҉I߃I9v< N;Pru VjmFIQSVS uSnXZjPXmXZnh@NPԝ Y[A9 K;/9wƅUWVSWu}Ë@+=^v e[^_@P3h{ C+W$ Wȋ$ wW;Ec;.$=ƀ@Rȳ0ڊ[P 1эY9v-~)T4D4%t9ڹV RB/$0uh@Rcuh@Ruh@RaЃ=Сt5dj jh/u luh@RṘ YE$@Pȳ4h@Ry W9PȳuPh@RsP fElRhj< UWVSEDžDžu } }HY1;(Dž }1j SE pO t ;(|ԋ ;(hh$Px k ; 4D4%@tC܀;t% $\oF;tC;uLjȳ03ǃX. t =С=<ȳR5WY=^tuph$Phw DEȳE k 9t C9t;Ee[^_5djx XZ|5dhr 5dj x 15djjhSr a5djjh5djjhCS=1uYiYC;UDžB)PE 4Vv E <1эt C =wKt k |ՋEK9)PE tVDv E |11>R ZmE ph5d"r [hGE PEP辜 E 0h뽐UWVS]E }SDžDž=YhsPAhjhP^ ehs臉jhP* 1j"P YZ+XSSPt }hWPt U҉A1߃ʋэ4 V}VSPst Vht Vt (}1׉1)SU SPt ShsM 1At } PV 11(t 虐 Yt 脐 Zt o Xe[^_Ë1I'h`D[h5dRo 5dcw 5hW! t1Ƅ C5_Shw7 XZ Sh25dn AUWVS} 19uMsk33D30 AT3D3< AD3?AA9rK9v IK9=w[^_UWVSSSEt8tljƊ%tFG>ue[^_ÊNt=5tŊVt=t҉}GU1с4D4%tzÊV=w^uCҁw/4D4%MTuETɈЋMR~ ZъUD1R~ Yfl1111UWVSPP}E} ;}1}'}}}  }$}(EUEU E(EUEU$fjhLuE EUEE$hfPUU:u 1e[^_j/uG ƅXZ+]CS胷SuP{o E8VǷU($@W ^XtDE8NUC:P萷j:E0 t@PoUY?[j:W ^XtCUۉ:tjSyZYU$f]}tuU _E(8=U(uU$PffuRU uPUuPUuPUuPh 5d@j qhu{U(^iuu ShT2 UutUuYUu>U u#U(uP蜊 E(YP芊 E [Px E^Pf E_PT EXwj]_S ƅXZt Ft<:tuu Wh`7)PÍGPWeU ;WCt~:t1 ^uu WhFqu6mjhqu u%EUEE$fjhxu uEUEuu h0 ShjF/ UWVSDž$P"PPPPDžDžDžxDž|DžDžDžDžDžDžDžDžDžDžDžDžDž$DžDžDžP Phuu$@tO $t 8k u =Kuh[/ _X|@t PÎXt x}Y5$ujuSu<u%ue[^_藆 X艆 X{ Xm XPd DžZPQ DžYc6 [DP* Dž$^!P Dž_P DžXP DžXP҅ DžX跅 XrxXS|蘑 ,Pj ZYPjj[^$߰PIXZuj/ ^_%@P訰[t 8u* t uh@JufX===ġDžDžDžDžDžDžDžtJt5:|t*XPR衆ZYu } } t E 81}Թ8E؍PURjEEE  BtDžSfjjjhVss.M =<t;tVh5dMb Sf"fBs js  JssP螭 y5Ph) PDž [+Y _hPQ [=<|^1=<$h|Qa =H{h2h<h|'a }t#=<,uh|` }t#=<uh|` =<t|jjh=_ |h @sjhAjP|ltD8< < =j _Xj PCSRo Nj t%Ёm4D4%@S#[,jhAjP|ktD< < =jh2 bjh jjh+ j h; _jhF jhZ tpjho u3Sƪ=XSh5dT^  X뿋u"Ss=XPSh~ XЋhES ZYtKhS ZYu/=5djjh\ ShSh & [^ Sé=^Sh(VhS4 u*VhS! uVh S IDžH8t3=- P6P $h6j(PV X븋y*j VS< i8-Zj VXS 29 9 8/x*Xj PS蘄 8=u$ h$ t5djjhIlZ tOh[5dH[ he5d)[ mu5dj*Z XZhlȃj PSqу ɉ£ ġx8u=QRh5dZ h5dfZ ` /,t@t#th0hl xjh}ZYh.jqh!jeW9v#WOPWTW_Pjءܡό^Džt8=HHuW1t/t9։dh|;h9v dh19|Wlp|9v lplj5WV xQ1jءܡ5W)1W ; =tp= ugܡ;ء |F;r>5dj#] PXZܡ;ء|;s5d_ _t)tt~x =HKt>tD|5W5W t&5W=~=tO= uFܡۋ ءx69P9|9s5dj#[ _X5dj [ [^|W Yth4 j*x^ XZtEܡҡءx ~+j茒XءܡDždv΃tj(Szx0Dž4ʂ SDžxy@cPC $Q $h@5dU 4hjPz++Y҉[x!@B+PXH@Bh 9AxjPlyY[|5W5Wr jP5Wc t 8 tX=u9=utS]tRPh5dVT h@@x thPt X:|98 9* ġ9tuh  9uh|m? x[x^tDžZhfxGhzy럃ġ tF9ӡ|9=<]5dj jh(Q Auqjj .hzyCS(xtDžL gSh6 h`t 8u hgWBW1t4=<uhE5dQ Ճ=<u"uuu;hW5dmQ ht%1#h(5dQ t :u h`];t[5dj#jh@O 5j (PR (wz44y11PRSuuu u31IVPp RP! _5]p DžXH?D< t< t.hjSp YR+a ^h5dcO HD< t< thv5djjh!M >Wh5dN F Wh5dN %FF |jjhM iWh5dN %F$h|eN j: 8菚PJZYSh|N Sn f"fPtPh|M |jjh=L |j jhL |jjhL у u!=HQ|jjh&5dWL 55h@|VM 55hU5d:M %FF(j%S ZYhh|L uhq5dL ThhV XhhV\P 5Px $hhDže^t 8OP"PPPPPPhu k$@Aw1t'8t">t{utlu hS [^u@u#Pql Dž~P\l DžZPIl DžYyYu\$u3uk$XPk DžXPk Dž$XPk DžXPk DžXej%> _Z@hPז1эq[h.PA_Xt;tj:Sf …XYt0j PBPmY ‹ 8u"9u1эQ9rRS)P rDžu_ EPqj Dž[΅tHbhbE _OhhU ^|_uh#XP|GI $OlY[u#xġ ub=<h5dH ׃ u5dj MH XZRPh5dH jRP|H $@t yh ?h%5dGH 6 8h;P& Y[uhUSpj;jdhE]SK PS5dG $pjh}UWVSLjhquVDžDžDžDžDžDžDžF 1 vPPPPPPPhVX$@t1t:t"t8tt 8Vh[O ^_ueuHu+ue[^_PYg Dž^PFg Dž_P3g DžXP g DžXRXZt 8J8At >k1H=ty+PPuPuPuPuPuPh5dmE $=DDžDžt -=С:r EԋE؋EtEEEPR  OeXС ZHrUWEPj@Y[1ۃ=t)ۉPPhl5dMD t>t5EPjE)uEXIX=XZ6ۉrt?uDžE)}Eu tQEPjE-wXZdљDž=t2=EEt EPj멍EPjj/W=Y^t @붉=hVSF hhuSG hWSG ߃$>=5hjh`A 1j/V ÅXZtCV.YEPj@i lhOjj Y[t>u5?hW ZYDžhV [ZtDž뮸WYYj/V_9Xtt {xou{u[j;PhYXhSI YZuDžhS& YZthS _Zuhq [VSh_ VDžj@PM t)CPیYj: ÅXZICP诌X1h j4 US]jhS hS+ ZYu.5dhjh`> 5dj ? 1]hS ZYu5djxjhhS ZYu5dhjhhS ZYu'hh2h<h5dl? mSh 5dS? TjhLS* tjhxS ujjjS*h\XYt8u ]]6jhqS uUWVSQQjhE_Zt"=Сu E@e[^_jj裦[^hjShj GE1ۃ;E|=Сtt jjc^_j:U E4۶ ZYt̓=Wu EM 4XEt%ƸtE8|t ~EXE@ۉEUE;EfDUWVS U Eк=EEEEEu載1ۉEԉEƉǃъT/YtE:t@}}V] SSuPEA ShuuEA =t#EuPuh@5d< EPjuE] }x"Eu E؍e[^_Po] E[}t5M 9u ENjU EEPu~E M ^9_uӋU EEPjg}XZj/uEVÅXZtCPvEYCE j:u'^_tCSIE/uh[g uh5d; SUWVSL1ЁuDžDžXy@}}Թju 8E؍P]SjVEEEvg xhph W?  W>xYQfBq jq_ pp, y h_8tօtGzPDž~bDžXIɉ@PpѿЁ󤋕BЁe ЁPh@}Dž`Z=с@}hEd hzy0d =tuNh ^u1u]a1e[^_Pe ZPe Yƃ=<uYj[jPhhDž]x뚃=thFN X5h5d8 jPjjDž]h _h#Xhc jjjhSrr" uSh/XZzhhMcS; DžvjjjhSrrR" uSh5d7 hhMcSZ; hV?Pb $hUS\jx{=\Xu @=u+[]jh5d7 $6_ jh`US[j{=\Xu @=u+[]jh5d6 $^ jh`UWV=S=uh1e[^_hj] Su5޳ 5jjh=4 $5> jhu[ PXZt tjXVje\5djjhEt4 K}8] tQQ}u+5dj jhW.4 5dj R: Y[Su5d 5dj jhaUWVS hjDžDžDžDž`}thGjbDž1Džjjh0 5d9 Yjw~jj~e[^_5dj@jh5djFjh`j.~j!~15\ ÁX95\ Phhho51 59 y5\ Ph빡<p5dj 5 5d8  B~=ut';tu1t jutj|j|=tht\ttt j_tGtt j^0jmUX뚍PX hPhS3 G@5=4jUWVS}1ۅutW-/ EfEX} tu / DfDXCiVSEPQ ~-11ۅtfEл} tfDfte[^_USpjrXrtIsuMjdhvEPA2 jdh]Sz2 PS5dM. $}Vjhajdh|5hjUWVSPE=< UDždءܡġPtD}t>} tU :-tRh5dy- }tuh5d]- =T 9,t jPl_XjhDž`Dž\DžXDžTzy[^=\XxPTZ`t huSduܡۋ ء~3P9|9s5dj#+, XZ5dj , ^_…K5 X5$XhDžl& $O p]ءܡ$XpSd~& $N l~)pÃpȃl=V= t =ġ@ܡEU9Ӌ ء|K9rG5dj# + PËEUډEU[EܡU9^ ء|9s5d- YhMQ p@Yp t#dp* ء[ܡ^뻃=tg= t =ġyUܡEU9Ӌ ء|=9r95dj#7* 5d$- PËEUډE Ud4% Zu"dj ) ء_ܡX;=t= tC=ġx:h$ ^ud$ Zu hY[֋ܡEU9Ӌ ء|9s5dj#[) XZ5dj L) _XPD _\jp_=Dž\XxP L^du"jءܡYdnP Džd[uhY[u h^_jLHh RE 8|hu . _hZuu h띍EPhDž`# $F[^x Ef%f=t%u h5d" EċUȣġjj _o] hCSXht Dž`L Sh1uu uUWVSE PPE $U E,DžLDžHءܡġ0uEEt^=<tU}tOPt*}u P8-tPh5d[! }tuh5d?! =Tt Eb1҃=ijDžDDž@Dž<u EtjhUZY=@<xPHXDt LuJHu30, $ءܡe[^_HM XLDXF[^ =ȡ Ej =,t jj@^XZ jhC_Z0 Et  }t E8 uh[^H2hjHY } Pf L $EPL $A@ZYt!Ef%f=t $(X9v#,XP(Xj,X_jQ,^l`Et =HVjhPFBBHYDž4[19ס(X|9vQ5,XH $E 8a85,XءܡL)O $E8 9Љ4=t= =ġNx Aj`PNAd+l`+h[҉X\^x!X@B+\PYHX@B\ʋܡEU9Ӌ ء|K9rG5dj#m! PËEUډEUXZܡEU9Ӌ ء|9s5d $ X =t= =ġ8894}4Ph#^_j0OD[?HMH jDžHnXEZ ܡɋءExj\WX=$`DPjuKT^@_7jpSh?STPxDž|~>@TP $ $Ph@5d REEPh5di 5dj)jhE LDDžLYPhy>8 t hYءܡ ܡۋ ء~3P9|9s5dj# _X5dj  [^…a>5(X5,XHDž4n $A 8?85,XLءܡ1 $aA8 9Љ4=k= t =ġUܡEU9Ӌ ء|K9rG5dj# PËEUډEUXZܡEU9Ӌ ء|9s5d XjRPLl $D \Ph[^gEt HC 8@Y.8 8 =tg= t =ġyUܡEU9Ӌ ء|=9r95dj# 5d PËEUډE U됃ءHܡC 8Y)L ZukLj I _8Xt@88 %L8 ء[ܡ^ءܡ=t= t]=ġxTH [uL ZRb;8 t hYءܡ뼋ܡEU9Ӌ ء|9s5dj#S XZ5dj D ^_mEE@EjjjLt 1ۋ119Ӿ|=9s9LrA Zk t@9ӡ|9rjjjL ^&P!6 XP9|uP. _LZtDžDPh[^jhY[t9ܡء~ jP^hwjxaX=ZH<_jj RaPhzyCS<Lt# $DžDL Sh)PuhA 'RPh H9,t jPR^_juBY=ġ[@ePPY"j/Pm88ZYt)a88 tPh(t;Pjut ۋPtlP9_ۉ4Xt/4x=ȡt =ȡ78 |678 uhPt:[^yUuPu3gUWVS1ۀ=A}Dž@Dž` =@}jjP17 £s5k޿=  ȉי\PXPEPEPEPURhh`}h A1UE E E fXf\ ІfPh5\ yy58t׃=`t%59XRh][58@[t e[^_À=t1j`Pjj5Dž`5yh ^5dj5jh+ k^5dj&jh@5dj,jhʼn޿  ȉי|\PXVTPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPURPPLPhh`}\LPT11DBvfXfV\PXPTPEPEPEPURPPLPhh`}], 6LbPUTCx5dj&jh޿\  ȉיDžXKP\PJPIPHPhh`}u;H:Iu-:Ju%:KuЁ󥋅\X5dj jh6k5dj&jh@=`Q5djjhS=СX{  ȉי1DžD󫍅DPh51 jD5}VZY=[ƒ0St'tF=Сu"=uDž@q1PPjPPPPPPPPPPPPPPPPjjhƃXPPPPPPhKƃ1ۍdCej j PhWdPdPNPWShbN=С L=0 5dj$jhf Dž|U=8=0@hr_lh#Bj`Pjh5,h6t^hhyhP=)fH}f%f=t f=h UVS(@}=uEu4EPEP5$. xV5d/}ZtV51 e[^jEPjjSE+yh Xh{5/1US+j K@+]UWVShNjLS[}E^z=T<aE@XTСUС"CE Ёu Ё󥍻@}u졠@}U쉃<<@@DD,HH,LLPPȡTTȡXX\\jh`P Ej`Ph jh,qP $EjqPh, @M싁hh@Py EhPha $hhPH EhPh0 ujQ ue[^_jUYhPCP =Ttƻ@XEaTUjH=\Xtjh5d $+ jh`»UWVS uEE8Eu=ȡEu==9,t jSAY^hZt5dj5jh` e[^_j"=С_H9,t jSA[^h`}h*ZYt jjh`|^_hCj,OYEѡ [t RPh t ujNuuhA HujjgE@EXZ RPht jhʹ^_hwjzNuY8[t =Tuu =Tu=u EE=+1=TP=Xu E=1=TPV=^u==Tu*j<=Xt ujMjXj j5u ~jjXZ뛅x=t jL&Yh[j_Du uhA Hj=X:j_jXu uhA HjAX~ju uhA^ Hjj jujcLjuu h5dv 5djjhM jq1U}SE u%t!0ha5d ]Å~jj5 xujXh*Vj$XZUWVSWWj/}W趹YEE1^t9jut ۉP%ƅXZt/hWhk2 ƀk.ku8E}dtUEC<9tBEjhk$Y_x }0tKtȸke[^_ÊC<.t@CC1E05dj&jh 1WhE︂6USpjAjdh]Ss PS5d $%jI# jh蜵UVSҋuu,h =Xt j"e[^jjPRƅƅƅ $ t hlXhh5 5 j V5y~[tu/jZt j_=(ujiXhPVn $$ 뮅x=t j"YhXUWVS]{t[^_Ã{uSzuz u9BuEEEEEBEfBCuEfECUWVSPU 2EUEhh@$$ ÅXZ @hD `$< ءܡPHD480EE8`" ÅXt/hSh` =vj?~ $Shjjj  uVhhhPE d Vh`hhSE0 S!=X =`VEhȳ" ԡ_u ԡh! ^t)hP ZY'`% ƿ `h! <Zt8u <=t<8uh`_hJ! ^tƿ18u5R $ \Pd5 $ ZYt4<u&=\t '+t  h$uu7 \4B$H88`h5dh`[ =vj? $5dhGj9d_P5dE@fCEXhEPÅXZt&;u5dhCeY_\F~jEPVui @tu X<  HzDk\ M5d5.d`j EP5d 4E8~5dEAE<~jjj5d HUhZ)EUTij 0E_ t8t P/A X1t PsX= uFt8t P@ X6@0E_=`ue t\hPh`Y =whhih` =v$j? $5 hq諼` = uhu[@ ^1}QM?uuP uhS Sh $hI (hh $h* hhp $h hhT $h $hh5 $h hh $h hh $h $S j~6h.j?h.j?h/j? h/j?h/j?}~L}tuuuPj:E0&k Y[t^U2=ZuOuu薳^_yȃ}t5 6jhPhj ?hj >jh"Y[tjU hj>hj >E0j@Vj 1tp EĉuȋUBEE t EPE@PX=С ZtW4t?=Сu)Ph5d(Z 54=С{4tjWV )PӈƅXHt  ƿ *hS ^_uhSØ ZYuh4rS裘 ^_u`ShY[q`  hjh@h@5dhjU=ot'ouPhhom7ohYt ohj蝶U=st'suPhhs7shZt shjEUWVS =@=\5hh轡 u=\jjV_X1эAEA Ec=(=eȳ0\[x t =СtnȳR5V_=Xt~u-~hj:hj :e[^_5dj: Y[5djjh j:ȳ0zf ZYu#ȳ055\% q5djjh5djjh5djjh8w W# E0@u( ƀ5dj n XZ:5d3PN 8[^u5d7 YPh5d ٍEP5+Y^t}u=\utjjgT^_MIM< tQw-Sj ƀEP55djjh8\ !u5dj r XZxUWVSQQ}1tS1EEt+B8t:9u);E~$E]uՃNE_Z[^_;EuF߀9t AB8t뷉UȳWS@( qP5ȳ7_Xtߡ=t3t(ȳ|1I $e[_$UWVS1=( = jjE p 5<h5d RE ph6rE PEP ]5hbh j覤USh6]S踅 YZuD]jh<Sn u HhBSx YZu LhOS[ YZu PhUS> [ZuTUWVSS<=Eu <h,~Y1@C~hRfMYtJ@=t14@Sh[C} ~E<e[^_1ۃ<@tC~@@}nud=TtOj hEh  }h h5d 믃=TtH} 5djMjh`e j hS 1XZt8{.t/3hh5d* Kj hS _Xu뾡U=СtE0u=Tu (PB XP1 XrUj=\Xtjh5dQ $ jhbUSj^=СXt@x jP5 Сj=СXtu,Сjk]jP $`51  jPf $65  0UWVSt=EEEEEt9EPEuPE uPh5d =G} uE}uEEPEPE PuEq} uv0Puh5dG 5jO]SEϊ b1D }E60E } t=u h/j[E^,}tXh:^E t}u7Et}u!Et}u Ee[^_PI XP@ ZP7 Y}u Eu E#=T[uС(E9EE}'1۸tEE9E|b 0hhh ȳ05aPhF@_ZC}t`uhN_EZ}Et!E8PhFYE[hEҪE^hE軪EY뉃ы} 1ˋ}Ӎ4 V!Vu P VhS VuS E] (] 5djjh 5 uh5d~ 2hE _E_ZUWVS1Q׉щKMuh5d ƃ ]5)PW耇 tPэ\ ~  t,M1;ȳ U e[^_ƃ5z jXZ5djjhO j9UWVS=]}t =Сu9=Du`|1e[^_á`tP X`ڃ=Du0=`|u`|`|B`|Bu`|룃=`Ph5ԡV (/thhuV hhV V- Pw<X1H } 5< C;zydљt t} hS <5藄 S` =`u+t `5dj'jh@U D5`hh`x u5` `j h`xJ [^t`x1=TPQX#jjP3Ph蕯;|mu1=TP XVh4UWS0=D]u Se[_1}ȹ }WjhS,u}uShęW1빋E0}WtUWVSSS<=} Eu <=Pu1uE<e[^_5dj(jh uhCZYtRt,t=u5dh 5dj 북=uȃ=PuPj hH Y_Wj U@RPËE 6Ёw!4D4%@ R ZUWVST<=EUEu <=DuB} u#E<Ete[^_ËU5dj(jhb uh_ZtTt.} t=u5dhQ 5dj L 봁=uƃ=DuDj SG Y^tj.hwG _Zt11tSh5d EPEPEPEPEPEPh7SE u1}Ĺ EEċEEȋEE̋EEЋEHUĉEԋE-lREEB E@^t#=mEPm $h6Q} A=4;P hh@5d ShT5d20 U=VS5<u <huZt<5e[^j hE YXtҀ:t̀z"uǃ1Ʉt<"tEBAtv=Ɓthhg5d zz"uBU=dt"5d $ ;dYdUScj U]UWVS8:}-= ue[^_itjSءܡ+||+x|[҉^l|9h||C9v9x|||h|5l|Džh~hS$ ġ ҉RٽP߭f,$f #f٭۝٭d~dWh+PP$ ơ =vpՅ~J׉йdh)VPQh+PP# 1Ʌxw  A ɸ tBPTPWVh+P+PG# +t|+p|҉>ڽܡڅ11ݝءxa݅ٞRٽVf,$f f٭߽٭x{w  A TPK  )Ӹdkd Ph+P*P! =ġ5xxܡۋ ءx3m݅s99h+P*PL!  }thP5d $ }t"}jjj_j Rjhjj 5h+P*P  f}kT+5=WV,$SQ,$ٽܵff ܥf٭۝٭?~؉֙t|Ph+P*P عщȺ<әRPh+P.P ƉWh+P.Pv Ɖ 끸h+P+PE Éhٽff ݅5f٭۝٭Qh+P+P Ãٽff f݅٭۝٭щȺ<әRPhh+P.P> Ɖ t_y\SH@B%1]H@BWjhp|p|t|x|||_h|l|XUWVSL=<u= u }~jS+t|+p|Y҉[Tڽ ܡڅ11ݝءxa݅ٞ։QٽRf,$f f٭߽٭Ѓ 5tS5ܡ5ءhhP ٽff f݅٭۝٭Q~RعQӉtRQh+P)P ؙغ<љRPh +P+P+ Ãx1w  @ TP  )Ӹdkd Ph+PPq }=ܡ5ءo<݅TġҡA 񉝰9|9+RP,$WV,$ٽܵff fܥ٭۝٭عøh&+PP_  <әRPh.+PP +||+x|҉Zh+PP }StPe[^_5d4 Zh8+PP^  uH@BTSh+PP "FPh+P)P =G>H@BUSܡҋءx~<=\ujX]jh5dн $ ̓wUWVSEEP9UEs(MM<1эY;]~]E9Ur؋ EЃe}uUBH1E9EE}hE9u}QMMUMA;E H9UCA;u9E0U묋E H9U.A9.A9.둀;t C;mt E H9UCA;u;.umtn=Сt/;_E H9^UCA;u?UWVSQ}W] j EPV U:t9t7A=w:uV e[^_ÃtSWh} huW YZtf@UWVS1ۃ$؍}ԹuEPURhqRVEEEt0=u1e[^_VSh5d{ u _UWVS]} uSXu} ]e[^_UVS]u SXu ]e[^US]S Zt]Sh@jyUdthjyUS] Su蒨@YZt]ShjyUEt P Ythjzh@jdyUS@E E܍EP 1}E]܍E$Sun xUЋ]UUBw$\Pu R1RhjyU0USS}] t3h^ 1]Ftt&EPkEZuh5z:YSh j UWVSSS=!EtjEӁ4D4%@tFڄt9E0E}t:;Et)GFutFuEe[^_Eр\tD"t6't(Ӂw4D4%@tRP ZE'E"FzR( Y9VhG h= E UU<^tÊR?tЃUS]˃ڸtJ4t@v>0A0BB0@\CD@[Ãv@AC@@^ABUWVSQQ}EE1;u==u }h`339Y1;u|1;}e[^_jhE 4ބ t{t8G{ ~-U DP{ ~U DPSEXs ZF;u|11֡djh`"2Sdjh` 2shhEnp5j,jh a `h BK h@ 8K h .K hJ$K 1hgK hjhE 4 tP"Zu_C ;E}&{{?tSpU;u|tJ33{ tPs h 5諮 jU 4h Z NE 4h`hCUdjh`0UuhAqh|GUuh6h3}0Uuh;h}Uuh@h]~UWVSQh}W证1[ZuhMcW蜁ZYu hY hI hY =Et21;эqEA*3hQY u^;_uj 1e[^_h,Y EXjhWP<t-ށ=u hgH jVU듊0< wk Bt0Њ0< v:u!vu Wh5衬 Lu Wh@u WhU=StCu;u1]P3hAX UáU~5jhP9kxh!4XU=thG XhUEx^Ht0 uh@G YhG jLhXZ < th_G jgh븠 < tu 1=|UEt\Ht3uh@F YhF jgXZthhF jIg֠ЃUEt\Ht3uh@jF YhXF j$gXZthh0F jf֠ЃU=St$Ct8t:P3hU ;uj DhhMchU 1]j "XU=VSut3Ct$8t.PuP3h U ;u͍e[^j XUWVSPuEE tkE 8jhWE ~PN~uvt]S t-1:CtPC 8t5PhT {uNuEe[^_jS!EXWh5趨 1Wh5j =Xt$Ct8tP3hN ;u1]j XU}VSu th> h> XZ1e[^jhv[w tGPwYu${ t =t{tsShgvh5? vh UWV}S;}|Jde[^_ËE 4ejhËE 4vSvVvZt,F t%~t8thh;M XvhȻ}M ^Xt/t)8 t${u-C PJ$3hVKM G;}J3s 3hbhn떅wE 4htM 1 E 4h=t8F t)~t#8h;L XvhȻL [_>uj =@@Yt)8 t${u+C Pm$3hVnL ;uXs 3hbhnwUVS@]u ~FPsPh` L ~%Ft5 e[^hK 5j2]SzR ؃U1=h ; =t"Ph K 5譧 øUS(^EPEP)ZYjj1ۅEPEP(t=tuE9EtZ|$j]]ËE9EuUWVS]EPEP(ZYEtNjWEPEPT( t=t}uE9EtXZe[^_ËE9EuhX ÅXtNj/SY^_t<@}~jhh$PS jPS hN&j蓿'h2&XsU=WVu'}uaE p uLe^_j5h9 5'`jh`CVUjhhhNjpUjj-^U=St$Ct8tP3hI ;u܋]j _XUjhuqU}VSu t5j6jh!ƛ 1e[^vYt2PqZtvh "5蠜 s S?vh`"U=St$Ct8tP3hGH ;u܋]j XUjhupUW}VSu vYPqZuaC 9tG3{ t8Ps G9C } *Ph#5轛 1e[^_ø޸v vSvh $5肛 vh`$5j>jh$R UVSۋutVs ZYtu1ҍe[^UWVS\; h0Zp >:t8u~j:p e hS21҈E߃щыLQ VShP* $q 5 x _h>^th0ZhCPe[^_hK[tp h>Gh>5 j=3 DžXZtGP3@=Y^;uUVSuVaÅXtMCu=C u-V ECCVrr Cu gr C e[^PA XP8 Xj áCYtXUSuÅXt<StPCuC u ]]Ϲ Pɹ XP Xۋ]UuZt@UulYt@UVS']uSh$5虘 e[^S,ƅXt BvB[Ee[^HDSh %USt%s s{t*PhS#D uۋ]ø U}U t1átt衐xt9Pt uˋ@UucZ1҅tP U=WVX5hC X}Z~E p`lUƠ"=th`% 3 =\Xu{hunPhuC !ZYthuPhB ^_P$hB 5۞ e^_h2 _uh%h%z2 huPheB huPhHB 9h)2 YWUjh`hhgT UMSYӃt'1t]ÍQj.h`RP讖 `QUWVS=] DžLDžHDž@Dž<Dž8Dž4Dž0Dž, } ;MDtl3hMc3 i^_(Ƹ7?M8M}u@k4tV1}Թ`V}Wj4EE`,@h> jh`hhgT>hJtN5Wjh% e 0t 0[,t ,޼Ye[^1_8G^h> 8ZtP(ÅXt.9Ct$P(ÅXDž8t881\ZttB9Ct[tB9Cu\po$h/XXZt5\HXAh &X5-_Xh_jjh5IOhh4YX=xL=5jhjj5膴趴8*h`&[PPXTR8h^h"X@h1I; dPrTPbh@hג h@h賒 Gh5=u $jjjhh\PRpeyVW<5EƺP$5hڍ5f  90f $5hڍ55 B<hf U5hWU1ɁU ЋpAu퍅pPAPUUSjh]S_ t]jh@S_UWVSPEEu }I}j [=Tpt=~ F< tO~ FB< u1t J: =Tt5hW6 XZ5hh< =tMt?PP?_ZYuotd{ t =tFh5SZY!}u =Ee[^_[He[^_hg% hh5M^u5 [t뎁=Th?% Y 5h15 [XyjjjjRjh`AUWVS]tUK~/E E 0VP ^YZu+tw$ XKэe[^1_Vh4 XZVhh '$ =YtƋGu ?uP7jh&h4 UWVS 1Dž}؉I} I=te[^_huR =h59 ÅXZtShhx: <#tԃt8Ё4D4%@u DžS4D4%@jRh'0 u h 0 jh h/ hhǽh蒊  < t < t< Dž.PP[ZYuGt6 t =th5W^_5h`'R2 5h5h߸+PP=+PR軗 ^R诗 _bSò hZȮ …ңXtу v'@hh@ Y@[Rh@s ^_UWVS0}tO}tIE EЃxEӋډUȋU Ù:!MC9@t e[^_CEE}1EE@CEEE1}:UůEt(},N}@1}:'F҈Uu1MQEPjuEȰusEЋ@@tC;Eȉu,uXdM*<BEUC+Mu赯W良$uhڍ5  tEỦ1軨0d\ $uhڍ5躃 ʍURMQjuEЯǃ F}F>@uBU*MEM9 U$@;"@Uh(h;h'h'5hT5 j0 UWVS<] E*j/3=ZY@E5h8±~t Tܭh (Suۤ M4E$حT5h`(5 됃 حx5h(ܭ\M>5d0X-5h(5h )pdܭE5d@T~dU5h`) 5h)=ܭH)E}Eă}EȉEth7?Y EȋUEЉEUX}th:?Y UEUXU}U~ CUEh`8_u%EċU)PPpHZYe[^_jS^?h`8[jjj 1=Tܭ;Uhhh` Hu&hhh@ Hu  j USĀ| HuуӸh ||PjjBR_u ,8tx$|]h1XUh`,UVSh`rÉY~,h`&ZjS5`5[ ÃxY=tu 1e[^S5`j>Z> tSh`Y9Xth`Zta887t .8#u 1jjl<5H5h`tjh6U1W}SU ]EPPډXP [_UMAP;QrЉA+AHUU9BUE@UUBE ;B r+BB@BUU ҋMt5At+x;9}A;Q r+Q@;QAt;ArAAAUS] S9t)x[CC9CrCUS] S9r9t)x[CC9CrC US]St9t)‰x[CK9t)C9CvCUS]Ct9t9sC )x[CK9r9tC9CwUWV}Su ue[^_u29E[}]ExSPmX)]ZuuYؐU5{ 5{ 蠠Uu u5Uu u5UUU99tx9tZ9tH9t6u9t9tu31+325"t%6ԃ=t4,5C4Ujht5z $ˠUWVhj,  e^_UEHw$ø"1޸׸иɸ¸뻸봸뭸릸UWV^_UWVS4]%9̭ P6^%}ľ ̭MM=tM>ee\MuEMeпne<E% eEECh,vjohOvjnhrvjnhvjnTM 0H $h)6 j8 P YP _P XhEj5UW@1_TU} S]t8u ulЃu]Adjh`djh`djh`nShhE/]U} S]t8u tlЃt]Adjh`djh`djh`ShhE=/]U} S]t8u ulЃu]Adjh`kdjh`Wdjh`DShhE.]U} S]t8u tlЃt]Adjh`djh`djh`ShhE.]UVS]1t#Btt BuOЃu@"w$@H@@t)jS&j/+ e[^jASXZ݃=t US]t#Btu BЃttoIt2Ѓ҈ujs*Y]jSXZ@H@@뼃u=t %뼃=tƒu=t %UVS]1t#Btt BuU'w"$jS%e[^þt"jSji) jSY^jj( "jSC "e[^; h0Ztx"ujj " jj?US]t#Btu Bu.Ѓt"t2Ѓ҈ujd(Y]jSXZUWVS} t1} I(<E E]t<:t;|Ct<:uU Pʈ E}X}E}EE҉ÈUt5}|}:} t }ECEuˋ}U9ztY}_E8}u } tU E8ue[^_ÃmU}9s݋B;Ur΃1uUm;Us B;UrEUEkuw:4D4%4w44V YVy _C}u++E)!} tJPuu  u7E}}:<|Et]EC|UtEuPu3 tU}:UEE P%XUWVS1}] ;]re[^_Vu3 1҅t;]rUWSW=tu t=tP膇 [hYt%EPjS tk1I(vJ  8u e[_S$XShv XZUWVS+Phj<~*у@ w.$Dt;s B:te[^_1h`r~9Y}JhhSjjhhh]Sj $WSh`FPEPj>)jh *8Y[t d;RB:ApPlP=hhlpjj hhhuVRi }10h`y{9Z}WVh`?C,h`*L X!;@tK~2t!r"j"FƠ" 9 A= ty=/t)RQ?[j)RQ =t.=|=)RQM!)RQ)RQ)RQ;#b;PB:?h0^t1ۉǃI+vjj#hhRjj#hhhj2tV x(h`Z{9ZWVh`CPv9t4~+p\)SR U} E~Oh`Z~$jhh`tjhj>(&h`*vXEfU} ~ENU} E~Oh`1Z~$jhh`jhj>%h*YEU} ~EUS} E]t]Ë9tȃuȃۢuh`{[~2jhh`>jhj>$E]h*2Y U=\s@@ @ =rj0YC,5jiTZ PYjF`Y\ej#xZt}bjYkj Z5Bj Yj Zj tYj QZ]j.Y'j ZjYjZjYtVjHZt'DMb= t jX DMv@ h2t}Z\e$PY,5 Ut Ht Rh +n U" uUU1 "uUS]h` Z~Et'j h-h`jh/j> ]j h$h`jh&E]US,@sJC t8;tTCCtPCP- iP' r0j]CUWVSE E}}~&҉Ut~OGu6m}Iue[^_Ee[^_ljjR kE EwWÉU : C 9tWs 9UGȀCGU舂 tPCPug}tCC܋EU爐 GCGsCʃ9QUS,hsICt78t1tGC CPCP- iPP rj]CU"UWVSSuEU]  Q߉tVBt/B}tY[^_BBA랡USBB@Á]h`_9Z~6-Phh`-Phj>h`+XU,S1=s+PyPPt 8 t  =rՉ[UWVSPPE }EE1?te[^_}tt;]}";t^Tt5t;FC;]|ރ}t uYEe[^_F}t u^t;u뺃Cj_뮡UhPx XZtRXBBBB'BBh+Xhv XeU;t@UWVSQ=]tSt;uRjjXZjj_Xt SXjj[^jjÅXZt SYe[^_S 1҉Ɖ߃IM_ EL; XvLX)WRX;w ZYX+)щ XSYtnCt#ƒ~G=t0Cu݅1뺡h+X ME;XUWVS]޿>tZ޿0tJ޿Ct:޿/ t*޿:t޿>18u[^_UV+5}S^u~OP@h`9Z~\S5h`VPj><ue[^P`t X[h`+U^UWVSQQ1EEh7ZZu%}~h@5@DžX1OFEw$t uJu>=u5=u=h jhXZM u t#=#=뭅F=u =t=Y jhY[tu uFOEFOE== fwg$Ehhh\gj@P@@Shh\ =u=ujh5[XiShh\S~DShh\jS'Shh\RSt%!jY Shh\Sjt=ruK=s =s \u=2$=s =sShhC ,}u1}u}te[^_uh@MY[uh@Xkjj#SXZUUdjh`djh`djh`j~jhhE Udjh`djh`vhhhE=u@Udjh`7djh`#hhhEUdjh`djh`hhhEBUdjh`2djh`hhhEUWVSuh,1e[^_h`u]EEEEEE)9؍}Z} @SVh`aCPWj> Udjh`djh`hhhE,=u=ujYzUdjh`odjh`[hhhE=u=ujSX Udjh`djh`hhhEJ=u=ujXUdjh`djh`yhhhE=u=ujqX'Udjh`djh`hhhEhUdjh`djh`hhhE'UWVSue[^_ÍEPEPY[tEEuEE}EUtnEBt^EBtKE܈Bt;BZh`)9Z|SVh`pCPWj>&gBBBEUUS]uu]jjXZjjYXUS]uu]jjdXZjj-YXܐUhh@h Hu&hh@h Hu Ljp UWVShh1YۉX~-}~= u[9t/Sh XZx 9t )ߍGe[^_1H9~͉)ރ}t~V5{YXS5j> S5VXZpU1Ʉu=tЃtt=t/u=tH9D~à"t US]at E[dUjZÐUVSut8w@4D4%tw44Fuȍe[^SZSR YUEjPuu umeU WVS]t;tPsm Xt޿u$@ e[^_hzySZ^ _t Sh@(Q Sh59@ UWVSQQuE} EEuEPh5 ? =@~9s'P;tp Ph5 C? 9rكE ;t*Pj 6? XZxs Ee[^_G Pjjh=Q> ̸*뎃 ~ 9r E Ph5 C%? 9rUS=ME ]6==t&=t=wt=t1҅RQh5 > /vxtWSh.5 > ;tE E ] > Pjjh=H= E]`F 5 jjh = 5 45= [XSPQh5 > sw4Qh5 = SQh]US1ۊ/P4hv c/N44h9YX/P4h  tF/v8w%4h XZC ]Sh) 4у/v!w4h7 ShE 4PShS gP4Rt/v'w4hj ZShx O4Sh 4/v'w4h Sh 4PSh @P4+c/v'w4h ;Sh 04UWVSDE=}Eu!=@tU :te[^_À}}<\tEPh 5 ; E Xp\ 5 jjh 9 /0  4h5 : /  5 49 XZ5 jjh P9 b M ƒ"T $5 jjh 9 ] CЃtJtfPPh@,5 9 }t ;t'Pj 9 XZ ;PA X}Pjjh=8 5 jjh: 8 뙋E PGPh y5 jjh[8 ] CЃtctFRh% 5 F9 9>U Ph3 5 C9 9|5 jjh9 7 뵡@H@ ;iPjjh? 7 9M  $pwCM  uE 8t +Ee[^_ËE)1SZ9S< YSy[mS< _>UW}V1҅St ] 1;u e[^_3WZYtx uى];uU1} UVSPPu E@E PÍEPhqSYK e[^UVSRuV ÍEPS5|S(K 1~Ee[^ÐUE HEDPuPJ PXUVS] u~K~Ph FZKYe[^UUWVSP5,MEt>uA@Q49ЋYHsd9t:uu 5,腖 @t}t ,@1ҍe[^_ËA9tEF9Qu룍DUVSuM FɋUX$I0tMu e[^Åt%hj荐 50 Z1hjمt,@ۡ,@ͅtK tǃ tthj끍PhmV у eǃ t1u500 Y8hj谏 ؍Ph0VN R UES@@$P] D; =Zt#=w0KtKw2t %1]Xnt==,t=,w==Xt=uUUu6t k Bx8t J1œjhmjPO U5,u@YU,M ttPEU+BH1UWVSW]Cu~9,EtUtxjC4K@sH9T0s1R5,脑 @tjjjj5,Wu5,Y j5,@[^e[^_9ShUU SE@ҋX$tMJu1]hĶjPj4 PG u6jZKXyj ZKYyj Z5q- XZj ZhjphjHO Uj5,@ZYUU SE@M]@$t>r1t$t 1[Ê犀ꊀ⊀UWVSuV]CH} P5,軏 @t 1e[^_sHVWh`jSaqUE@@$t1Ã} u5,@Zj50jYXUWVSPE@}X$p\tSEtmt e[^1_ÃMEu hm5+ ̋tVUWVS8uFX$E t[u2jjIXZu 1ҍe[^_ÍEPjj5 EPj5 Pjj5 뮡,EtUtxĶjHP5,5,葞j5,ءjjV$f8PjjJ5 jjHt 2jF pV^j5,zWu5,菍 jVEPjjjV}F@$U5hjh ÐUWVS l@lHtK E 08PãohJ V3Vn C\C`u j3oXZjEPEPjju2ECHCDEC0T  Hux9DžtJUt/p ;~?9ujjjP@P=u u/nZ.e[^_ËEHPujA uN@15UE1u렍EPjj* ڋEtMрy t BEǃ<8th.jud 놾|uVjk* YZ/Džt.} eeEPjjD* \uuj? ^E1ɉ{A UWVS(u hmhES1Eԉ]EEEdp jPIuM~t e[^_uhmhSp jPIuM<~1҃붐UWVS]sT~$JE t E t t tUF9t"jC4CHP5,15,jC4CHHP5,5,苑E tySYuW tEt_hm>Xh>X68tWhjV^Whmj苆X5UESX$j5,肐XZtS+ 'ǃ 1]jj5,p|j5,ĶjHP5,O| 5,ɌYUWVSUBX$1ue[^_ÍPh2u$PhٿuPhmu$PhuPhnutp0 󥁋<040Pjj" t#48thmju\1P0 ǃ^qP0 ǃY[UEp$m1UWVSu %ƅXtt1Ӄu 1e[^_S. ‹E_t SVRn jju9\US]uyu\u?u"u]P/ ǃXP/ ǃXP/ ǃXPy/ ǃXPf/ ǃXqUVS0E utjPV9e[^uhpj(]Sg jSUWVSS=-E-=/E/=(/E /uHMADtC$uu1ҍe[^_s ssssu#ҋM1_ÅXtct^޿BtMExuZjjjj1IQSMyIQEpu荡$fEUz{.jjMy1IQMq듋M1Ztat\`MA 9tjjjBP1щIQSMyIQEpu$EUzuxE0/YtZtUjjMy1IQMq߉IQSMyIQEpuf$?EUzuUESDtB$u ۉu1]RWXUWVSWWE EEEuЃ tJt[^[^_ ZY[^1_UWVSD}GP2h$hnj@]Sd St t8u1tOGPg$hnj@]Sd ju u1uEIQVuSuEe[^_hWju\UVSM ]CuP$tk&tt e[1^ÁT?tJuڃ>u$C tǃxtjpS 뱃jj1>PRSUWVS`ju} "YEPS}-YZuEf@}t1}t1tCtU;Pttu[" Xe[^_ÁTuSh1^_uWd֋E1Cdu/CTujjjS(uCToEHU ;Es\zEPS5ZYaME9m9XUM ;Ev[PS0^_ud֋E1Cdu+CTu-jjjS(u CTuEHU ;EwEPEPjM 1S.1tst Utmu FEEw2E Hu}pu0S2Q$PEPjSӫ/E묋U B;FxwNtFxEM܁TPFxPvtS荫FtŋM u9u vutdjEPjRS-1tst U}EEE9u}܋MEPEPjU2S~-!UuBN9ty)ʋMD9}`1tst UEEEp}u}MFEUM+BDEuu܋u 6S1uxU;EbPS .ZYu[dыE1Cdu3CT0jjjSj%uCT EHu ;EwPEPjS蟩E;FxwFtE܋FxE䁎TPFxPvtSYFt1tstU;Vtt;EPEPutT;FxwNtMPFxPvtSPFth)ojSI PEPjS轨EE;FxwFtE܋FxE䁎TzPFxPvtSoFtEPEPjRS*1tst UEEEw\U Jt u}MqE u}xMFU BM+AEHPu2S.PEPjS蠧E낋E;FxwFtE܋FxE䁎T_PFxPvtSZFtEPEPjRS)Eu9F8UWVSPE@} Et]X009tSKE309CFE0S9Sp YE09ujj Y^ts} tBou u3U0MA4C9Q0t}G4EX4؍e[^_ÉY0u CZuS jjuG1jju G Q _J}G05CUB4u s _Z#yUWVSE fPЃ fDžhDžltE fPPu\e[^_ÃE fPj\jp ƅXZSpPtPu uNXFFFHFT0uU REdut pOjj uh Uxkp B@8PhGohtSR SR P E x_ufHSHU B YzbE @ EduU fJFDP_1}UE B]T@}EuFLYENXEPjh}jdt1P' FEhPjuHDžlFX@u\FLuEFu7V( lXu Muuu utPPXP FLXvLX뙋dlVuA_ZtMU Bu0U B ]PE p  U B XZ;P{ E @YVu=,Y[uE t&UB WxM@PuXZEx}thu'E uU fBfuW|u;jjjj*udEU P pPE 1mjr[_ujjFPP $FHPdu8Wr0IhdjuDžhF"U fJEU fJPju u E f`jVu 61jjuBE pVRې 'FLESU BZU B ujjuASPz Xh@눋Upjjuu Ӄxi v utFVRhEhW0L uWMDžI}FCAB0K9t'CuS YG P XB0֋CB4hos jW?냋w?UWVS4EuP xtrV2 [ZpDžEuZtQUk Bx8t-EuPju;e[^_EU\k Bx8uetfBft4EPVZYu$E uoPVju>qEu EPV[ZDžuSt@Eu7GXt%G<9EtE`u놋G@9EuGD9EuDžEDž u Džjju\ uDU0k( B@8PVuQ tEhV  E|muzyPS ZY} -jPPuu Vu t%EhVju<EfbHJPVuG )Ej u`PuFPh@TPD ËEp8$9TrG1эL 9sT/BK9s :/uF9s9tdJ.J.J.Rhju7t)1}tUBt ;Pttg Y1T퍕T렍F9sjhgXzt fJ@f`EPVk ZYuOXEG1ۃ}tEXt Ux@D2DžDžvxDž;t<%:븃΃UVS]u u7t'V蒸^te[^jjS, ǃPK XUUSD]t\k< Bx8t#8jS^ZYujjSR] 8#t8#t1܃<UVS]shjS7jjSjjS$jjSjjSh2j5(h`ƆR (I(`t/R;sRC UWVS@}wVXЃF$9F(F(VXEEEF(FUjRURvP 9]HY$1}tF(CjPu 覮 fX1e[^_jCPEPE肮 uWHuGdufXjCPEPEI EȃPCPuWuG\1jCPEPE EȃPCPuWuE9GXG`GXjCPEPEȭ E܉EEjEEPEPW 1hIhW% h,qjWUhjj UVSuuu @n$hDqjV^CPPSV te[^E]qE ue[^ UWVS]hDžlu ǃh{ u ǃ~ CCC CCCC|C|C0C0C4,,0CpƉdǃǃ@ǃDDžttֹdu3Y_1T@DžDžhDžpDžxDž|hoquu  ?8$2 u d hj3e[^_ÃTDžlDžtzDžxk`Dž|QttDžr9hyDžp rtރttdDžthh@42=dUHpUt tTt DžpPjS4E t@tCCB9C t!CPCSS CCB9C )CPCPZu|tDžDž7tt *lt xt 3PZY-tqWhqhWn 1򮍅jPIDžDžX$p k B@8B4`WkX B@8pB8u rlkd A@8@胻 u ЉhthK_ZE8t@@ EB(B$ rx uGP$XjPQ_X]jjR~BC|xue ҉t-t%P iZu1PW$ٍPjR[PjjjEPE܃QHtdYċE3 u)*k_PC^H2P…XY@fJ `Oxm1Q@ UYt@ p}7pXZjj03" dZ}?*\YVQ_7Xjjjj'jjjj)'(jjjjD'jjjjH'(S hjqdtdqu DžtDUVSuFVF9tRAVF9[uVF9tRAVF9YuTuR^lt=s s{t8Phq5ŷtCBC^luÍe[^øq5j3XZjjPvADUWVSQE ۉEt=޿=?t,<+<-t(EEt޿=?u1e[^_ÊCt#_XUVS]u 5u^XZtShtz5+ uE E e[^鮵0蒎$htz5 UE @81US] S8t tBABRv S8Xu1]UWVS] `}SWƅXZtF9t:w*kGXPhquWUe[^_SWZYيFt&wkGXPhSW[^FtKPWZYu)wkGXPh|SWZYFUF B1j~ t뭻'UWVu `S}VWÅXZtC9tj Yt`t?tPZӋUCBC C}C1ҍe[^_ËOA8tA8PA8Q8BjjWȃ}uC1<u봾'LUES@@81Ʌ] tP9s u[9tUWVSQE u}tbt 1ҍe[^_jVZYtFX8t܋C9r@CuɍEPVaY[u}u묋FX8tC9r9t HCu닀KSVXZ* UWVS}E@EE $D4Ut407k( U|8uU胊Te[^_E p@pHEu1}EtEpt U}EES1ۃ} } } U} K}t1juu E EPEu)PW;EEsE;]w} C;]v71}tUBtU;Pttu` Ye!T }t uZ}tTSuu uU1}tUBtU;Pttu XpTuSh=50艉$Ehtz)PWI ǃ;]EE }}U苲>tBuEEhq)PW ǃ;]EoPuYZ듍EPhqu$ M 9M8}E}ljuEPju[EU;VxwFtEFxETfRFxPvtu[IFtŋE(UU0tk( U|8E 뽋E(} E}} zE n UWVSVu}t^EPVW Vuu W}t1tGt;pttVZ [e[^_ÁTuu WuUWVSEun@XŠ(6k  B@8E1ҋ]MT\C]vt'9w+9Ats&E]ED\C]ve[^_1ۃ}tUZt UshEPjuEYEt]EEEX4EEU|\}EMEt\h/jS UREMEE|\4t4u>ƋME UMQTE0uCUƋMEUMED\(EE}9 uE]CuujS1tCtU;Pttu@ _Tw;C EC{xvKtCxEM؁ThCxPstuX#CtM UWVSUB x1I1ۅ҉MtZt UEEEPUB @E8]tXU<kUB]EU<kUBXߋMEE]8u]:C UCt-B$t&1҃8t B8uKEUJ fQЃ1fft,C CUB@XEPh'rREߋMu ]UB f@f%ft5t,C CEPh4rut߉EM] Uk Bx8t5t,C CEPhAru߉EM] t:C CE]EPuZY}EPhNru߉EM]  C+UEUutFEH89v/F;us>/u)A9w;utfN.N.N).]uMUBuVjR1}tUBtU;Pttu Xe[^_ÁTU+B8p@ 뉍A9ctEPh]ruEMkE d1PQu uS01э\ EPhyru|u PS߉E1э\ EEPhruuEPhru&߉EM] EfQPhru߉EM] 0Rjhru PSE1э\ :C C{Pu7^_PuZYPEPjuFSEIE;CxwCtECxETdPCxPstuRCtUWVSj/u VaY_t x jjjjSjPPDžDžR u tBR=,^t,e[^_h@Sju"ru}G@h,uUBxh1PP[=,uhSjhr Zt8uhrs _8PVhhSUE@huPPXUU MEwV$|4EE rMAEE EE ߉EE rӉEE sljEE  UWVS] =}utHC=t'C=t{|tt1I؍e[^_ÍESEE1҅EXtWtJhujEPEPrhQ uUt݅tBUBE1o1G1UWVS u] ;t'4D4%tC;uـ;u E e[^_EE}6EXt U1}EEHE] t@;}s;U k B@8Hu DžhOvhW1jPIuM tDž0RUBRu`Y[T=XDžhZvhW1jPIuM# tDžI1ۃ=44uGIrpk UBx8t:jk UB@8Pj Su& C?oE 8tSU 49t PWqXZ1jPIuM uE U :u1E \+t&k UB@8PjjSu4jjjSujjjSu(=wDžU tk B@8HUU'B UWVS0U xEEt.EĉƸNu6EE } xu҃}u EЍe[^_uuY[EEEẺ1t=Y?PCu}Et UBUuEZ]؁4k U}uuM AxU؋Be}1u}u}uEOU؊B udk Mk Ax8t:k Muȍk A@8PN^Z~E؃xtjuWuPujuSunt EAjuSuyuߋMAjuSQujujSu먋\$hujuEM؊Q Ѓ t }NЃt }1}zu8}k Mk Ax8@E؃xtEPjWuURuVjSu'VjSuwMAVjSQ}tjjjSuj烺\k Mtk Ax8x3hh}h@s}5}+U=Yj EPuȍMQAEPuu ÍEPuutu}t1}tUBt;XttCSh [}21}tMAt;xtt W@ YTTPShjuJ{PShevjEt\Ё34D4%u;EPuu*ÍEPuuPShju, E؊P Ѓ@t }u0k Mk AU9P8hE؃xtURuWuPuVuSuPVuSuu}GVuSWujjE9nhR莣^1h@8?pM `MĀ9nt#}uu _XEoyou׃QEM EX;]t=]t E}tuh|vju/ E UkE WUV SB}uk UBX8uat2 t"uCu s1e[^_Pp _EC tuu3PH YUVLiƅXujjua렉pUM k S]tEk C@8t8u+}t ]h4jS 1܋UWVSDž< EH81҉< D8<<DžDŃ=4Dž@DžLDžP4P48PъS Ѓ} t6} } } k }k8 E‰4Z؃BP1PBуqKD9Z@8tG@PP;@~c<9@@҉tC19};DžH<9H|tF9| Lthu_X9|1;L|hue[^_Ë4PuFpY;L[}huTXZ̋t4Pu=߉;@XZbDh)PhuH<9H|+L8BLt^4k UBx8t5k8 ]t#k Cx81эt⋍4몃t%4k ]Cx84t@4k MA@8PhrjTW1эt4ȃ PG k }k GH8k8 ]k C;H<k8 }k Gx<dk8 MtLk A@4D4%\u SFYXZuu j=Fk YM[tnk Ap8t2wI4D4%u)\t$u SFXZuu j ތ_Xu j\͌Y_SKZ뷋u j\讌YXDS)Z"k Mt6k Ax8tE0hvu 3 AU2hv䃺k Mt(k A@8PE0hvu UWVS h0fjj&Eh9E܍EPz0t@4e[^_hIfjjOh4EMPMC0Euу1}у=4YEE4t7}ԋ7M8|%9ۉu1}u}ԉ}؃EEԃ8uɋEkUhu juUE E EE郫UE E EEjUWVSSS] uE1EE샸4tG EN~Ee[^_Ê4uۃ}u!k Cx8ujjjWSjjjWS(jk C@8Pj WSu~thk Cx<Cjt=k C@MA\11}tUBtM;Httu蕜 XTPEPuu'rETUB;FxwFxNtE䁎TMPFxPvtuL'Ftt}ԋu}ԋE)EuPuuHEU9BXB`BX11PEPju&E EUB@;CxwKtCxEM؁TPCxPstu|&HCtEPurZY(}E 9Etu+uVQVJ e[^_P8 [P/ X̍P訪XP X롍P萪XP XsP XYFxPrZ<3ԕ ;XuAFA US]SJB9t 9u B9uB9t[ÍBJ9tI9t;ACBY9t$BBA9B t BHJ뼉J BًAB1UWVSPPExL]uYE tc4:CCE߉Nt* ;Etv\tBGB;EuBNB}tE)1E}yEtPEPEPEPVSuuE@t E U1ҍe[^_Ã}tCUEt=E@u1EPEPjjERPvjP돃}tC뗍EPuY_i}EtjutXZUWVS(u uuujuV0E 1EEdEEMԃ}p}tU ;:wEPEPjWV͠t~}uktUk Fx8t1EG1E u"E u UЍe[^_jVXZjVzXZ҃E tjEt9t1ҋMM PEPju܉]䍞SUE_t)E uFVd_PSPVN @}t E u6EUE 8PuE9r1҅tPMQEjVY[뾋FTjjjVMuFTE u EdHuVYEXEPURjM 1V zE E 8tXKU B@;EsMQEPjGWV趞1ۃt9k Fx8uE u jVXZOUWVS0u uuujuV2E U zGEEEdEEM̃}:}t M 9Er U}t}k Fx8t`EPV_Zu"Et@EEM1E u"E u Uȍe[^_jVY[jVbY[E tj郾E tjӍEPEPjRVuEjEEPju؍SEEEIt1ۋU9ڋE|+9#}t E EUEЃ19ډEUM|O9sKM PEPju؉]StuUt1ۋU9ڋE|9rEUE u#E9Er1҅tPMQE}UЋEPE uFVd_YSPV? IjVXZFT*jjjV耔uFTE u Ed~uVYE[E HuYt BE#t/k Fx8uE u jV^_ꃾ֋U UE Uw<$<hjR* hh@hvh`hv% UEPu hvPhÐUWVSSju$uujEPu}u kto1E(u}tu$11Cus {1e[^_P? YVuu u>070jjuIj(jE_ ÅXZK} tC {uuu9 CE}CVuu CE(U$C$SU҉s u]EPDt DXDDCC<UZHtXE#0s YC u S XP Z1C?0Wu u+ C Ǝ0jjuֶ kUjuuu jjuet EUS]tCBCC u&s: XCu S, 1]P XP XUWVSP} t E E@DEt,}CMQ 8wrE9Ct!]uԃ} tEM 1e[^_ÊC$uՋUC9vRusK xC;Ew;Et} t} tMU 릃} tE 녋sM8sdE9CXC$JMC9v}9(lUVSuDt7C uICu9Cu)tCBCS諈 DXuɍe[^P蓈 XP芈 ZP聈 YUWVSUBDEEtU E;PtEEuEe[^_Ɋ@$u݋ZE1ۋz~.<;kUBXPuKGXZ҉)օ~hsu跪)Y[UBZ 1ۉ~.<kUBXPurKGXZ҃}teEx t\)օ~hsu:)_XUZۋz ~( tN;w[+<Jۉj\EShjuĩnUWVStjj+uT )UHk B@89[hjuYDžbZBxu΋hP _ZtjP[$jjuL|vtKhSH t޿wt-hPju苬5Y.j S[^thS  twuj SZYtEPP'~^_t 8tFEPZ$}PEPN$h'xDž!Pr[ tx1ҍe[^_h2x>_hKxjuR͋uUWVS jj+u Ugk B@8llrY+U RpDžtDžDždDžhDžxDž蟂_Bxu΋PlhEhS育jjSL tjPjjusyC+uXVhS ޿wj SÅXZhPz wwj RY__|EPP?{_Zt|8pP}Y[EPxzXhZt;EPhdh0h_PM0dYtAtS$x Vx XZUtt t_Xtjjuhw hd!jju hP~^h PjuɧDž|Dž|th^txx9djPu uz\u:UBhPP|tPTu U fJHX@1ҍe[^_hv dv t~h@juɢ ihju貢 @hpju襦hljEUWVS jju} t=h PW}1 ~?S.Pu r} x)uhujue[^_1tUE VSHP]SuV9} 1@t j SYZ1҅Yt)@jRPV{ ڍe[^UVSu V®ÃXtEPV|^Xe[^hujuzUSEPhVxwZYthixhVxjuC]u hVxhxh|SqSKnҐUUWVSE ut9s6sӅtBSPqu ZYt>)<1Ѝe[^_jju蟠 1Ss _UVS uEPEPEPu u臁t1}e[^ËEt,9s(M)مډMEt < t< t}uH1‹MAEEHBEt܊A< t< tUSj/]S …XYtB]UEWV@Pu Dr _tMǍe^_jju蕟1 US]bwuuu +Gw 8u ]0w8"t1;uUS]wuuu Wav 8u ]v8"t1tށuϐUWVSQQEEsS Z.~lt;ww wStGBGw >r W8r _~lXuTtdždžxE t SI<Yk4 Cx8tM@k Cx8tM@CTuj:CxPS)CTujjjSxu+CTthS!S蛔 1CxPdžsdždžSZt TCTujjjSwu&CTtCThxjS͜ TxguY%,RjS_ te[^_SUX]e[^_E1ҋ@ W4&jsLS UWVS@EU@EЉUԋMЋY|StC @\tEC 1{Q3 Su5ZY 1{ECtGC E}4MċD4%tCHCCu{t }:QCtE}"t7C=E4UċD4%tCHCCuɋCu%MxkfytHEEPSu1 u}Z {t=C=E4UċD4%u}:uCHCCuÃ{EqC<|d< \PhxmY^K@KMCEEƒEwP$=PDEMŠ8auޅuCu?MKEuЋEdžEe[^_hjuu+ju&r[^u Eh@juё hju踑 PHhڋSBCBCuE̊L0wuVSUB:RPR2iY^kREPPSu}E迁,E hju {u8{t2C@UĉCt]tG} t2}|t,CHCu΃{EЃ耋M9A|{vCЋCvHCC봀}wMQEĀS댋uFU8RyuV/h_Zdjjju)9VLh@jV Q蒔YuRb_Z%C<+tK<-tG<^tC<#t?S=w.CQKBfK|Cl1j1u8ZYTES=uE8+ <+t<-C<-t~<+tsj EPsEPuSMuU:0u:U+C)CSE8at KXfK|ClCdKdSpAShClhxPfK|fK||1JssSu#&EU>!E{EtK;EuSJA҉SCuC+EPuSuM9<jC 0u`E\}tuw$44Uuuu R:ZEMC 0I^덃}uKCC XEuC)ȉKPD{$CC0xHBUBAB8tҁEw44UR"_s{ut.Cw94D4%tCHCCuҋC+EEhxR:DZNjUԋB( {`C 0Fu MuC`AL@CdAPCh7PC_ C8uZ0uЋ^|{PCY CHCtSBCz uC8 @KCCHCSBCR:Utu.C_GUC DELPuwe^_muFPr`[ UWVS E] {}C`twK 2$>uUClPWdZY1{l1CdCpChC`CK{uu Nt5{`t 1ҍe[^_ËCd9Clsh jWd}E ыC`t~&uClSpCdShGLClGPCpC`똅uGLCdGPChC`|zjjjWo E^jj9ttC`tZ~jtD9;t C`t"~uClGLCpGPօ̋CdGLChClSpCdShGLClGPCpC`뛅uGLCdGPChC`uEPEPSWE8}gC`tD~&t1@ClSpCdShEUSpCl߅uۋEUShCdC`ƋEUSpClC`X UWVS EU] My}S$8w?$?UGWu7bY^CK{t$C4D4%u1{t1S=Wuo<+ti<-te<^taE8ttx/9r71ҍe[^_jjjuMۉ;vh`juRzU빋M9uUBLBPG{t,C4D4%tCK΋KB 9Bv6C< 9BAC t FKt> u9,t )H)PRujWEtRu1tFKۉuU Zt-MɉOLt 1ҍe[^_jWTZYtGL݃M fA|f%fu& k Gx8t<tuk4 Gx8t@RjuVWuuX]9t!ssujWEtQu9uߋEGL4됃bjWUZYu[u0jhyWF{ PWchWcW8dhWc[^jM A 0WS_jhujWEP=::.F,K%E pE xdjlVdSjWqjVSWlXjU B HUWVSPE PxҋuEu)F(txuhyjVle[^_ËMtXu?V(z1IQruVCuEE ue[^_ 7UU ue[^_jMfA|f%PV< kExx& uF$t8v$> [F(jUBx@P$ F$ZYMytËxt(p0V xuF$F(0V"[_1ہMfA|f%f PjRV#otF(1VjjB3> ;_uF(pV"…XY@tfJ _UWVSSEPuVv} t e[^_juV uHGt0u!…XYt'fG|f%fPjRu"tjuujWV]C$C(EF1ZUWVS]S(;S$u tAz1IQrVSxt e[^_Éu ]e[^_;4jfF|f%PS): uċC(pS _XtfF|f%f PjRS!yk(1dhyjSFhMUVS]{$u uhjShe[^jfF|f%PSf9 u׋C$C(0S…XYtfF|f%f PjRS u1UWVS uF$8EEE1;ыE;^(TF8UH9E}tEhsV]_XV(E9ӸtP935tPhV0]FTu+jjjVZAu FTu ;OhVP]e[^1_hUEd:hyjVsfUWVS] ۸tCxj@P_ ƅXZt1҅ttI[txue[^_p0uE txu1ʋ}1IQuu 1҅~ujjue mUVSEC$jPu CFtC$Fxe[1^UWVSEuPv S$CM8uS$CUC$SMHC$M @C$QtAxe[^1_UWVS }1ۅt_t UhEPjWEEtUEuEPEPEPuuuu WE$t91҅tWtBt9Etu@8 Ye[^_ÁTEtB]49s"w^4D4%tC9r9tuuu W1҅tWtBt9Etu7 X1|TR(Z뢁{xvCtECxEThCxPstW!CtUWVS}1ۅt_t UhEPjWEEMtgEEecho@ jEPEP]EPSuuu WE#$t61҅tWtBt9Etu6 [e[^_ÁTjj4Wg tu1t\Nt7EPEPEPW uuuu Wƃy;*uEPu W ƃ WE]PSEjj5W v|%kt G@8E];tH4D4%u'4D4%uC;uEuxXt'MPu"ZYCNu.&wX4D4%uw24D4%t CNuPu踌ZYtlR%ZR%YR%^8R%Z t{xvCtECxEThCxPstW貿CtUWVSSSuEEU}4D4%^}EE M4D4%u EENuuuMA$QUPYҋXtM t@?t8GCMuMA$.UBM AtB$Axe[^1_GŊwEPS멋UB:RwPRG7YZS#Z8EN/wMQÀSUB8RSR6YZEN=S#YUWVSE M$E}?}U}tjM##!s)E1}Ut}w;^tU;UM}BEMu)E1}UtEptT;^ttOM;Mw)}EHUM E}$1ҍe[^_QEPSut܉빋U䁦T;VxwFxE^tTRFxPvtu譼tFtREPSu莼rE䁦T;FxwFxE^tTPFxPvtu=!FtÃ}(}}1I)M1}M܉UtUrtW;^ttR};}w(EMq׋ME PWEPSu蜻붋M䁦T;NxwFxE^tTQFxPvtuQ5Fthju-\%t4\z}pMA<%t <#t- YC?C&{ <1EC {<C/t/Bu׍KUB$JuD3BUB$@u B$NtFx;My..y1эY]ux(XUE;B$t*hEjMA$+EPAuP@1e[^_hzjuWhuju[EػuElE؂EuZUE E EEj/UWVS Udk\ Bx8thjuVe[^_ËUpkh B@8j/Eu_^E_E؋E E܋UEPUEE-[Ehu3ZEY$-EFu01X]uv4ǃX>}w=1ۃ}tEXU;StU9wU])EMCFRuuuUtE1jjuuugt]t!wG4D4%t/CNu߿t 1mhzjuT ߅uRrZ빁TU;CxwCtE܋UCxTPCxPstu脳0Ct;]v C< tR< tNU2E U܉u[u u4Yth"zuju8XKNh4zjuT }t!u3X}eu/XWEtP.h:zhj,UԉUtEhIE\ju+u.u.j.juh$uu\(hAzujuSWj'UWVSQQu fF|f@t^Q@**!MӁ4D4%Ӂ44MQ@ɉMtM8AtC ɉMujw#kXPue[^_Pu'(Y[ڃ}thjW_EZE<]CRZ EfyUjjPIUWVS} Gtx]E3FE0dFY t)uE0hS豔 `C1t;@Xt1$k Cx8tWjS"YZ1҅u.1PVE0WS`t 1ҍe[^_hSgFXZ劃`t0kX Cx8tujhS]ƃ |XՃU{@1dtPVE0EPGlPGdPWSUSLu ECP8CPCPPRS} luEPS6YZ }uGlGdsjG 0S E0hVzSDSE>jjSNP>" Xj G p밐UWVSUB@X] t4fC|f%fu'B @8/th jR$Ne[^_ËCxZHCt(1҅^tŃ{xtrCt/td@v .UHk@ BP8֍ZCt<:tCFF9r"{uhjugQ.CRhEhWYSW'uhW@ZYu1h[zWjuQE@Ky. AwWu }t%MEPA BALB APB1e[^_ËUBMHU؋MԉP H܉~륋E0p9vtUPMuF}t u ^}t u [PwuĊ u*hrjuBb}t uo XWu[j j[E_tÃXX j,jZEYbMAU܉Z9Y tMAU܉PE܋MAAQ hjP*B9UWVSP} ]E A4D4%tE ׋U :R4D4%tM :tFtU :u>uIhM }uEe[^_W6hEhSHEPSNt >u뻋E1>IU U B9EUUEE UWVu S}t>uDhW1X=`J`JZu 1e[^_s3jhӂW1;uVZYt p0hނW1s hΈW1VhW}1US]uJZ]EE ]UVSP] uۋMtqCuaC uQjEPsͦ tCBCC,uC(uSu 1e[^Pf YP] ^PXXPOX떅~Z۸t 9t@uQh@jV[:륅WUWVSu{} u 1ҍe[^_hWV uރ{uUWVS}@t-ssVhW0Fue[^1_hW/UWVSSSuV ҋ]} uIvS: ZYt(FEUCPSLCPPRS1e[^_wjS蜊jjEEv$REPPSxyuuǃwjUWVuS1у=`JY`Ju 1ҍe[^_S7Vz t?uUS] slZt(>usY>YusK Zu1]jSumUVSSu~] t}jClPCdPfC|1ftSQRVHt e[^jClPCdPV3uۋCdFLEPVZYuE9FLvFL1jC 0VD띐UWVSPE E@t0c]cCbtj UB pSe[^_ËHwڿ9uΉ]e[^_{st(tuHw9u]e[^_Hw9u]e[^_&6H f&9V]e[^_UVSuF@u @tnC=uGC9Ct jSV FTjjjVuFTuF@tbC=w|t?C9Ct jSVs FTuAjjjVu FTu"uF th2SV& e[1^11hAjV5UWVSWU B}_ulERPh~W+E p9t|^KVUtTU_ZUEIu hzyuf  t#jjjuuPhu{ Pjh5zjuy.u u EEt jPvXZjujju`EtPG XEtP8 Xu/ u' j/Upkh B@8Pt|@juh$PUptUkh B@8PL6hLzUpt"kh B@8Pju1$jMhMh뭋Uptkh B@8cMhUMh9h4zju -E tP_EtP^}t"u [EtPYEtPh:zhUWVSP]u EPVSG uBCTu6jjjSu CTujjuw,StV_uV e[^1_hjS, ސUE P}RPuUju uUWVS(ExvEJE xx@t04D4%tF܊Ё4D4%<\<|< F؉t-9t&\tFAV9t \u\FAF9U?EE@UBLE܋BPEjEPj'R)t e[^_hj_XACS<C@A9SEt1ÉE xvUWVSjjhEPuVv JF@|x.t 1ҍe[^_h^ ÅX5jj1IQShVguF@|xuk Fx8tjjhŃ4SVt rUtF@|x/jjWEPVoraWV\[_JhShEhW.jjWEPV(V^XhVZYUWVSLPjjjjj6TSu I1IQVEPS虌,Su;e[^_UWVSEpF|x}}hu1}t^{E} CtF1} IQu u CtC 1ҍe[^_CuWu Cthj<ÅXZtF|tF|XF|^|C;jju UWVS] SuV}Z1҅Yt e[^_t { V}tH9C ?1ۅÍPVu/j/VLtqtdrWt=t1}tUBt;xttWYdTWhju WhWh@hVjZYtPVu/ thrZt?R1}tUBt;ptt Vb[/T WPhjuxWPhWPh fCt qUWVS(Exu!jU B 0u茋e[^_ËM Ad@PuY^1}tEpt UhEPjuE}tE̋U fB|ftBlM Qd;QlZE @l9EEEUEU BdMALBdRl9‰EU}tI1}tUBtM;Htt#uXU Bl+BdMAh@Ah1T+]Suuut1}tUBtM;HttuZTuuY^uMM9Mw@EPEPjuu "EU؍T1}UtMqE;FtE;Ee]]܃}EudU fB|f%fuT*4D4%}t,E4D4%tME΋Mt[ߋuEEEx}t*+E+EHMAPEEM9M+E+E+EHUBPؿ R^zE8)tWh̃GZYt ECE EC}SEw4D4%/MERt_WkZPEPuuzEsU؁T;VxwFxNtETMFRFxPvtuXz-FtEHU BlBAl~xvNtFxEḾTVhFxPvtuyFth`juUWVSQU fB|f%fBxGE pt #t2jWE PtBpB0pSjjuxae[^_À{uȀwcEPS t Cu}UWVS} Gt3uVfG|f%PVt e[^_3Vw[XtfJ fG|f%f PjRVu1렐UVS] fC|f PClPCdPSuVuClFLCpFP1ҍe[^UVS] fC|f PClPCdPSuVeuClFLCpFP1ҍe[^UVS] C|PClPCdPSuV#uClFLCpFP1ҍe[^UWVS }E0E9ƉEEEt1?BEDjjjEPuWEPEPjVWu_}u EtauuuuWuAGTu)jjjW%u GTu F;uE1ҍe[^_úhW XZVhMj ]S]*jE @ 0WzUUVSu]CTtECTt 1ҍe[^jjjSsu CTuhSuY[jjjSEu CTu%tjPjEPhSunj%PREPu SdT5UWVS ]} Ek Cx8t(jjjEPhTSETuEPEPj7Sxt e[^_j jwuVuSu֋Wj^jE@U9йt)QVuSuCTtjjjSu CTujjjVhrSEr)GS;1:UWVS }8k0 Gx8tMWk T8UUM}UE @ E kGXEkG]}uu;w8Kt[U;W8trEuUPhWXG Tu8jjjWu GTuKEEuM}9EUe[^1_hWER^XuuWBXZuPW2Y[0PW:^ZE1ҋEu])ӋU;W8nKdEu PhWjG TFjjjWuGT#EE;G8KuE0UWVS}EPu +4P44P0Ƌ4|3 4t=vWYe[^_UWVSPP] EE};t-4wD4T4C@ 4t"E;uӃ}u Ee[^_W[EWXUMS4u1]ËQPC4PjQǃ4UVSPP]{U tSCLECPujVEBdPfB|1ftJQQjS<uECLFCP1ҍe[^jB 0St㐐UVSE f@|f%SuV ZYt e[^SVgsZYuۋt 1 UWVSĀ]C} |GxEt'H4Gt0@x>!E{}}}hu2lƅXZtEPV@$HZYthujS e[^_ËEf%f=tf=tVh`jSjV$jjS>t?jEPGdPVuSLtGd}CLt@CLzEGduhjSk묋GxjxVWSt14Gx9t{HtFWGtt0ۑFY/ u tjS|ZYuljGtt0EPjGdPWSf@USLu1ICPCPPRSd jG 0SqGtt0hSpI + t(Gtt0hVzS+ S^hSvXZjjP}Xj G prC @EMxVWSqGxx t jGt#OtQEC f@f%ftuS[Y^rA0SQd tC pC pXC fPf? fPSjpS jS»ZYjjPS:HxEdFtk\ ||8j /\UWVS]CEE]8UEEEPuSm dE@1u9CTjjjSjuCT}tkuUr,WjSuMMGEthu jSuK}t e[^_jjSMh 1DPVSEh1 tu胵Zuu_u}tUE}t1늍EPu S$uuPhjS$}t1tCt;ptt V^뵁T멐U鎒UVSPE Vxx]t=@tPEPS)utEC1ҍe[^1UU fB| Mt< +tj B pQmøPrXQiuո1UWVS]CpE9EEEE9CTjjjSu CTufF x1ыETC8UH9Es2}tEhsSXZF pS_EX6nhUEϋCTt e[^1_jjjSu CTuhSZYh jSUS]E t-xxtPS YZuS#Z1҅‰Ћ]h`jSwUWVSWjj4}W " t e[^_h^@ @@@@\PjE@ZYsTc`cdVhht@j @zVuCPCPCPW @T& t/WTY?GT 1$jhDhojhlhs^jhh{M$jhat sFsFjsDjs: js-sp tFkh GX8j/Sk^Zt'@jhPSghLzSjW j֋hh5zjWC tP^CtPYh?hmjjWKUWVSt HuU`RуdDžlDžp tlRjjtP`B@Pd)ڸ)Pd`p d;ds7 eEPS  C;drɍ99dalPjjtP`B@PDžlDžpt ~dHhPud)ZYtu e[^_SVhjuOuSVu[@uhjuS 믋d)SWV3_d hPu5^Zu)PWhjuT{UB:Rv1PRY^hj^h~R@AhUWVS(EP}WZYt e[^_ÍEPEPjuWu׍uVuuW}1ۅEt_t UE考EEuuu EPEPEPu WtU}thjW E}t1tGtU;PttuF_UTE؅tVPuWtUE9t)EU؋uusz ;E؉tt h~j_jhsE= Huǃ}`1ۅt_tkU;SttcEE;Ew5u؋EuEPӗEEPuuWPEPuW~WE먋EE쁣T;CxwCtE̋CxETxPCxPstW+WCtPEPjW W~EE;CxwStCxEÚTPCxPstWV2CtEUWVS]{Džht Hu_G9DžlDžptAt/p t;h~hG9ulPjjtPh@PtX1tJ_G9Ct@tuS!^te[^_hjS|UWVSpPuv[^1ۃ}tEXt UhlPjuDžlUvPEPDžT\hW\r( F&P9s3 EPS C9r9hP)SVuXt hDž`Dždt Hu\Pу t`PjjtP\B@PHu&XVPޓPX XVu t e[^_XVpPj@up9u4pUBL1XtXHUBPjRBITXZ1}tUBt P;PttP_ThT)PVXpPj@upusu"tMFItItt?8tGKt78ut/GF8uKIt u1҅u}tE[^_1UVSutXVQCZtPXCtPXjjh3Vs ~Sxdže[1^UUJQA9tuA9uTÃT UWVSQQhʍHnZEt@E=˄E˄t#U=Є8Єu!EE8ue[^_5pjjh09 u5tPh0=hh0Bh0jjh0$uVYG?zTE0}E th0u-^_}tujS }tuhgtSG 18u UU zxMujQXZ1҉ËB prtQ uUVSjj4uVi u~ptzkh F@8PhhSFjjVPjSu V40VjËF pVڍe[^ËhUWVSEXjj4Pu udUt}VtVuhuru[ tjjuPude[^_j/Upkh B@8P}\ZYt|@juh$PUptUkh B@8PhLzUptkh B@8 UhPju$jVUh뭋Uptkh B@8cUhUUh:h4zjuhu)_XjRZYtjE @ 0uYjju\E JUWVSVVu] }jEPSY @u$8thhHjVe[^_ËUЃ}t < < EPWVǃ1р}yyzPEP $wPSvPhjVH,}J1tFt;Xtt S[,TG< t< tMu~tw}< tZ< tVEPWVǃ1эyEPwPSvPhjV(9G< t< t1~UM1ҸP9t"BvQh'j(hË@Uju uUju uUWVS8]{k Cx8uhjS1ҍe[^_ËE jlPE dPjS謕uҋM AtEE<><<1tst UrhEPjSE@IjE̋M u Idvl9EMuvb}t?1tCtu;pttu豽XU Bl+BdCp@CpTߋMCPKLCPPQS*I 뤍EPEPjuS7EEY1M9EskuuȋUȋM؊< o< uPЃMk CH8&k CƉu1v8)E؋M9Mr}1;}r+u91t{]M;OtQE;EUEk C;p8r+ Btk C+p8E+t  EBNuMu+MuE+E؍+EPuuSuJM9KLtEU9Ueu9uEv )u܋ECPҋU+U܋CP9r)ЉCP1tCtU;Pttu臻ZT; PEPuSFEE쁧T;GxwGtE̋GxETPGxPwtS>FhGt‹U9SLEEԍ481G~xvVtFxEÚThFxPvtSEFt뾊t)k Cp8uԋUBEB<>t<ZtvEPWS8StU9ӋEt,M9΋UtMW%Xu9u9ujjuWuuLjjju- SHKUSSE f@|f%f]ujS蕷ZYu!UCRSZYu}t 1҉Ћ]jjS+Q 萐UWVSE xxt8@t@Et'?4D4%tCMuu u(e[^_Ã}tCU4UD4%}\Eƀƀމ]؊t;;Et3\tU؈CBUߊS;Et\uU\BCUC;EOE>EE@SEEE ;E%ɉEt#;Et~CEt;Eu1ۃ}tEXt U}EEU܉UE;E\tf~uDUPtEkH Bx8t$U}؋󤋂CEE뜊U؈CBEU닋EH뽊S;EtI\t4~u΋UPCtkH Bx8u뇋EHE\C@EEC;EUE҉t/u]UYtQNju܋M1}tUBtU;Ptt u^XuuSu uTTjjRl 1}tUBtU;Pttu ZTP^GC#uEPju @EU;SxwCtE܋CxETRCxPstu?QCtUUeSt ;E2;Et CC;Et2UuEǀǀP_CjPjjERP |jjPfLEjPEPE}P)WVuXEjPEPEPWVu!UEǂCEjPRZRYUVS]ҋu t^t-jP~xtFtPVSe[^1jPjjRSujjS*KUVS]ҋu t^@t-jP~xtFtPVSHe[^1jPjjRSFujjSJUWVS4]{}CPKLk| Cx8uƃƃE1DžDžDžtjDž8t*E iw-$hRU B\UBEzu֋E8u u%t j U B pSIe[^_t3t*uu thjS 뵋M E Id@l9DžDžDžDž Dž$DžDžXCTHjjjSuCT%(RMQjStZ 1ts ;Vt (;$? u(󤋅E(DžDž DžDžDžDž4Pj EPuDž4Dž8<Dž@pn Džu(84 u@< { 4(<ҍ uDž Dž 9 r B 9r BCLCPjS]/ZYjjh:SN PSjjuVS裴gE܃ Eqq~ y 1<@19Dž|I9vC\҉7P^ <u󤋅< <)Džtt yt,t#ODž9a 9vE=s҉P ^ u󤋅 1҅t19) ǃ RSJ9SXtSXC`uu tYDž DžX3u9u$SL;CPCPPRS6 1ustSt$1tCt ;Ptt&袪_u}P芪[ThRjS 떃uuwE @h9KP0@hWVu ShWVu ShWVu S)PRSںEFBC\;rDž bjjS 2PRAZY 9vE=s҉PʧZa u󤋍 1҅t(19)) ǃ RS苺(PURjS1ts(;Nt(;$u(󤋕U()9ЉDž v==s҉ukPbYtK u󤋕 9jjSz PR_ZP$PSV2(T;Fxw!FtFx$TPFxPvtS1Ft뼋)PRS覷FBC\;rjjS LPR^_0jjSg PRZYx  1481҉CL9׋4CP|I9vC҉P`_ u4󤋅4 4PP PPEPSDžDžjjS8 gPRͥY^Kx CTDžrvVS薰_XjWVu SiuWVSq uhj,PS.,@EDž @9v==s҉u_PZt?[E    MjjS PR|^_uPS P$PS.R(T;Fxw!NtFx$T\PFxPvtSR.Ft1tst UtI(DžDž$P$PjS-(;FxwFtMPFxPvtS-XFtDžM I\Vj EPuZE 8uHE(8"tHU BlBdDBlPS˴YZE lPS&YZvt'tjjS }hejhy!,,0 DžDžu%@tEjjh |5jU B 0UWVSQQE ]Ek Cx8tEk Cx8tMtk Cx8t7u} t)?4D4%GNu׃ME t @E t }E nE JEPEPE PSU}tEUE@P9U^Utu MEE}t"1҅tSt Bt9E u YUt&E uu u@ t'E te[^_uPS) E t @E t 1뽁TzjjS P聞E_EPEPE PSEPEPE PSNMP謲X4P萲XRɎZ])UWVS}?E 1ɋ1҅]uE}t3}[[*v.mBEMuͅu1e[^_1tst UEE}?M M}Ut'E[t.[\*t$.t BEMuًME )ʋ}mPtkH Cx8u\B}빃H\tO~uPt4kH Cx8t׋n~eHу}EMM<<G*t.t\MBcPtkH Cx8=4H[t̃[>u~uPtkH Cx88H쾔\REPjS&ƒҸU,;VxwFtEFxET RFxPvtSP&ƒҸVtPt!kH Cx8sfH\tC~NPt$kH Cx8.H} EM}2~PtkH Cx8i6HUWVS EU01ۋEtZt U 6EEE }t#Ds~tW ^}t u[uu PUru uj ja[Xt___ j,j`ZEYtGMY9_ tGUPMOORO vuCEXZMMjjuuCP.[>~hهjtUWVS}9tzC0C9tZE f@|f%PVW uCstVSW> 1ҍe[^_sv$v W h`jWĸjjW UWVS}9t{CpC9tZE f@|f%PVWd uCstVSW~ 1ҍe[^_sv$v W8 hjW(jjWW UVS] {ut[F 9CtOjuV[ t e[^j jsVquދ% 1sVoCZYtUWVSQ} uuwVdoG[ZtEPVve t e[^_juVtB O;N trujQuPpuAGpjV]PUC$C(% V1jujEuBfUFJ BF f@fAjEpPyUWVS E9 M Ax HU BtEj EPuxx‹E 8u`1~99t;J~ 9t/J9t%]U fB|f%Puue[^_uhjuֵߋ}19yt9;t,C@@j/PE#ZYtB@WPu4C t]9uh uju~9t;V1iE뺉UBjjPg`UM9tE f@|f%PBpQjjQAUWVSU uXF 9CjuV6 t e[^_ËSC BCBF fHj jsVmuƁSV-Z1҅Yu;] u98t1PV[^C FLCFPUWVSE9‰EUEx8"EUBTjjjRxuUBT`E9ETUЋr9E;phuY[F^1эQD Pjjhu裩U9rE;pt/huE6[9_sUEU XtʋUR8ЃUv1ыEQ#9vSRE9ptWPhqu whuXZTSjjh.Xuh u e[^1_hjP]jjuUWVSEEU2E 9֋EPVu  FEF9Et`EPuu  U9VM]QA C9QA EA EEF9EuU:GB9?GEG6;uQUZt4EPSu { uPUG BG EۉG űUBu 1ҍe[^_P<G^ujju ՉsY=UEPUWVSj\ÅXt6u E p<C_tE1ҍe[^_jju苰UWVSPP] {E t C!Eu…Xt5׉ދMB{BB BtBBE1e[^_jjuUWVSPP] {E,t C-E{ t EC$@Eu[…Xt5׉ދM{tB(B{ t CB@B E1e[^_jju苯US] Eҋt CBCsS1]ËCA UVSE] SC9t.C 9tZBACJ9tCR̂XSC9uҋt9tCBSS褂e[1^ËCFC뺋BC UE UMt$ru1hQjR觲hE'E Ut藋UWVS EXۉEtSuUZ^_uE EƋUt!Ё4D4%tE)EwuFE8t@E1e[^_jdYtfE@PSCZtCCt/MUCCUB CB Z SKjjut jjucRr[@UVSu9tPVYX9uCtPVXCZuCu e[1^PɀXUWVSSS} =]tKWbPSEi t"UCPSLCPPRS 1e[^_ujShjuWuVVSEEuuǃj(WYZYthj)PWVVSltuj1;UWVSu ]}t$ЁI4D4%@uCր;Ct!Ё4D4%@u؀;t$Ё4D4%@uCր;t{Ct!Ё4D4%@u؀;tKEt ЁwS4D4%@uCڀ;t8t:t M8u 1ҍe[^_Rq^RsoZRjoYtR^oZ5RRoYRFoZUWVS} 1ӍC Pj~QYs_׃BB rzu }u CuaPhFhSwhSx3=hS| 1р ? ZuPPPPt1ʋэL ,Qj[P_XtmC(CP mIKKAK QlQ S9AtX Y1e[^_ËI4YQ9t PhVu ju藬@|렉߉Ƅ UWVS EE} 1MUE PuNju6OÅXZC{CC s{u MEp1t'u SVuN6uٍCS9t ؉Se[^_hVu ju跫t#EptVЃtt6uS;{1NV hvjugNˀfoUWVSjjE pb tvEPt.}ZY;jjtjjuj脅d@dEPduppPuhhhp9ʉUs: tUB;pEsz uE;p8 ]hC1EhEhEPO_Xt/t#tFى`1I|≝lڃpU҉\_W1щXIx8luH~_ZEPEP`u u|ExD0PjjLU@(҉CtuC/E}|{A`󤋽|}{{GxC${ \XEMQ S9At EX 9YudJ}[^u.tYu 1e[^_hoju苤 hljuw 뾍EPuu菳EEPM quzPuhsju9,}t#1҃}tEPtBt9EtEuw^}o1}tUBt;Xtt SwYLT=T{M A t~~{U B UWVS`E];/u tEPSyY_ue[^_j/vjDžXZtSvhEhS葯E/PSXyu~E81IEUWVu} )љS89sC< u9t2VSu Ht,މ)љ89sC< u9u΍e[^_ÉUWVSu] 9}r 1e[^_VSW'ƒ ҉t~9sۊC< u9r1BuUVS];E ut/9s+ t$ t 8u>C@;t9s  t u;u9s t t[^118DUWVShU 9Et9u URXj jjuQU S9RYU XE UBL@CBTEe1jjEPu{HEH $UE;U t+CBS;U tSQ^Ee[^_ËU CU ЋC@;C 3E&$UEE tCt Cx\EEtC@S9j jju|PtiC@EFtt^VsSju؎u>1uuVuE ‹@F9tU B0E p2VuEPjuwuu|s[Sz.ESCE@t/Uw74D4%tE t SEK CRcZɋC9CwEtEt;1;ss+C?4D4%tF;sr;sEKSB9nEEw]K}sCEEjuU|CCXZjuU|uuSuRREPju5GE넃s;KSuY^t C@91`CCUC@j RgbYC9CE PC PsuCEPu}_XPEt#SjjUrLRM@QuuSu+Zx ^@"zUWVSu@]} Eukt,tMk Cx8twhMXZuEe[^_Wwwh=o ׃P軄YUWVS U} *k BX8Uk Bp8W19EUsGU< AEE9ErI1)19Ew 1)1҉)Ѝ0E9v)UD;G wGE؃}GGtGW GMutGW GKu1ҍe[^_PG PwuRtډG똉1)6EEUWVSSSuFLEFP}jWj'VEGu7^CXx ȀCXC4C4t=rStEFLGFP1ҍe[^_WV腊ZYuC4WV,ZYuC4wUSh]Sh@ShShSې hS͐1]UWVS0U BxEРBoH>BtF4D4%$E344=BEРBt2SEȉƉU9҉tEEЋ8tEċu9uEЃ8t}tVf@f%fuI}t3w-443shuYe[^1_RY֋Mqqhˆu-}It }0IuEIEpphˆE0IR_ER=]ZEЃ8rUBT_jjjRruMAT9}РBtQUfBf%ftlE[wR44EՋMЋEE]BM؊BAuUԋMqRj hՂuE:R[Z뱋EЋtUWVSPU Bx1uE$HBtxtj B pVe[^_Ë8~,[]~Z{u2U zxt;u%ujE lPE dPVRe[^_1IQSu V*uҋU Bxx"tjSV몋E HtF f@f%Qf:tWV0a[XuWfrA0V" tF paF XXF fPf? fPVjpV 맀{>MЁw4D4%CRRZ@l@PVtYZM;!pdk\ Fx8tj U B 0Ct!Ё4D4%u؀;uj U B pj1IQSu V'&U jBt@0EPЃlPPRVZt1hVY[RP_N\RPZ9jBiUWVSxuFEE}E8tU MEEDž|A9dE@1u5FTu|jjjVfu FTu]}$#EPEPjSVmuHuuju:=;Eu0uj EYC ZYuCEE9eu3F[tiF@XtGujY}$t }tM EUM e[^_jjVUh hu jVŽ뤍EPu=$`ZYu Ef%f=tuFj[1ۅxXuz=$Nb_?1|DP|VEhDž| US]{U t'jBlPBdPfB|1ftJQQS4]jB 0SHUWVS}u  fN|ȃf^X%Vd@EEUf@ tptEEFdEDFl}t EPWRp[Zu+E9FlvFlVWxyZYu}tEGL1ҍe[^_9v )@FdVl럸9Ev)BFd^dCtFd=t=H7K9Ev)HVdFlVWxZYghW EFdFlVWEx9hW~EPDVdFlY[K9Ev)؉VdFlGLEGPEjEPj'W9ltkd GX8KdjF 0WUhju膇ÐUh@jujÐUVSS] EPC PCP3uVhht$}u e[^hPjV C uCC1PsZYuCCSCUSS] Ct~t1C PEPj@Pu9ht C1]ËC USuCCPR芒ZYuCCCC뷅u"C HS9tBCSCAcUVS] {uuSw^4D4%u 1ҍe[^SVYZu{uSw4D4%uRIJZR@JYUVSu] SVYZu1CttuSw4D4%u1ҍe[^RIZUS] C$YtlC PCPjBPuft ]ËC uCC1PsYZuߋC CHCSCCˋCu1;CaUVSu] SVjjjjjjHlPlPSu]jjjjjj,`UUWVSEP ]PSRu S1ute[^_UWVS u~EEG|xhAj:u VC^xC8TkL Fx8tSVZYjjssjVkUVzXV&V\nEPVuV}tF,E'}tEPVZYuu Vm[_u}u 1ҍe[^_Vj ^[g؃L{w EySV[_uUVSPjEPj]sLSu wWt1CLCPCLFDCPFHF0% F0e[1^ËE9CPr1҅tPSPUVSQ]s~uSZuEPSV t e[^juS tu*֋NAUI J BC f@fABLPR\EZxLYu@L[C1zUSSSEPEPj]sLSVt{LtPEuhjSuЋ]jjPujSRu݋CC1jjS5UWVSW]Cx} tOC@s@19tCEPS[ZYtse[^_wwujS6X‰sS ^uUWVSu^jV",DžXZtCPVS& t e[^_jjWs0-uC@`X1s_ŐUWVSE x#U B<+t#<-tjB(pue[^_ËM A1dAJhEP|PxPE p4utTt}thju0s땋U R8dd;|s0x4D4%@td‹d;|sU ;B8tMAPjQ[^|xd+d<0d<0Vtd<+<-d`DžXrx =``;|sy  x`=`<8<9``;|r`+d1ۃ}tUZt U|2Dž\Džt`;|gdx WjPlPtURuZY\t)1}tUBt \;Htt\DX-TE x+l;hr+hllVXjdEP|ǃdx\pWE\PdSY|+`xP```S+d&|d+d)$R\E p4u|UÃ:l;hh j jPpPEhM y-hp~~)9غ3xF pu Xt!pXjdEPm{ǃDžXrӅy)9غsdVxP\ \\ tPtPju\)|2;Cxw!KtCxt\TPCxPstu5Ct뺋x`8<j DžXrB1x`=w:`Ph70[^1Ћx`=w11*d@`DžX A`=w>`<8<9DžXi1̃/D0uXDuE|u2uS/>dže[1^P>XP >XP>XP=XUSU 2M]EtU2<&t1[ÊXtkP A@8E] M[?PIuċE M[鷅]tk A@8E 븋UVSREPjju v4]SKuE1҅tPSPStk@uSRXVSe[^UWVS j} WuV5ËW4EdžVLPEPEPRV J tD}u e[^_ESG1tGPjjuujWV7θUtϋFP@9tFPʼnFPUVS]CPu CPPv4S u;Stk@uSQYu ]e[^ e[^UWVS ju V}W'ËV4ELJWLPEPEPRWI t}u e[^_E}uSF1tFPjjuujVW6ȸUju uUju uUWVS j u ]VSu {LǃCPSEtk@uSwPX}tvjusLjSJt e[^_ÍEPEPjCL@CLPSdHuҋSLJWF1tFPRjuujVS5뭸jusLSeKuEPEPjsLSGiSLB땍EPSZMZYJ}1EE]UWVSu F0%V4 ;V<}F0;jVWEF0 LJEtIF8 k Gx8t!F8Pv4W MF4GLF8GPWtk@uWNX}u F<9F4u؍F>+))(tBE)H M A4EԍEPuU2_ZtEPuօZYWEuE9c;EuOu΋Eԋ] CE( ]t=][E]{t}E{E}E[E<뢐UWVSu F,t@ t~8eN0E~4UPRjWu8cF1,^EEEUREEPj}GWuf8}EKtREM< <.uUUvU|:tA8tB< tT:AuKuF,t3@ t-E܉F<1}tEHF@F4V8FDVH1ҍe[^_É~P3 U|1e[^_P%XjjuQ1j1IUWVSu F1 }F1t~^Kt`jFDPF4PF1taFPjW跅uGFDVHF4V8GTu/jjjW+u GTuKu1e[^_ø1랻{VWXZdUWVSu F1 }F1t~^Kt`jFDPF4PF1taFPjWuGFDVHF4V8GTu/jjjW8+u GTuKu1e[^_ø1랻{VWY[dUM A1w$dd2EQò3456ܲ7ز8Բ9АUEPjPUWVSUWVSE @1uX~G9lȃV@txkd ;T8sIƒvPjE RUSj] C1t1CPCjRy@DRjpjjPW]VUMt tRj jju Q&UEj jju P UWVSWu41ۅt^t U1Ewih0hhuWLjj@PWu VÃ01tFt;xttW^ڍe[^_ÁTPEPjV՞x;CxwCxE{tTYPCxPstV薞tCtUWVS] UC,u}Mt @ tFutrfRjWuC uhjV>RjWuC4D4%BE<)7<]/<"'<'RZƒ?OEPu6Y[1ۅdEPugZY-}uUw4D4%tRR[R[0EPu輯[ZEPuZY}t~8|UE jp4u:1ÐUWVS]CL} uGDCPGHSYCLCPk Cx8t$tzk Cx8t VjjujjjWSb$t e[^_ÁSZu܃{4tGDCLGHCP1ƃ@烻닃_UWVSu~4BBF@FDF<F@9FDt1k|9s @BCBB 9r扑@.BP@ @F@@F@FDF<[^1_UWVSu~4N<FD9ЉV@9щkF<k  Fx8uB9tOV辶[u=9uߋB9uLJf1e[^_øB9uЃ 냋FjSVCFVl;^@v&3UWVSME@ΉUxAx9}t90BV XE PuWuús9vXUBLCRP}C8St*E* MA)@C(E+AHE) C E(t } D0CC$CE*@tESK CCC$E(U(@DžDžMk A@82MA8+TDž,DžtDž u Dž E(Džt%Dž E(U(DžDžu11U$CDž0BLCBPjRDžDžn^_M A1 BEԉ$ju0tUus\MA49Dž0Es)щEȋMǀ\ǀXǀTEPuMju螂BH :$hhMe[^_ÃE(z vD% Dž E(U(t!kDȉtDžx AZM~+B =(AHw $hU(EKS$9wC8tB9rC8 $t E*UE(tC tHKC E+{(tC C+C(CE(C@;C wySCCtHCjsuܙ EE*tLEuCU BDCBH1PC Psu݉tChExPu'YPExPu- CPCCC(PCCP uESxPu#1$PSu U(nT[,P(PR PSu%((E*t)‰HuE+UBujsu: 6tMADž\uTtMu 0uUBu1CMALCAP1PQ~^_uE+PSu us)QjjQx 5WSQ,ZYjjh~jPQjsu 9m  t Dž $t E*{E(tC tHKC CC4CC0Cjsuj K E+C,{(sst,4D4%tFOC,ԅu6t->4D4%t FC,ʋB PRVuGEUxMA|F9QxUB|0F C@ME(q|~(Ft1IVsSjucDžFFXu\u TF\T ;F vPF PvuDkF\XTPk AX8E pEEEOtL4D4%t+> t EEF˃}tEE1)E}a}u 9]R11;]w1)1҉)ЍG;Ev])ˋE +P9‰]ӋM )ËA)PV)VΰOE )X)X pt O FuM}t  MF}uMR Z UWVSSE}U u@E}]t-4D4%t EHCEu+]t#F;F w9Fu^Suv^1ҍe[^_PvFPگ PF PvWotȉFR4Yxu F먍EPEPjRWu(UWVSu} ^9MtlS4{(Su[{ uUC C C 9t7FBVVjC@Pu~1҅uڍe[^_ËFGǃ!Athju UWVSUYk B@8EU'k Bx81E 1;ps7U B< <kUB]FE ;prɃ}]1)}}ElU B$B9BZ] CK$9vSD< < 1E 1;ps7U B< <kUB]FE ;pr;]r_11ۃ}t ;U BE u+E u e[^1_jEPu uD KujEPu u+ Ou1҉uE)Ѝ1;Ew#1uE)1҉uE)Ѝ0G;Ev݋])`Puz_Z91uE)(] CHC(9ȉCD< t< tEME1)UePuYZ/1uE)]]]UWVSEU zDž ] {OsDž4D4%U ;zt;z$t O빋M AQ@);A v"Pȃ PRuzktX] Cu ~8:*jjjjjjSWvSuj$t e[^_Ë@PSuct 1뿋|x z]Pu VxX~ExP9s19s81xtGt+BAKtuՃtE )pp(U z(t2U B(AFHBKB(tku΅tcM AQ);A 2E xXX@ Kt$KAFu܃EPx0Y[Ef%f=@U B(ыAR@);A wGu F ~u$E @M A/DžiPW@P膨 Pȃ PRuMh'] CHU B(PWPD Pȃ PRuhu FA98tx1эY99ۉxEP0_Zu Ef%f=@t lMAQd^Y_AuFVeRY0JDžAUWVS4E@Uj/E0uY^EtTM u +NECM̉]؉uĉE~2UM9Hű>9ɉMăE}΋E UEĉUE~KM]1;t%<kuF]Cǀ;u;}v}MăE}E܉1E)ЃuE܋%EUB89EuH1u9E EY1ҋE uȅ҉tFE9u1U;}ȉUEPMUMQu~Phu}Et"1}tUBt ;XtSYMTuE 9Es2Eh+EPhu%UTurG;}ZhudMXTZuME9u"hu=^_uTu&u[}t Ue[^1_ËE胠TׁT0EPM0uuROËE E~&Sh(uKU Tu Mă}ڃ}S1}tMAt;Xtt S[0T!EPuE^ZyE(UWVSQE} HWE< 5<k]EE9v^G;G ]G )WE__(4> tcU;SxwCxEstTRCxPstuTCtÐUUE @HBHXB@4UUSMA,QBX] x:ȀBXB4B4tu5CDE M[CDE M[C1 u1z4@B4UVSSu ]tEPSZYuE9rjjS  e[^hjSUVSV] ۋut7EPjj3VuEH9Cth jVA e[^jjVUhnjuUE Ut8th`jR hUhjuUVS] Kut&w)4D4%1҅t KFuںe[^R5ZUEUM w\$iEE U[EE EEQh֔PR QhjE@Uju uUju uUWVS$u F1}^F4EԋF8E؍EPWRkZY9Et&uXU84D4%t6F,t@ t}t EPWlYZK}.KtxEPWMkYZEt\u"U4D4%tuF,t @ EPW9lZYuY}tKuV,tB uF49EtJEԉFKf}Eu(UI4D4%u }_tEEPW\fYZsE uPU4D4%u.}Uw4D4%u}_u}uUwD4D4%tEPWfZY}gKXRZRZUw%4D4%}__R˰YR°ZR趰YEPW&eZY}=Uw4D4%4R`YRWZUju uUju uUWVS$u F1}:^F4EԋF8E؍EPWcZY}u&U4D4%EPWfZY}KtgEPWeZYEtKu"U4D4%ttsEPWfYZu;}tKuU;V4t1VZYUMQ4E J9ЉAE@u5w!kFXPhjV?EPV蓯_ZEu GVL 1҅^jEPjV( } tEt UEC룃}}r}FVd[hrjV,ijEPjV M} tEt UEC=w}CPCPV 1҅K0EjPjV, } Et EECI1jEPjV } Et EUU8cEu JEjEPjVw } fEt UECK0j tk Fx8-\k#WSV 1҅C1ECc0C1E}t jjoj}WjV 9} Et EECK0jWjVS } BEt UEEh@U1}E@jURjV} Et EECK0UjRjV<} Et EUUeEOUWVS\]C0% B}u E EԋMEtEEUUS0t"ECMԉES0E8dC(=\kEB1C0Ɓ t%C0ŰB%M EԋALE؉EEAPE܉EEEPQZYt e[^_sǀY UWVS EPEPjEpLP&E1ۋxP;}s-Ef4D4%@tG;}-EE4D4%E<_F;us5E1ہ4D4%uyE<_tp9]tŋE);4Ev(P4P0uB.t'0u}W0Bn0E1ҍe[^_ûR蠓ZkE9R舓YExPjP#[^hjuRQZUSQ] DEtYD;Ct]E$cj jEPju艦u Z1ʃStYuE_yE_E$dUWVS E }E1k E\9wOj EPjW޺u$E=w#uE1ҍe[^_1j EPjWDuE=w(ujhjWu1UWVS}u1 ]SjVW٧u$FH1ۃ wO$lk~uȺe[^_úGWdVW!ZYuVW蚬1뿃} uUWVS}Dž0u\v Dž0t4U +O@G4iҫ9 9t Dž0E x}8 pWPlPW`pjM +iPW`hPdPjM 1WsE)Ѝ09v$4D4%uK9]S4D4%tKۋE))u)~ |0.)SVu uCu^UBTu*jjjR#uMATuuuuuUjuMjhjuKpR{Z;E܋U+X0ÉE.R{Y 7M؉R{[jh\EPu`jhsjuO EPjQd OWSju!M䃡TudXpUWVSEU@M}lh\@uj uIl ]\dt\+EdhXd]ЋK89v)щdUB4t+h\h\U;J@h\jUB@R49rBPulhU\TB TMjjjRɏuMAT'} dJtE`BTXX1 kUB]TM9:k]CXOtTOBATu`X`it9T} t}ullhdǀXU)U\XtEM}\te[^_ËhXPpPulp jjul\ hT)SPulX >VuDZYTt)TTSulXT Vuވ[_h @jjul\ jju \fЃf4Ah\TfjR@9sLBPulullu>hf\TR]C@S49rBPul UWVS$u} FfXEu \w%1ҍe[^_Ë%uFTtfF9t @fft jjVU\\ vLF49Es)щEEԉMǃ\ǃXǃTPVXZǃ\ǃXǃTjjjVFuFT 1tPWV ?PWV+FjVYZjhPVǃXǃPUWVS,uF} EȋEPEPu UpUȋT o@VFXEȃxlt` UȋZltAss sVEtCBCs -S'XZUȋZluf\1҅tu e[^_jVWjSS1s8҉tAut̋苃9u뢃 UWVS(]Ek Cx8tE} |U u}t EEe[^_Ê8<k0 C@8E܊k  C@81}EUEEU2B Uk  Cx8t"UBPM1SU BRUBH؃ ǍEPS U9tRS]iYZSZ}tC}t MuWtM;vMًEËU;vU몿룺s}ԹSYHM}t>uVEPS uE;Et PSth_Zt}M}u‹ujjS jju S RShZY}tP}tJU;t9VuS tEԋM;PSg^_jS9^US]CjjSjSujC4tikPPPSCujjS薳‰Ћ]ËS UWVSVV]{4} st]EPEPSOp t;StjC@S49rBPSSuuSO uōe[^1_Sl[UWVSP]8}u1EC@9CD9Es}ԹS>YumM}t7EPEPSn uJ}t_}ԍuM}uɋujjSo t e[^_jju S劃tk  Cx8u}z돃 EtEPS1YZtE}tJC@9C3Ex EPV\ZYu,E+i@;E}}jjVcq UWVSQ]S ҋu tCLBCPBfJCS9‰C4B4EtttC@9CDtzC4HC@k{<󥋓kC<}t'}u[jjS# e[^1_j݋C4HCDCuMUWVSQu}}^WV,EXZUE ҉u'tPWjVte[^_Ã}tjC 9tYBAUCJ9t?juV t%MSCA9St CEC뙉K1땋C뾋BC륍C9t:FBCV9t#SCF9St C0s붉sCڋFC WEPV  UVSSuE^PVZYur}C9ttFBCV9t]SCF9StDC0slBǀEF1ҍe[^És뼋C렋FC h@jV\nUWVSQu~uV?ËE XZ1҅IV tFLBFPBfJEUF8K@C8V4FH9KD^S4CH"lkd C@8V@9ЉCj EPVk$> 8uE8ue[^Vhju Vh njUS@]=8tSh]Ã=t =Ttm=tՃ=Xũ=Tu?TtEPj >XXZXHXxD9u5h@|^?T_|U=thhh?5*hh(5 jFEUUVSu] hSVM: @tH)ƅ~i3?YuhX=Zt37{tCPsns hf@ÅXtjhSSnShjD'U5j jh`/jxDUM UBB9uA^BPQUM UB B9uAtBPQUM U9RuAvB@B9uAvBPQUM U9Ru2z~z~AB@ B9uAvBPQUM E9@u6x~x~ A@PQUSM ]UzuAC9RtB9t BB9tB9t @B9u 9Ruv Ad$ÉUWVS ]9[uuu SvCx֋}э| WU4ƃuE @>GWCpV WuVCpE5CpCPM Qe[^_ÉUVSu]9up>C SPSB s4$4Ne[^UWVS]} j3ƉCt" uF{t CxuG>udv{ \ tQjEPSC C \ C C C, C C H C$ C( _{ \ uEP3CFCF C FCFCFCFCF C F$C$F(C(ve[^ÐUWVS4Ehu /ǃEPWtuhP Ehi/ExvEUׅt| uHEEE;Es!UU܃RV-1ƃSVEU׈ VEPE0P$E؃EPWÃq V/ W;E؍e[^_ÐUWVS$Ehzyu ƃhV$3Vh E$B.ÃEPE0Pto}э;Er%EPS0ÃjuS Sh(VHEPU2REu S.4$:Ee[^_ÉUWVSu] }S6Vt9;u$S6Vu Cde[^_ÐUWVSu] }S6Vt9;u$S6V u Cde[^_ÐUWVSu] }эyS6Vt-Wsut#S6V u CdЍe[^_UWVSu] }эyS6Vt-WsuQt#S6Vu CdЍe[^_UWVStuu2~C(C(HC(C,>NDC$C$C,C(P~ SkE>FS(C(@C(C, SAE}4E>e[^_UUB(;B$u 'vJ(A;B$ry tvH;B$r8 uB(ÉUS]SBC,]UVS]} RS 0$Q2Sq)2Su[2S:t KcЍRDtF~Aw}$EEPVS EEPVSdkEEPVSeTEEPVSg=E"EPVSXv&yBp02S#r2S4 :tcKve[^ÐUUE t\}tV wQ$(PEPRl( EPRE-REBUvÐUU EÍvUEt ÐUE$ÐUVSuE  hZhPP=hh\P=ulhP蒝ÃtwN SKct| u HvRV"tPSƒu Sȍe[^UVSusj(jhvuE8usj.jh3u P WuVSe[^_ÉUVSuM ]< u9;hu d<u;duh<t SV e[^ÐUUE 8urj+jh b"vtPPRÍvUVS]u u>t7"jVSSVhsve[^ÐUWVS ] u}:u@{ t&Vut ?WVs C{tC${tWVsuve[^_ÐUWVS } u:t<tvS:t Ӄzu {uv P C{F> tw uqG Gtt atuWt wEG}t"}}t )t"UGN E0_G7 u PbG  uuVw u e[^_ÍvUWVS ]E 0:t&~txQ:t уzueyt_ϋqC;t$~ tNSF Puu6~ u0u FU FGFVue[^_ÍvUVSu] tr{ ts VC sVCt t-#vt#u{t s?v Se[^Ujƒt#EBBB BUWVS }u ]U>u RSW`:ubPRƒ{ t @Ps FPB~uED"DsCPW{tRsVWSe[^_ÍvUWVS }u ]~BC"Dwj5jh` h,w}tyPSƒ~ u-D"DvFPW<@Pv W@~tSvW*e[^_ÉUVSu] MEtett/LuF6t9RP1~P08t6;Pt 8t$0h<vShPve[^UWVS }u ]u>^F>@vv S 4D4%t&>^Fu >?v؃@v^u>\F>^\u>\F>\ tPv Sn 4D4%t-v SF 4D4%@u>+>\F0>F0>F؃0>e[^_ÐUWVS U}] ?t] C:u^C@Cvր:v R%4#L4ȅt$^C>u ?v@v>^t>\u\C`> t[v R3 4D4%t2v R 4D4%@uv,\C0C0C0CF>?t tGCE e[^_UWVS]hZd h<htgǃp`ǃt`ǃx` hDt/ hlu-[ǃ[ Se[^_US]dǃdhǃhǃpǃtǃxeǃMǃ]ÉUWVS Ehv S%4#L4ȅt3C~ƍe[^_ÉUWVS}hd>/tC<3/u~48/tvC</u~|uƈ]E3t9"t)؃Ej3PW PEPWC~E0e[^_ÐUWVSEhdMxtǀ|lPGv2:M B~ uuRjuUuGe[^_ÉUWVS(Ehdpǀ|lP2:"B~ u6uEEEjj(u< PEPuju_Tu`Fe[^_UWVS ] ޿D8u u &޿P8u u`e[^_ÍvUU t2E|tt DPvÐUWVS }u ];t{uVhPS:t@v09Bu2QhEw :tփSW|e[^_ÐUVSu] MBEƅ<"u.;Mh6PR PhO:ti9BuW;Mt_ 2h6PPPh6PP Phfv ; :u2h6PPq Phzve[^ÉUVSuvjjhsh:tCPQRVكC~؍CPQhVvjjh d:tCPQRVNكC~؍CPQdV/vjjhhVvjjhhVBe[^ÉUWVS,}uDžhDžDžDžV:-Ba$`dDžDžsDžg W* W); s3hCw ;uBP6hwC8<u Wt C14CPu6htktW@xtP<uRW)"<u7tW~@W(t+v|4Pu6ht'W PW?%W PW<4Wu46hwet'Wm PWy>sxt:W" PW-W e[^_ÍvUWVS u} t }t}u P2[PtZU[<\MLD[Ѝe[^_ÍvUS jbÍEPEPu ScuuuE$ocE]ÍvUWVS } j:E0@ƃE;0u vE+K CPǃSE0W;FWE0É<$tQuu uT;E0=t#V4<tC<ue[^_ÐUWVS u{u ;\C0F$ K! CAЃw G~udK[;^uS{xM{?t,Sv R. 4D4%tC;?t  vCe[^_ÍvUVS]މE \t\t /^t &- E Pt E @E C뭉Ѝe[^UVSu E;t"V3auC ;ue[^U帄ÉU帇ÉUWVS u} u   VÃ8tjPCV;u苆GGe[^_ÉUEǀ& ǀǀǀ & ǀ(ǀ$ÍvUÍvUEU Mu uu&  & v@@ÐUMU t}u ÐUS]E tRv#u;jjS"t&PjSJvЋ]US]`t `sǃ`u ]ÉUSE] XtXB XAv PS0&:]ÉUWVS u}WVƒ~@t F@lu;EPWVEt t v]uV;du hl"neE Ѝe[^_ÐUWVS u} 2u!,0v t jWv zte[^_ÉUWVS u} X8;y VtC;x>C8uBЋ CC8uB! VFx WV‰Ѝe[^_ÐUWVS uEFt VEFtY^$@vC;F0r +~$jV̿^$C{ { SVts Vz4$4$Ftu^$74vC;F0r+~$jVLt%^$C{ t{ tSV t^,^(} F(+F$U uEPEPVÃM;EPVЊEFD $F<F8 Vl V4$bF<F8 VF<F8 V4$,fF<F8YRF,+^$H V4$l4$|F<F8F<F8 V9, 65 VFFt V} tE tF$e[^_ÐUVSu] v S[ 4D4%tjSV u;jjV;džC u#vjj Vᐁv S 4D4%t.jj^Vyu jj?Vj؃@Fjj\VK j0PV7 j0PV j؃0PV e[^ÉUWVS]C E  }tq@;CH|_C CHǃ@;CL|.sLC 89}S DA9|C | [^_ÍvUWVSudždžj V,dždžEEjV^$;^,s-;^(uE苆EPV|C;^,rӃ}uE苆EFH++$$tA(u8u/~*K~jj VxKj VYdž$dž(jjV?99vSF 4F4V vHF 4F4C;~ʋ ;~K9GSV jVW"F<IQV"'FC; ~ uV uV"e[^_ÐUS ] Sn $ 1$ ~1$> 1]UWVSu]~cE+E9~Å~,E UL)E9r JI9sE UU UE E9s~FBK9s[^_UWVS} MuU~0 9|9#~ 9 >9s BA9r>[^_ÐUS]U MIt:tBCIt:u[UWVS<] M;t:uCA;t:t]π;tC;u9]s { uK9]r]9tA9u9s y uI9rME8u ?e;]v 9vKI:tC]AM]؉MЉ]ԉM̋U:tmE;}savU:uQ];MsE9s:uCF;us ;]s:tE+EЉ)9})9~MЉűUU؉]ԐA;Mr?tkE]U9s\E:uM;]s;}s:uFA;us ;Ms:tE+E؉)9}+E9~}ЉM̉]؉uԍvC;]rE+E UUE܉EU)E+E)‰UȋE+ẺEċE+E)EċUBPuE}~EE؉EԋUUЉŨ}~ EEU܉UU+UE)9} EEU܉UE@PuE}yUU؉UԋEEЉẼ}y UUE܉EU+UE)9~ UUE܉EE+E؃UU؉UԋEEЉE̋U)E+E)‰UȋE+ẺEċE+E)Eăuuu9uuu9}}+E EȋU;BH+EPRE9EtXuWu!uWUrHE+E Pu R])+]SEȍ48VuF SVEEP])SWu# SWuZl}u+u Vu,U9UtH]Sup$EpHVu P])SWu SWu8E)PWuE+E U+U)Pu!E}E+E EȋU;BH}vPR|E9Et(EPu E+EPuu6E+EPuuU+U E+E9t)Ru 9}u+u])9}+EPuU9Uta)]ȅ~/SWuuWEpHE+E Pu u ])+]SUȍ4:VuC SVEEP])SWu# SWuZv}xeE+EPu0E9Et0}~uuurE+E+EPEEP E+EPuue[^_ÐUVSMU u9s%:t BAC9r9s AC9rv[^ÐUWVS E@HEEp$;p(vEC< u } uCt|Uv R 4D4%tC;]~E=Uv Rc 4D4%u;]~+]vG;]|GFE;p(;WuSuJ)e[^_ÉUWVSu] S)VFFF@F;FHFF@;FL|=NLF89}VDC9|jhW)F| F ~PyFQt, j ($ j r($ f(e[^_ÍvUWVS uF(X t!;F,uFH+F+$$t VsӁv R 4D4%tt@?j^V.Ӂv R 4D4%tCj\V`0PVH0PV3؃0PV!Y'e[^_UMAA;QL}AB;QL|ǁ ÐUVS]CPtNjS/; %vVSsHSF; ~ރjS{( Si$ &$ y&e[^ÍvUS]h u*ǃǃƃǃ]ÐUS]ǃ]UWVS$u] SVfuEjS}Wu( jjjVW(WډЍe[^_ÍvUEu uÍvUWS]CD<|ul;duC(+C$=v ǃt,s$Ie[_UWVS,uF(EUE䋖UE E܉F,;F0rjV_Uu4:.B*EEF, F,H}tD;tvV,CF,;uV,F,X9sV,CF,9rF, VEPVEl'ws$LE V,EV,BF,BEEEH82vEt4 VC9F(HF(h( jv,PPÃ9F(sNF(8 tFwTF( V,F(V(BF(F,9sz uUV(F, VcP V9؃Ph#/E󢉲hVmE؋F,;F$v 8 tF,V,BF,;F$vz uF,} KE];v;[t;]u E K;w䃾}[}thE 9Eu`=?uG}H% VA<u V1}uF,F$ F(}uH@F(.B*BF(;F$r";F,wu܋@PVǃ<uUU܈VD}u jV jV螶<t(}uF,F$F(u܋@PV8Ju@ VE9t V <XUV(?:uVǃ<u=?u}:uvt <uV}uPUEU9t V<EF(u Vo}u e[^_ÍvUWVS$u} ƅ.ƅ*F$F$F,F(jVF( F(PF(/t? VPVÃ+Ƅ+uF$F$F,F(v8.8*hPSߪ.@* hSP贪B.B*B;Ƅ.CƄ*CƄ+hP8FDF$F,F(ujVvjV蕳<u Vu;u+ VZF, V,BF,B4$7e[^_ÍvUWVS u} }u/^(;^$rSvWSuK;^$s7^(2^(;t$;^0sWSuC;t;^0rve[^_ÍvUMU QDA$A,t t#vjQ色vjQŰÐUVS]u S(MIt(9uJ;S$v9t J;S$v9uIu;S$r ;S$u9t>9u}tBS(LtBC( SD S,e[^UVSu] V(MIt(9uB;V,s9t B;V,s9uIu;V,r>9u}tJV(LtBF( V贞 Ve[^UVS,u]ShVS EPSjtt?P 5F(j5 <u 5u$ 5iv 5*=t;4tB=tBt >эY9u6购vEHXA=uUBTэ9s8lj9t(;t"€8tBC:uƄC9r̍hPEpTfUZXC=~rjjhB'uUBTBXPUBX@BXe[^_ÐUVS]sH SS`B CHBF$He[^ÐUWVS}HGP!ƃ;_} @Pt9C;_|GEp GPźƃtH ?;_} @P蔺tC;_|GEp e[^_ÍvUWVS }wGt+>tv 3r;u V^w G t*>t 3:;u V&e[^_ÍvUWVS u} ;~Q;~LH+^~Py:FV8t,FHHPV" jVFFPVK=v~;V\z|t2B|8t*hb SSSr|LLP_~ j jKFVV\tP8tE؃zhtBh8u.hb PPPF\KP0F\xht'@h8tyhb jF\phCx~e[^_ÍvUWVS u} ;~;~Hu j F+^Cv'V\ztB8thb WWWr~3V\t'8thb SSSvFPt=F%9t)E9}Ӄ j E9]|%FV)PNFRVBڃ~?N\t38t(hb RRR+JP>eFPt؉9w !9~ j .F{E9E}à jE9]|~e[^_ÐUWVS }u ]~z;_Hu PF GKuG;GH|VPyJGWBWGQt|u d] EhEU|u t] EpE u6]T ]C\;;E| uSuu{t:UU:t<u&Ut DPSu,]SvE<"uKSPu莫U| u D] Ut DPSuҪFe[^_ÉU5u踈ÉU5ÐUWVS }wjjh`̇wjjhy軇 G`pp hw貈 GP@t|msPhw菈 GPtsPhwl PyPhwIPy&GQtPhw@_\=@tS ;t$8thP3蛱P6vhwć >uwj Me[^_UWVS E xxp@E@=@tAV3t ;u$;tuSuu=V3譬t ;um;dttt uc8u-MQ`Gus8u-MQ`uh uva u }G`p pW9Jj EPu>E8tuh Epۅ]-uV` V`B FLBFHtu"}G`p pWtvЍe[^_ÐUWVS,]DžDž{8-u'@stvuDž Dž;838uE@P38u,MA`xtcsPhEp#3?8u&UBQtcsPhM3R8u#ExPycsPhUu388uMxƿ8tʼn8uUB`phr.3o8uMA`p hqK6@=@t:36ܨt >u-@MQ\>uP3>t 8u3hg>tD>%u9F%Mw $ G#tPh@MqiF>utC t;t8uqhb j;8j P3)ƒ8&;t"8tuPh-hb jhtWhUrw;t8uMqgj P3}ƒ8uy3hփ;t8u&Urj#jh@j P3ƒ8uyuj3hMqM8tuD3h=Ep';t18t*uPhUrBv*hb RRV2Pe[^_ÍvUWVS ]ECPs el 󥍻l lPpt%=}RPPEER:t9:t 9E}~EUR:t E}~މ# # # # 9PPjSЍe[^_UWVEǀƀ`xl-  f Pe^_ÉUÍvUS]SHu S,]UEU H HJHJHJHJHJHJHJ HJ HJ HJ HJ HJHJHJHJH"JH J@!BUUE JHJHJHJHJHJHJH JH JH JH JH JHJHJHJHJHJ"HJ @B!UWVSu9E썖UEEhdM䃾|uxEtUpME=UECMEE:Eu } EPWVUM : EPWVU|D:}tEEPuV̝UM܊ M EPQV讝U|D M  ;Ce[^_ÍvUWVS ]HCPs Í%= P+4$;t!VuVR;tt;t! ;xt;t! ;lt;t! ;pt;t! pt ǃCPRPP R: uA~#u R: t 9#t  9A~jS9PPv#u R: t #t  A~ul Pjs =tǃЍe[^_ÐUS]t1Cu+lPjs tǃЋ]UWVS ] 󥋃# # # # Pjs tǃЍe[^_ÐUS]u-Pjs ͉tǃЋ]UWVSuEEE>€8-xvBdt#d at;vqt'xt,E@E4E(E@PuhUr.t%>t:-u zzt >EE=Z9sthSMIR}tluPhEpusURvM|lIMM܃}vUDp#CE+uEMIv}Dt#CtE-}u };ЍP}txvzEU;BH| huhrt}܉}}}t3EPhMqv3h}wt ;Epj $tC;.+t-uU@Eǻ=t"W3t ;u;uWuhMqtE+t-t:oS}  RUBp CBpC@SҋM!TtjS}  RCЋ}!DpC@Pt SPt3SE @ RCЋ}!DpC@S!Ttte[^_ÍvUVS]u LǃLǃPǃ0ǃ4<S$;S,sA4B;S,rǃ,C$8C,C(t hlvC(PL[^UWVS ],~t/} u C(;C,s@C({(vSShC(F;C,v vvW5e[^_UjuÍvUjulÍvUS]C(;C$u @v h, sQ<E TPЉQ<&A$A(Lt QdÐUS]TtC(+C<9TvsCC $(C tC jCu!CPSCCC$C ؐ]ÍvUE@PPP@$@ ÉUS]3迅s贅s 詅$衅]UWVS ]u VU 't7'&"tY"\ F\tS:C$C${ C $C C$C${ aC $C$C${ AC $C 8C ,SC(c${ wqC $K$C K$C { C $C$tC$R SqC UCU/%vC bvc${ waC $P3t6 SAC\SBCC BvC SC vSB9CrQC)ǃWPYƉ+Ktbt&;S} C  B;S|KK7CsSB9CB CPs 0etC tЍe[^_ÐUWVS } }uWjjh`WuUBph`WaMytqhWaWjjh`EE;P E+EMQshWaCtPCtPhWSaWfiCt sshX{~GshWa<$1i;s}5CPh W`F;s}߃shW`Wj l`EUE;P  e[^_ÍvUUzuEPu BP֔US]} u hS{u C]ÍvUVSuj jHTÃt;95txt9pusCxuhSL؍e[^UWS]C @C )RsiCPS0{uC *C )‹CDE}Ee[_UWVS utx~ur VeÃt` u 8CPV{щ ECC}xECK}щKve[^_UWVS ]tt{un Sƃt\ u 7FPS~щEFF}xEF}щNve[^_UWVS ].{u/C h}CujS~CmsjsȈKjhCƃx(ShG Plj4$C8ut腂0+6e[^_UVSutb;^ s-V)|t t~C;^ rՃ v~~t v} V}e[^ÐUEÐUVSE u]t6Ph5\ SV55j b\SVhEPUe[^ÍvUWVS E u}tNPh5r\ WV56A04 Ph-5?\V]WVhSѐЍp04Phtz)PSO e[^_UWVS}u jVOÃu(蘀0>4$Vh7W ؍e[^_ÉUWVSl]ǃ ǃǃǃ0ǃǃǃ$} u ?QE *} IvhvEth}uEjuux2EP}xjjyuE%f= E 8ujh E 8tuh 3Suh/ xjj ~ych:jju xjj~yu h3S Six-}thCPu6] S e[^_ÐUWS] h4xƒu.h}01PS\+v  Suu uR4e[_ÐUWS] h4+xƒu6t*n}01PShڍ5kX&  juu uRe[_US]x ; x !x 0t S~t xx$t $^x SRx]UWVSE} yW1?tg8t`EEEE8_u@E܃EPjjYytCCfCECF ;t8u)ȉȍB)e[^_ÉUWVS } uE t{jRWE ?!ЃuH{8tWhjuK1VuE ~Ãyhju9shE0PhjuhE0P1EEEPWuÃtz9vqzjERPE9!ЃuBz8fSuE}Ut E)nE+Ee[^_ÉUWVS u] } yjRS 袀!Ѓuy8t ShjVWu |ÃyhjV/v9sh6Vph@6VXe[^_ÐUS]0t)08t 0t 0t]ÍvUWVSD]jSƃuhk0E~EEPS5u}EȠEEPS t hZjEPE)PSt h4hSjhPuS =thv3S >e[^_UWVS ]u } x h0U8u 73y%?Љ@) %jкRP#~!Ѓu h$jEPzth3S{Et%E+EVhjSe[^_ÍvU uu uÐ$FreeBSD: src/lib/msun/i387/s_ilogb.S,v 1.8 2000/06/06 12:12:36 bde Exp $К u %UE]EÐUSEU с> tPu~CJ~:v ~)J vvЋ$U=LuEEEE@ jjURhLjPes u LvLÐUUt:u9vt2:%uB tpJ:$u zUM:1tsӋUЍHJt&t"D2]:DuIJtt D2}:D9t<2t2M1BAM<2u]3E}<7o VEщЀ|muu U2PE81u[ CS9tHM)M|1;uIM E@P)<2t2]3BC]<2u}7@5Xnu 5XiX uivDBxtDxt>j*BpNt @PAt @ fPDBtJtAj*Bt @Pt @ fPF@(t (u8Pt't(@ǀ@,t ,ul@t[tRt u@@t u&P,@ǀP fzBu%fzt@tt fBfBBXE@t*t!8uEEC)Bx8tEx8t?j*Bp8Kt @P>t@ fPHBtJtAj*Bt @Pt @ fPJ}t!=`thh`uIEe[^_ÉUWVS }=t`5F9}K+~F")‰Љ)‹F v jPWE u FCV9|e[^_ÉUWVS }=ttC9}_&~C$)‰Љ)‰S"ЋS v!jPWuC ftjFVC1j1VC'PVC<@9|ve[^ÐUWVS E<t <jjz/<@<@ <@<@ fPf=` fQ<P fz~ fBfB=`fA<B=`v =` <f@fB<j@PI.C<{ C@P@P.C ơ<‹x fxv@4<Bt0Bt<@t0Pj @tUd<P@9D G<@9t=`<@@] )à <‹fx~JvPL<@tuAG<@9|=`X uE=`<BR‹] )Ã<fx<PL<@uAG<@9봃=`<BR‹] )Ã<‹fx~GPL<@tuAG<@9|<<UPut<tex t p W<xt pW <W<ǀE`<`UЍe[^_ÐU<u9<@< <pÐUWVS }U@ыR(4fyE\8f;Y~fYf~tf9~~f~f~tf9^}f^M u DQuCf9|Ӌ Kf9} u׎e[^_ÐUWVS u<Ef~>uV| N| =G fx~9}3@9tCPGLFPqVtU}H!Rv=<t<tFRP}D@PVtvUV,@BVD CF9B fx~-~t Bt @p艛e[^_ÉU=<t<uD<xt, <!<p華vÉU=<t<uD<xt, <<pӮvÐUS<fbuH<xx%@EEf@jjPU~t<fǀb虙]ÉUWVS }@xu WY:@\tG`t> `<$$:<x@\这D@x|t u@u <XKph@ut@xu jYTVS<xtf<t<x<$T9<XKph@ut@xu jSVS<xte<t<xj<SR4H(CTDPe[^_ÍvU@xt#<ǀx<ǀt:v@xt<ǀx<t <xÍvUWVSu} @u _v~j;Ftc<BH9tuBH9xu QQ v Q7<B9x|O~;FuuZً<BH9tuBH9xu S QW7<B9xE9}}9^uvE9}}E9t Az<9E_]Axuilt`0tP<4u?8u3Et1EPEPUP\sf}uf}tE% ڲ<9ht RQu@xPΕ9}}~<tUxU䋀h@ut@xu jPuS<xtUb<t<U䉐xq@<U;x@9EEE܀}tJU܉ڲ<9ht ROuP@wP讔<Ux}ً<BH9tuBH9xu S0 Q4<B9x|ohv;]}[ <BH9tuBH9xu Q Q;4<B9x|uC;]|E4)Dža9}X <BH9tuBH9xu QX Q3<B9x|C9|e[^_ÍvUWVS u}E 9E)@<;9vMM ;uB<;)Ѓ)PU PMMމ]<h@ut@xu jMuu<xtf_<Ut<M쉈xC9=)@PU P@e[^_UWVSj6<fbtfb<du xt觟<dt0O0 <PX<ǀd0xu 4xt0@4@4@P<p9~֡<t1 Vƻ9vuj4P([ f| u0@(f|t SG4B9 R([fD4R(fD0B9 R([fD0R(fDC9L4@92vR([fD4R(fDC4B9~щ0@9/R([fD0R(fDC0B9~ѡ4xfP0fP4f0f0p<h@ut@xu jJVS<xtL\<t<x<ht j?J{4P0P j3e[^_UVS , @xt; 0t,@% ‰ѡ4@P<p9~փ Qi4$Aƻ9}v SC9|e[^UVSu] =0tX<txJx@9}>x%<t0R(@90t0A<@9}Ǎv<9ht RH<P+x9~bZ~sv<BH9tuBH9xu V[ V-<B9x|K~먃 @pQe[^ÐUWVS }<tx9ht R"Hh8S <@)P@p<@9}'v0@(<t<ǀx<»fx~_}BH9tuBH9xu W v W3<B9x|mC<B9|F;ue[^_ÍvUWVS uM]}B9M 9] <h@u tBxu jM+jS<xt =<t<ǀxU<9ht R*h8S j@d}B9] <h@u tBxu j*jS<xtD<<t<ǀxU<9ht R0*h8S j@B9M 9] <h@u tBxu j)jS<xt};<t<ǀxU<9ht Ri)h8S uju@B9] <h@u tBxu j(jS<xt:<t<ǀxU<9ht R(h8S uju@5PPxmB9M 9] <h@u tBxu j(jS<xt9<t<ǀxU<9ht R';u h8S j@lF;uԋB9] <h@u tBxu j:'jS<xt8<t<ǀxU<9ht R&;u}5h8S j@kF;u}ظ/<l0 @x;u] <h@ut@xu j1&jS<xt7<t<ǀx<»fx~_}BH9tuBH9xu Wu v W <B9x|C<B9|F;ue[^_ÍvUWVS u}@uxXt@uu L] <h@ut@xu j$jS<xt6<t<ǀx<9ht R$u$BxXth8S jBpX6vBt.h8S VjVBKP@i1v9}%vh8S j@pXiC9|ދ]<h@ut@xu j#jS<xt5<t<ǀx<9ht R~#u*Bth8S jB6vBt.h8S VjVBJPh4v9}(vh8S j@gC9|۸e[^_ÉUWVS ] , @xt; 0t,@% ‰U}RSjuu uaǃ @x F}u u@tU<E9tt H9tu;Bt)t h8S jBfh8S juu @p iIPft"h8S j@f<ǀxǀtuuu uu uBǃh8S jSj@p HP#f<ǀxǀtu2<FtuE+E@Pu ujǃ@xux 9]v9]Bxt|]+]<h@u tBxu j] jS<xt2<t<ǀx$ v;u])<h@ut@xu jjS<xt1<t<ǀxjj F;ujyuSjuu EPǃ @x 1} tW<M 9tt H9tu;Bt)t h8S jBch8S juu @p {FPct"h8S j@c<ǀxǀtuuu uu EPǃh8S jSj@p EP2c<ǀxǀtu7<Ft uu UMDPPtǃ@xux } E9E 0<h@ut@xu jhjS<xt(/<t<ǀxjj FE9yu4 uEPE Pu50suu ue[^_U<ǀh4@<lu$@t qa@t ^@t 1a@t a@t `@t `P\t6`t- @xt \@`P`ÍvUÍvU<ht j^<lt}0utƀ0h8S jjj=<ƀ0j<BHPxt,<BHt<ǀxjj VvÉUS]@xt~u ذÃ`ڲ<9ht R<t SӃ<pR<x@Dt D_]ÐUWVSl=<t.<du j 9u[v uV#jV #jV# ]SVj7$jS#ǃu$ Vf#jV" jVj$~ ]S:#jS"ujS"jEPj#E]E$"E uVSj#j$ jVj]#Db{Z jEPjR#e[^_ÉUVS u=F ]؍EP["EE jSV"8=<tC<xt8 p$t<ƀ<ǀ8S v S =<t<ǀd|u j^"U8tƀx|uÐUWVSX]u }EPT!tMuEPjS!u3}t9ut u#}ujEPS!ve[^_ÍvUS]=euh]=tjhLvhjj3!u@=u7 hv    jhj  ve=du;t7h jh jh jd]ÐUWVSE<<pA5<F 0F$4F(,$,D؍e[^_US]t 3s$]ÐUS]8=8t!9u |||u߃ s Ps$Ps(Ps,gs0\ t (t (t t  s2{t1{t+ st8 u s Ss;<u<04,<]ÍvUÉUÉUÉUÍvUÍvUS]EjEPSKƒ}u] vxE E8t8;tEE8t8;uE8;u@EE]UWVS]EfEhj<8<|<8jS"V<P<fUfP<fP<M fH<ǀt<ǀx<ǀ|<ǀ<ǀ<ǀ<fǀ\<ǀd<X<ǀp<$y,r<ƀ0<ƀ1<ǀ4<ǀ8$,"C h, ƒ<4PRƒ<8PRƒ8t<8PR A P<94~ZYt+, 8u ǃ,# <@ P4ә4 A P<98~[Yt+, 8u ǃ,$ <@ P8ә8<ǀH<ǀL <ǀP <ǀT <ǀX <ǀ\ <ǀ`<ǀh<ǀl<ǀp@ fx~M<%o@<@%<@ f@@ǀH=<D<ƀG<ƀF<ǀt<ǀ<ǀjjE PEPK4jjE PEPK0i4<P$0<P <ǀd 4@0@_PPh = hxyۡh8y?j<@)Pu VSJƒhPVRhP8v4^ #$#@#@-H-d<h>l*p!tf@lt l4PBHtwHI9s[׉֍vGHa`}+|3.~0t 'fwFHD @CC9re[^_U<B9Eu B9E tÍvUWVS<PUP)UH@u)Mu up<tSBxBHfB fB;E|<uf+pfr8<p+E9u9ut }+}<@9u 9}t}v<@9u9M tM QWR-R<@ MfHufr<@ M fu fr@ f@f+E<fB<t -<ǀ<t! <ǀE+EĶE ȶЍe[^_ÉUWVS}u <ƀxVWt, hXj50,VWÃ؍e[^_UWVS uEE=<t<ltEE=<tP<lt 0uE=<t,<ht@ fx~ <!u}tQ@ fx~BPу?%  tt E!;5CĉE}tӋ!0Љ!ǁ}t?}u9}u39UuEtttu EPuRS)$@t7Bt%u jBK%=}Btu jBv=<t<Et9t1Btu jBK=<t<Dt3t+Btu jBJ%v@ uu j PPPPPPPPP@ ,4PJ%}}u }9Uu,}t}t Et tu EPuR'f@t4Bt"u jBxIv=<t<Et9t1Btu jB%I=<t<Dt9t1Btu jBHt<Bt*u jBH0 ǁ%}tM}u}tA9Uu!}ttEtttu EPuR%@t%Bxdtu jBpdHt(Bxhtu jBphGv t(Bxltu jBplGvt(Bxxtu jBpxGvt,Btu jBLGt,Btu jBGt,Btu jBFt,Btu jBFt,Btu jB|Ft,Btu jBHFt,B tu jB Ft,Btu jBEt,Btu jBE t,Btu jBxE@t+Btu jBDE}t=<t<h v5e[^_ÐUh8S uÍvU@xdt@@xht@xlt @xxt@t@t@t@t@t<ltÐUVSUu @B[]Ӏ:/;${<j>ST;>,4v=wt0P$ ;*u V $d$V;.uEC;>tC=wt$0P<$d$]E ʉC;>Z١<u ,E<Eڀ]؍vC;}fE fEEm]mEe[^ÍvUS u un=@Bt<Ișȋ]ÍvUBx t'<@HPjBp $PAÉU@xpt ppA<ǀxǀt<ptpǂp PYÍvUS <~_ < ǀ<j@p&<j@p0<j@pH<j@p8<j@pD<j@p,<j@pL`<j@p|? <j@<ǀBt"<jB <@P(uP<<jjjT"P<j j@""PY<j j@!P'<j j@!P<j j@!P<j j@p ]!P<j j@+!Pb<j@p<j@p<j@4|<j@pT[<j@7<j j@N P<j j@ P<j j@P<jjj @Pm<jjjPA<j j@p [P<j j@)P <;~<9~ЉBtHxptBBpp趫t'@ǀ@ǀv]ÉUj<@HPjj<pt jS@t [; j :UWVS] EDžDžuEP贾9])Dž@BBt8uBPu舾t<9]ku)ދBt\<9}IVB;P EPuPt<v@x,2@,8 u<|<;EPu能Dž<@@,I΋;Hs9^~<0tK~ Dž@BGv+uBtY<9}FVBP EPu葼P褼t<@xL<;EPu5Dž<@@LI΋;Hs7^~:tK~ Dž@B@B@BUE؋BE܋BEM9MDž@BBx tFuBp aP EPu"P5t<E9Eu)ƋBtY<9}FVBP EPu襺P踺t<@xDhPP~;|ƅ~e;}]uTuK<@$P(MIU=wƅRtƅ9},<C$P(E@Eȋ;huA9|逽ta9}6UR<@$@(UʋA9|׋)<<@@DI;s9^~<Q׸tK~ Dž@B;P EPujP}zovu+uBt\<9}IVB7P EPuP t<v@x8hPSkDž<@@8I;s9K~>vP[tK~ Dž@B;}/P EPuPt@B@Bt e[^_ÍvUWVS }u =<u 4;}u;u<P9U|EәEU<EP9|^؉љNjUB9|)\Bth8S jBf2 j K~8Bxth8S jBp.2 j ~ 넾<@H9~ǡ<@H9E~E juuVW e[^_ÉUWVS@u]Dž@BVu<KPhPEPǴPjtW<}} ~-@9}"U+Uyډ+E y؍uv}} tHPVuu u hEPRPu =@Bt;} }tb@xtTPVuju hEPPƒ =@Bt<;} @x0tVPVujj hEP薳Pƒ =@Bt!<;}v@xHt^PVuj<@HP hEP)PLƒ =@Bt <;} } ~< vDžB8xuz}~tBx8tkPVu<@HPEHP hEP{Pƒ =@Bt*<;} thPEP$,PVuu uEP@p}WdPVuju@p0}W8PVujj@pH}W PVuj<@P} ~@pEP脱@p8}WjPVu<@HPEHPWA @Bth8S jP-e[^_ÐU=<t<4vÐU=<t<8vÐUE-US]M BtQj SB!QjSP@fP,]ÐUS]M BtQj SB!QjS=P@P=,]ÐU@t @t +ÐUWVS <t3h8S V$h8S b$@ fx@ P<,<j@ @P誷(<(%% f@ fxy @ P<$<ǀl< @P #@xt`- -;'< [fTfT< [ ؅yC)RfDfD@xt< [fDBd]< [f<tf< [f|tfD< [f|tfDC;Ѝe[^_UWVS,MU ]fMfUEfEf9~f;}~f}fuf;u}uf;u}fuѸgfffE؉U܋U)ff9uUfMff;1ω)ˍ] ω)ˍ])ʁ؉љËEff9uu+MU)эI)ʉ؉֙@x^f9uu.MU)эI)ʉ؉֙*MU)эI)ʉ؉֙hhffuf,[^_UWVSEfE} MfMfE;<0tSfyf}yfE;|fE;|Kf}8fx';}f}xE;} f} EE EU<(fË< @f<< ft< fMfLBt. EPPPPBP$e[^_U@xÐUB fxxLfxxEBt u+@t u@tUWVS] u}Mfx ;| avt< @fBft< @fDBft< @fDBf[^_ÐUVS] uMfx ;| =vtѡ<(fDPftѡ<(fPf[^ÉUVS]U uEEfEfE;tY At'Vj RAP&"M=<tEPEPP=<EPEPPf}uf}uf}uyf}tq<1tf}uf}tVjh-*<1t%f}uf}tVjh-Z! xof}u fEf}u fEv}tUfEfEfUf}tVEPQf}tVEPe[^ÐUUE t BÐUWVS,}M ME@EURU9U uM9M]fC ft6U S4K8A9US0A9uF8@(EEE9E UfB fu'} G;} MQ(4G;}~] [ Puv(F(}G;} ^EP(UB(fDB(MfLfB ftJ(B4@uV0uG;} ~E@E;} &vMQ(UBH!‰UuE9uUfB fuIJ(M܍E؃UPSËM؋E܉UB(<u5 MI(Mԍ ]C4@S0]Eԉ;u|BUJ(D;E}EfDUfB fu!M N;u|]S(fDuV(MfLG;} u]fsE fCfC,f;C~U fS,MfA.f;A A.;Eu ]fCfC.ufFf;F~fFfFUff;B~fBfe[^_ÐUE(P5$谿$u h@2vÉUE PuÉUWVS] ,}\ }Ix; `v4``P5d d Dž|E} Mx9v9%AEP5dQ !]$-|6}~ ED|_A0 wSU9~LHAEE9A0< w/A0< v#E|E9tA+E;x1| ~ Dž| #v|t ؃D ؃DB;|}|9| u=|Jx4L D @CJy U:* M9%t6u,@;(v PM$,fE@EEP5du E!] $d/,@;(v P$,%,e 5d= ~ H |t ˋU,D;(v PjSV= ~" H |u<t эY,;(v PSh.dt= ~" H |u<t ΋]эQ9~ڡ,D;(v PtVt$,Pֵ,=$эL ,EM1|t%L=  DL^EUA<wBA= ~ H |t +Ma<a= ~ H |t EUA<w Ma< ~EE=  D @ EbDž|EU0< w&|MTBЉ|AM0< vڃ=  D|= ~ H |t = ~ H |t w= ~ H |t ˹= ~ H |t )= ~ H |t = ~ H |t = ~ H |t ˸= ~ I |t 5+= ~ H |t ˸= ~ I |t = ~ H |t tt9= ~ H |t u4= ~ H |t t=  D= ~ H |t = ~ H |t !x= ~ H |t = ~ H |t  = ~ H |t = ~ H |t 1= ~ H |t ˹= ~ H |t 9= ~ H |t ˹= ~ H |t 9= ~ H |t ˹= ~ H |t 95= ~ H |t 2= ~ H |t у=  D @ }uE}E= ~ H |t EM9U:%u'BU:?u@M9;u~fH U:eutWM9tdAM9uYEU:tIM9%uAM9?u@ U:;u~HM9t AM9uE8t @E8,@;(v P8$,$Ѝe[^_ÉUWVS M] EEE]EE%C9 Xw=$0CsAC}tEE׺YAER}u>E=wtTPЁ'~EAC9t `}tE]%CC}tUE9}Uȃ [^_ÐUS]{t SW"{t SA]ÐUWVS} ]}E@8EtvU9Z0u 9z4xax]}t MATS}t MA@90}t UBT8W}t MA@9~ vm uEX0x4]*UZ( vME@(EMU U GF}t MA@9|e[^_UUE t BÐUWVS Ex8F8EEFuoV(UMI<\:xFF4@MQ( ET8F0fytA9~fYfytA9}fQEF9E~v8~8q [^_ÐUWVS}Ex8P8U REuFEUB4u^(@ f| x]E@uF(<D V0)L )щH!ƋUB9~ftG9~fwftG9}fOEuF9Eoe[^_ÍvUS]t0{8t*CC0PC4Ps8[8t{8u֋]ÐUWVS }t'UB PBPB@PB@POÃu 0ufFfCfffFfCfFfCfFfCfF fC fFHfCHfF fC FCFCFCFCFCF C F$C$FCFCC0C4C8fF,fC,fF.fC.FECuwEEvK(URuV(<4MEtf}tK(URuV(fTfTK(V(fTfTEC9E~؍e[^_UWVS u<tvC9u<tfF fu4Fu)vV(<t 4GF9~ڃ v($;50u 0;5,u ,;54u 4vڋ<ȍe[^_ÉUWVSu} ]}x|xxxtxpu <p+uu <x)ߍ; <A9@E0A92 jSuWV6E } uhE9u}~UR(UMIjW#UMA(<t‹MI9s&MM MA(M 9rE9u|Ee[^_UWVSMu]x=x9}t3} x-x)E 0E@E@9E@E@9~ } u UR)BU u EH)AUfB ft WUB PBPQu E }t\Mq4Y0UBABA;} }.]MY(EUR(vM U FG;} |؋EMA8Ee[^_UMQ E)PQE)Puu QÐUE9u ~ÐUWVS}uEWtX u tFj`jE}]j WܑC(u S聾vfCfGfCE HfCMfKEfC <fBfCHfs CC }uB9uB9E uKCCCCC C$CCC0C4C8fC,GfC.fCfC@fCDfCBfCF9}"u NC(IfDC(ftA9|}uVUU <A9uBfS ЃfC }uA9u}u ЃfC E<R9ufK <tMt؉e[^_U=t!u@(P蠮tÍvU=t#uj@(PztÐU,Ptu#@0t@ǀÐUXP,u`\ÉU=tY XP(=<t4<x5t j<x ujpÐU=tM=<t0 j<x tjpJv ,PÐUh@(ÉUh@PÐUVSu] hN2uq V4ӡ<P tVȶĶ ~ <xu- S`ƒt<PSPRV"e[^ÐUS]@xt{ Sa Pظh )~ PK=8S u]ÉU=<t <@vPÍvUM=<t><t/MjEPtBP蹘$'v=<t <@PQ蔝ÉU h8S juÐUWVS ]tu )=uEuE@;Xt;uEEBxuIB fx t?=<t<u( PHR R 9|E=wutPC=wD1uӍ4;.uUC=wtt0CC=w D1u߀;*uu CE;v;$uC;Su j$U$<UvLPC=wD1uӍ ;.uUC=wtLCC=w D1u߰;*t ;/u;*uM C~2}u }ut" gfffș)Pv;t C;~~+}u}t gfff)Pn8S e[^_U<ǀ|ÍvU<ǀ|ÐUSU] Mt7x3B9+x'B9fJffB ࿃ fB v$ÐUÉUS=tX?9H Ë]ÉUS=tXA9H Ë]ÉU=tQj@(Pm=<t*<fǀ\<fǀ^<fǀ`ÐU<ǀÍvU<ǀÐUS@xt p@t ؋]UWVS ]u E}tct_EyэY~1>t,FKPuu E ~>uԃ uEe[^_ÉUWVS u ]EffPfU}y>t C8uvUBU)@9~ø@MQ(EENjU:ЃtfЃtMfyt fEf9A~ fMUfJEfxtPED9}fUDMfA ue[^_ÐUSEM P u"HȰ t% 3@ót %  ؉t0  Љȋ$ÍvUu uÐUVS]t%u Sot Se[^ÐUVSut/u V/t^F V^؍e[^ÍvUWVS u @u$w SfyǃxuvVuE@EUU t* w4G   0E=̶̶)EUzu B.9Et UB9EBà UB;ESu3UB;E| uEfH @EUB.9E~.BEMzjRz EE upEUB.9E~MztgjR. EEf` O}t[MUfb 7?tB GPu>t%?uUEfPUfЍe[^_ÉUWVS }u _W u#OȰ t% 8GƁt %  t0  Љ@W(fzu fZ vB9}fZB9~fZ4CG9~FfO @f@ff;G.~*fG.ffGfGu!jWfGf_e[^_ÐU<f^u <f\uifǀ\<f^u fǀ^ <f^<f^f;\u fǂ^<f^f`Jv<f\u fǀ\<f\<f\f;^u fǂ^<\UT8ÐUEÉUVS]u =u!@ @@   hmo~ hhEY~;~>r @(PtYhEPhht@@(P聱y 98u /8tʃ;E>E;@ @> @ ;>PP ffBP ff@ fxx @̶ ̶e[^ÍvUEPEPy=<t!<dtuudÉUVSu] j/VuzSPV1tSV^uIf{tC<vBC9|f{ tCC 9t13VusVtЍe[^_ÍvU<p,uUS]t"@dt d u+@`t `Yt<x4u<@4<X5]ÐUVSuMb)ȉEM)QjQޠe[^ÐU=tG@uux|t't@xTu tU=t6@u t@xXu tÐUWVS ]f fsfS Ѓ@ftf;K} ЃfC fC @fuf;K f;s~ vY{@S(fztf9r~frfCfBƋ C9w 99v Se[^_UVS=tA<ޝw(DPޡ@4<,PfC<uče[^ÐUSEu&Ãt%jEPSnƒx 9]tE8tЋ]UWVS ]}u >= f;tc][{t8C;tX뿃j joCt!ÉE#j jooÉEu uCFtXj j3oÃu(]t7E Sě]tCFuf{ e[^_ÐUÐUWVS`DždhXhsc\t 8/ h$4@thP hZt2hPV}Eэ\ /C)¸)Ph`4S#Xh\Pp}Tt-4EXXC;tN; t;:u<C;t;v; t;:uC;u&;t!XX9PC;uX\t)\?t?/t WbuhPdPQDDžP`d`j:P;u<`эqw:`PIY+`FP-_=~DžD,V`P?`PPHLh`PnÃx\t58tԀ8\tv Rk 4D4%tLt3zt-B:u B:Cyj:RƒtxuэqP-_=VSPFPP:@Pdt d轗D hsb$jjh`j =uG } C 5e jst%hE4u37uu݃ 5wЍe[^_ÐUUM tB9y vB(If|USEt.@u#X(HvRf|t  B9~$ÐUWVSuU Mtx xF9~ SӍ9}CǐF98N([}fHfDN(к}tfVfTC9|[^_ÐU=<te=t\<ǀ<ǀ`d`X@x@y XPÐU<ǀ`d`XHd@x@yXP/ÐU`dXP ÉU<ǀ<ǀB8% Bd BdHX XPÍvU<ǀHdHXXPqÍvUHdXPLÉU} t`dHd XPÐUuVƒu h@2P`ǂt ÉUVS]tP{t sS SA;u ;u ue[^ÐUWVSu j|Vu9эYvSVuuEf|ƃe[^_ÉUWVSTuPÃu PqE gv+)9u ߉9҉8tQCj|Su@j|] uȍe[^_ÐUWVS,u]tu u=vPuPOtnv R5 4D4%u h@5]t Pփu P:[=t,tu犅e[^_ÐUWVS|EDžDžv;vt13t[Fu) 30 Ph45So~( 7T0 Phuz5 oj~5j t)+DžDž;S( 3/Ir,R4ƅ$mZ=tiR9t9hp1/t|30ƅuU RP@ut hu h@2ZE 󥋅@(It0ƅu;=h4YRD0;K(Ct {(Dž;s(}$D0x(G;{(|݃SPe{(t'C(@t$VQSK({(uSP5S{t s詌{ t s 蕌{t s职 ߉jSYOtvf{tC<uBC9|f{tC ftjPVUj'}'PRU B WPV 9M q P7j=}PvR} GtkWPV蒆9fSE pVr9F U rSrP M fA,fA'fA tjPV= j PV fljߋljDž~ C,U fB'fBfB BPrfM AAPq xf} G G Pw_fGf_"ft!SG,PV諄9tjPV聄E fP$ftKWPVN9"M A NPPou t0<WPV9tM z} GE pV蘃;hU fJ&f rBPP KxQU Bx} Gxt xtxKyt[jtNU B M APq}P8 +U BC+~&M A fXC&~} GC~Ѝe[^_ÉUWVS]} jSAxjS迁Ãy -vWPBƃu WU Spe[^_ÉUWS]U IwuRhES]uSNe[_ÍvUWVSEu1ljɃtV E?v3t:u-B9rf=uuRu RtStCă W;yEe[^_UWVSHE} uPj Ph=]S\ =t'VSjePWA h=Ԁƒt%VEPRPWtX…tVEPRWst4 h=uƒt VEPWRvVEPWhf=‰Ѝe[^_UWVS}}tB} }t}tB}tjEG"EWUvO"M_$ˉ]G(W"G$‰U_&O"G&MG E_"G$G&þ9sJG4u O|u,G"W$E9wG"9Eu F9rju uuE9sbu G4{uExfG&fG G Pw_G_ K;]vWDK;]w_"G$G&ÃPw^GK;]vWDK;]w u 8WMGUlM pEftfvle[^_ÍvUWVSEEPE}p}t hBA u96Uļ5ȼ~|u @ V87MA$$?E4)؃ ~&SPU;u EvEPhF@^j|SƃuMA( EPEvȼ޿8t޿8u=EX([ 5мK6C,UB(@MT4A(=t  cP5ȼ"Ã==5ȼ6 xuI~vh v7"Ã}vv6hC> >뒾=t`5ȼ6wuA~ h cv!Ãt.}u vv6h@C&> >u 5ȼÃui= t?u5ȼuÃt&= v5ȼhF=u}z5ȼh4FO}E9CuA=ȼ8u$ =Pj! PjhE}uJ=ȼ8u- =P#! Pjh Ã]}u{u EH}CLFt TF tXy5ȼRhCF}} }tw}}Ct+ tt-SMAS]C fPSMAS]CKEP f̼fJ5м=u!C=PV5ȼ$ƃ Vy2K]SZ}u h\Fs; =u*:(v6hC v6hD<;,Pv EPHEt P uAE0$t:} =ukj+U2t6M;Y(})j+[Ut,uCM;Y(|׃Pu u ju1e[^_ÍvUSMU utu%)‰9$uKyuvAŐ:$uKzuvBŐ9u :7:7ABA[ÉUUtE EUEEPu7ÉUWUt&uPu u}ÍvUWVS<E UBu&(t (e/MQ]Cu#,t ,0/SUBxuNB fxD~+@DPhBhFS3P$.MQ hB.]SBUBx8uzB fxH~+@HPhBhFSO$.MQ]Cx%u hBp.SB8!EP4t4t 4B8MQz,uw0t0t 0B,Z]Cx)tNC fxF~+@FPhBhFS*O$-MQ hB-]SB,EP@x&tz0t0t 0B,]UBx)tQB fxF~+@FPhBhFSN$O-MQ hB:-]SUBXBx)u;B fxF~#@FPhBhFS*N$ hBUBxxt{trtih VS%4MApSk4UBSK4 VK,MQz]Cxtwxtqx,tkx,teh VS3UBpS3t1MAp,S3t V+]SUBx+tx'u MA@]CuQC fxJ~+@JPhBhFSL$X+MQ hBC+]SEP fzu@x*ufBUBxu hm*MQB]Cx*C fxtfxt@Ph@DFUBtAhBt' MA2PhD34]Cu hBW*SUB f@MA898,ji87ƅt xmuƅ]C8v+B=Bt6I9uVR t;ũ{uVhD{h 3ƃh csǃtu hE73vVMA<u 3hFPGMQ<tG4F42k GMQ4N0P3sh@E1[V]C:t$:$uzuAB:u Pk(O]S@j,fMt1MQ4u" t 4Aǀ ]CxuxCu hB'SUB<u hB'MQ<]Cu hBn'SUB@t @ MADt D]CHt HUBLt LMAPt P]CTt TUBXt XuhMA\t \uP]C`t `u8UBdt du MAhih\hVS-UBHS- MALjjS UBHjkS MA@jlS UBDjmS MAhjnS UB`jqS MAPjtS UBTjuSn MAXjvSW UB\jwS@ MAdjxS)t] V$]SH$E-7UBHu+xdt%t h6$MQHe[^_UWVSuFtt|hWS+FHS/, FtPjlS Ft@PjqS Ft@PjkS Ft@PjxS Ft@PjjS Ft@PjmS Ft@PjwS Ft@PjuSh Ft@PjvSO Ft@ PjtS6 Ft@ PjnSt1 W#VH$E#,Fǀtve[^_UWVS Ct `t@ Y>tƃu4du1 jƒ9Xu @9t 9ZuB9uG<뱍e[^_ÐUS]=xuhjHxxtx<|t Avݡxx]ÍvUWVSutm>th] ;t:uFC;u>t-U:t: uB:uu F>uӅt;tFt>u[^_UWS&=ux hZfÃtbǰу wG ߉у Q]u h@2*ShF5 BЍe[_ÐUWVSlEEE=tB uP$)=tV  lj t t t\uv t t tþ=:u :u} Ã.u(=ԼuE_ Ã.t t tTv SM 4D4%u|.u =ԼunPhF荴uV}u S% PhFh@IX( P:v=|uhj|E|5|F=t=ļ_u htH:u,d,u,؃\u t t tÈFà u=u:-=u$N> t > t>,uN> t> t>,tFj|5| ƃu|эt  5|X&j|5|NÃ}ut8u hH&u|э\ 5|9@v RwK%@4#L4ȅt}ub hIEv>/u}uJ hI-vPhHt}uPhJ% F9h5|5ȼEv SJ 4D4%u=u_;uFÃuF:tC:+##,t=A@t19t h@J%|ȼi9t&}u S! P5|hJ$|ȼ6 \5FNw2=v PI% 4#L4ȅuD.jEPuVGǃ}u>9uu5|hH($E8u 9t hH$|ȼ=̼w|PV؃}u9t hH#|ȼ5м%}u S9 PhHw#}u EPƃЍe[^_UWVS}EEEE=E H9M=u ;^}%jÉƃw'=v PG 4D4%u VdPhH"?u#G= j hH|":J@\#Éƃt$@ЃEEÉƃu hI#@ЃvHwtShJ! PDvU\Љ]E}~}uEECjwC$Fpk f a\ W R M\H^C,>:9 VPhKB!G u=uEG}uuEE}X~}u h@K E_É9t e[^_ÍvUE=uhj> 5` ÉUS]9tu[UMU =t t ÉUWS=эYtK@v RD%@ 4#L4ȅu  Kue[_ÉUWVS =u188 =t8q;r0P5a<u 5.5)PPt u,th5Ctsэq: t: uBz tz tэQv)x u x uQD Cx 8#;@Ѝe[^_ÉUM;u hK=BJÐU=t 5-=t+ÐU=t 5'g!=t8uÐUSM9tAA9u؉љЃ[UWVSu} Vt7#vf{ y &C @V3eUuΉ؍e[^_UWVS } UӍL9s(ƍv9{u3u"Uڅt 9rݺЍe[^_ÐU}trKÐU}t  cÐU=u1  hNu h@2UÐUWVS ])֋} ); v5 PR8Pu h@2vu S 4D4%tV,tQ'tL\tG:tBh#5hP'h&5cv/fӍf0hQ vUfӍffэf(0 h5)fù fB0h5}hPe[^ÍvUWVS }] =tu u9=ud h)hC5cKhG5=Kِ=t=KtBw0vh5hPKuă= t#hK5v=t#hS5ve[^_UWVS ] } ux[=wt8޺v=wD1u ;*t;.uCҀ;e;%/C~%CN$0%=uh\=uhp = uhhy4j5%h5j5hj5hj5h5t$Ãh5R$iÃh§q;=t;+t;-t;*t ;/{pt {c {E;=tj5{pu8jC@P;t y E CPE*w$lhhhhǧ5M==t*=u =u  ]j5*$ Ãhj5$Ãhʧj5h SÃj5hϧtj5hZ;3t#;2j5rhԧ2j5Xhاj5>h.5t hܧ5D%h5KuPPPh%Ch5M;hߧ5!v=wu ;*t;.u%h5C묃h5h5e[^_ÍvUSEPEPhuuWE=wt3E=wtE:Eu؋]ÐUVSPu] wmv SH5 v4D4%tB:t\u\hVƈhVzKv؃9u Sj PEP3vShEP'EPV-ƃe[^ÍvUhu u P uPÍvUWVS,] EEEEEEE`EEэt >>N>/NN=w D1u߀>.tڀ>*tՀ>$uuԃ Fhu$E=wu>.t>*t;;]v;\u{^t{,uCx;$uO{tKA;%u{%u h3;%u} EPEPhStQEPEPh St6EPEPh&StEPEPhBS|u#j;S1à uuuW S4tÃh^0EPhaS tEPhnSuKj+S軘t9Xhu=EЃ}tEEuu,޿8uh{޿K8uE܃}h~R޿S8uE؃}[hC%N$%huPE%Chu$E=wuPhN;d_h.dhZhPC;1u Es;2u(}uh}ubhuEE;2~A^hyu^EЃ"hu?EE;tC;t ;]D}ue[^_US]=$u hD=$fC,fC'fC fC"fC$fC&{u j,=C{ u jN<C {u hx<Cf{tvCBC9|f{tC fPBC9|f{ tCBC 9|(]ÉUWVShjÃtNjuuPe؍e[^_UWSU(׍;=wR$P7-=($e[_ÍvUWVS E gu( 6xMfy t,F<ttsf<8uiIwRVS2(Pmƒu9u fDž.jP=vЍe[^_ÐUS9u!=t=tvډЋ]ÐUEUWVS ]u "t\u\C5w3v V*( 4D4%u u| u \Cnp u \Cr`u \CbPu \Ce@w>Ёv R' 4D4%t\C^CF@C+%PhSqэ\ ؍e[^_ÉUWVS u !tr(th,э QE4TU"PFtvPRƒFu"B؍e[^_ÐUuj`ÐUUM t JEHBtU u juÍvUEM QPQPÐUWS]U t9эy;{s#{tRsM%{){e[_UWS]U t=эy;{s';tR3$C){ve[_UE4ÍvUS]=8uhj88thS58ڜ]ÉU8uPuW$ÐU=54h5L=x5h45'=x5h>5=8t"88tPhG55j:h5j X E Pu5s5j 3ÐU 54h5p=x5h45K=x5h>5&=8t!88tPhG55j:5j } E Pu5蘏5j X$>U 54h5=x5h45g=x5h>5B=8t!88tPhG55j:5j  E Pu5贎5j t$>UWVS ]}~i~eE0U 2F6yU UE FK1~UUEFuU UFE EKO~K~U UE FKO~UUEFOe[^_ÍvUWVS u] }K~$vW6~5t KߺЍe[^_UWVS E@"EUB$EB&EB";EEf+B"fBBPrXMAy"Oq+u]KxEE 4uUr5tMQ 37OEP3KyMUfJ"UB$;EEf+B$fBBPr MA y$Oq+u]KxPUM 4uEpt 3EP 7fBfJO3MA fPKyUEfP$MA&;EEf+A&fA A PqUBz&Or +u]KxRvMEU 4uMqt 3EP7O3MAKyUEfP&e[^_ÍvUME t t%t Q"Q"A$ÍvUME tuQ"vQ"A$Q"A$A&‰UWVS]SucƃSulj9s$UB4u 2څt C9r޺Ѝe[^_ÍvUVSu] Et uF FV$)V")N F&)F"V$)ˉ[^ÉUWVSuuu V,ǃ^"F$F&\9}vVDA9|uWVL}t:}}t y}tNq^K9}VDA9|fN"fNM^K9}V fDJfJA9|fN$fN%^ K9}VDA9|fN&fN e[^_UWVS}uWÃuWEw"G$G&t0;]s"G4u 0txC;]rރPwGN9vWDI9wGU uSWÃ}tq}}t)v}uSWfG"fGGPwWGOI9WBI9v}fG$fGGPw G OI9vRW fDJfJI9v?fG&fG G PwGO I9vvWDI9w؍e[^_ÉUWVS uF"EF$EF&EE]9N<F +EV&)ЍV<j4u 5x=jWVujWVtxjWV‹FYjF4u xHjWVujWVtt!jWVa‹F fPvC;]e[^_ÉUWVS}G"EG$EW&M I"MM A$EA&EUu } E9Eu\fG"U f;B"uOB$9G$uG;]}.M A4G4-t vC;]|҉ EEPf'Ef&tM Q$A"tQWE fx&tW$G"tWu v U B"PrG"PwuEM A$PA"QPG$PG"WPUMPnEU B&PB"R$ЋQPG&PG"W$ЋWP]]UP%à 9]t0 PuuuW t w~'MOEE9EtZE Vuuuu ]SE pkU BNjuډ؃tfЃte[^_ÉUWVS] ߋu CP%CC$%C C $%Cf{tSu FAC9|f{tS u F fHfJAC9|f{ tSu FAC 9|E H"@$U B&t@ MQ$CNjE pUЃtfЃtCe[^_ÐUSEt: f@t ؋]ÉUS]t. S$e%;u ]ÐUSM; <u @*Dx`9 tBv@$ÍvUSEx`9DuBv[ÐUSXPgÉ$f=t ؋]ÐUWS]{t sc$;t 3Q${t s=${ t s )${t s${t s${t s# e[_U U ÐUWVSu] 0HA~9tGI[^_ÐUVSM @xt,@%ƃ 0PB~9tCJ[^ÍvUWVSlEE<fx~$ƒ8uAF9}<E0HA~IE4G<@9딋<ujCP<ujCP<ƒfxU4P(0@H~I]4<E 0Q(IA~IE4G<B9d<B(ЃtfЃtت<¿fx~:v9t 9t9uAy G<B9|ɡ<¿fx~E9t 9t9uAy$G<B9|<9t)yuyuY ;Yt Q$9u3<¿fxB9}$ƒƍdjjWV Ãu 8tjEPj jEPj jhPjtde[^_ÐU uu uÐUWVSFЁv R%@ 4#L4ȅuˉ<-u E E<+u>F}t}u0u>xt>Xu~E}u<0TUEEEE"!EEȉURPjj EUuujjvEԋEEUĉG< wG<w7G<W;E}x.M9Mw&rU9UwU3UE3E u;E~EAvEEeEUUUċEЋUUUEUEU>FE}yEED"#}u 1}t ]U]} tE}tFU EUe[^_U uu u ÐUWVS| uxDž|>/u-E /@~DžhFPThu "uhhu `#v} IhVP-Ã=w1v5#x>?j/VoY…u3)w)tft)Ƅ()ÃtCPBPQE |/t@=9M  /88u;E Dj/PؚP@+U |hPu =xEPu t$E8u(vAE%f=|| hPu ÃxƄ(/uM ADž5v,E Dj/PљP@+U tQ+/tC=}Ƅ+/Ƅ+hPP=DhPPÃ4vE x/u@E e[^_ÐUVS uĶƃt>j=V/u Vj@PVÉ4$f؍e[^ÐUWVS u} ]=hu L8uSh95H}5HL8-u#Lzt#BLz-uHvL8Ll@L:tRSUuf=l-uvL8uH=D;:=l?5l  PhXnx:tdL8zL8uaH;5HKL;:u:Z=Dt%5l 3  Ph5?%HdLHlve[^_VWt$ |$L$tfffIutCffffffffffffffffffffffffIu_^Ð v7̀rϐ v*̀rL$QYB̀rQU帨ÐUEUEUEUEÍvUEUuUEUuUWVS,uO4EԋE E8>wUBU%tvӁv R 4D4%@t=F>&v R 4D4%@u FE87E}G}Ãy $FE<%v uuEg=wEr EE}DPЉEMF}t%>t =w D1uE} U}G uuEuuh } v } EuuhKuuh>uuU-uuh uu}uuEVƃE =wE EE}DPЉEMF}t%>t =w D1uEHE=m EHUBd >[ v R 4D4%@, =wE EE}DPЉEMF}t%>t =w D1uMuE}; EUBE}< }E8>g v R# 4D4%@8 EU:3 v R 4D4%@t v=wE EE}DPЉEMF}t%>t =w D1uHtku E} E} Y EUB>8 v R 4D4%@ E}? v R 4D4%@tEԋIM܃QUV}u&} Ex @UԋIM܃QVV}EC} 6Ex T@ KEUEԋ||IM܃Q}t|V|t;EUԋ|`IM܃Q}t`V|t G}vE}EUB=wE]EE}DPЉEMF}t%>t =w D1uE}5>v R 4D4%@EE8v R\ 4D4%@tp=wEQ0UE8}Ex>v R 4D4%@EU:v R 4D4%@t=wEEE}DPЉEMF}t%>t =w D1uE}#EUB >v R 4D4%@E}?v R~ 4D4%@tE}t6BEUԋIM܃Q}UEUԋ|0IM܃Q}t0V4yt=EUԋ<IM܃Q}4Vyt E} UE} EUBu=wEEE}DPЉEMF}t%>t =w D1uEHE 7EHUB>v R 4D4%@E}?v R 4D4%@tj EPVE=u EuuEPEY>Pv R  4D4%@!=wEYTUE}DPЉEMF}t%>t =w D1uYumlyu }DEdE}yEUB>Xv R 4D4%@)E}?$v R 4D4%@tuE̋È8t+v R 4D4%u9u])C)ĉeЃSVu[U?uи8u EM5uu UB )5uEu}G u̐E8uEe[^_ÉUVSuEEPVu u*Ãt"}t VEVEPR؍e[^ÐUS]fEfEBhEEthEExEDžxDž|EEEuu EPRIƒy% u EEЋ]ÐUU uPRu<ÉUjjju$ÐUVS=t S;C8xu@MڋCHCy ;C| tRQvƃ=t Se[^US=t 5@8xu@ 5Ã=t 5(؋]ÐUVS]=t SJC8xu@K{y SM 0@=t Se[^ÐUVSu=t VfF fÃ=t Vp؍e[^US]=t Sfc =t S.]ÐUWVS|EP BUH$M@H#EEEt} u>}E FEvU UэL MU9UMy<yDyHY<]ALtuϋIDWHUu\0;]sZ<t;]sE<u;]s7vKJ:u;Uu:t!+E}9}ËU;]r;USp]E9s@UR u@uJEЋ};Gv R 4D4%rUЀ:_f]ЋM;YWSv RJ 4D4%uNuЀ~_tEEԋ}@UԋP%EԋMԋ%=t EEԃ}u)]9]}uu9uHM!Mԋ}@Uԋ%=X0=Xw.=Hm=Hw =8tGj=PuZ=p=pw=hH8=x(uND#D }GL4)ME)ȹ9E}OG E̋uM9ɉ8UP @M9t @Eԋ}9uuuE@PuEEPHuuE@Puuu ;uu%UԍDPuuuMAuЋ]t@PuE@PuVQx}GMЋU; uHPuE@PuQWQuFUЋ}Wu%M)@PuRVL }HPuE@PuuV&]MA%uԍ\0uSQuuu *}@%=CKP%Ë%=uK럁EH4|u}EЋ}+G tuuE@PuuWa }WM] \zuNt| u}EЋ}+G Dt uuE@PuuW u,}WM]L\  ȍe[^_ÉUWVSE EU;Bt HMEƊMVhVuuE0/ƉEEv }MU;JtEE;uuUUE u M@uuE@uEUX,} u M@u}u&E@u}EUX0t'~#VuVuuM1Xƃ Kށ}t@Ёv R 4D4%uG_tB}t9Uv R[ 4D4%u}_uEt}сv R 4D4%u_uK}t;}t9Uv R 4D4%u }_tEE-wVuVuuE0ƃ Mu,E9Et$uuVuuU2EEMAMtUBЍe[^_UWVSE@0EU UM;Qt BEEƊMVhVuuE0ZE }MU;JtEEE u U@uuMAuEUX,} u M@u}u&E@u}EUX0t&~"VuVuuM1ƃ Kށ}t@Ёv R 4D4%uG_tB}t9Uv R 4D4%u}_uEt}сv RU 4D4%u_uK}t;}t9Uv R 4D4%u }_tEE-wVuVuuE0Uƃ MtEE;ut,U9Ut$uuVuuM1EEe[^_UWVS ]E ENJMu9uUBM%=P=Pww=(D=(w1==[== @=8-=8w=0=@ =HD=xY=xw>=`=`w=X5=h=p==w==W=t9=t;|9E5}ts}#E-QW}}9?v}*0%uN} U"AE! Éс‰! Ä)MMNJM! É!сuvuuET%=tN%Eȋu%=u*! ÉсUʋuF%=t!v! EE9EG؃ [^_ÐUWVSlEP BUH$M@H#EEEtE uEU VU!vM MыuLMU9UyMy<yDyHy2 u  uu MỦUEAЉEEkAЉEEkAЉEEqjPeMy@~+A@;EsEE uuuu]Sq ǃ 6}uu~T~ uuuuEP`ǃ uEڃ}u UzTD}u# E@PPlEE;XPw1UDD DCE;XPvЋMyTuEu uuWu]SSu~X~2}u FXPEăExX~ }:juuWuURà uZ$vjuuWuMQà u4;}v" uuGPuuVǃ uu E@G}t"EU)‹MY)ljyq }vm;]scvE;XPw+MuTTTTT T 'UDDD C;]r}t u}t u ue[^_UWVSE E];]y]U@%=Xt=Xw =Htj=xt_vM@u%ƉuBU‹@M%=t&Ju%Ɖu%=uމEU@%=P=PwS=(=(w==8=8w =0tp|=@q=Ha=xQ=xJ=`?=`w =Xt(,=h=pE E uSPuu ƃuuuPut ;EtFɍ{]K SWVuuO t SWVuu uE uSPuu ƃuuuPu ;EtFɍ{]KMMM SWVuu t;Et UUE؅u EMM SWPuvE uSPuu ƃuuuPun ;EtFɍ{U@%\ SWVuu7 9t(C{MP%Ë%=uK SWVuuu Wu@%NE+F \+u@%NE+F D\ ];]Ee[^_ÐUWVS,E EEUUԋM9Q]@uԋ%=0=0w9==w=t_v= =(ta==w=`==}9}mUЊBU89]9]XEgu%J}9}$E"AEЄeMЋU;Ju BuЋ];s~ /EЋ};Gu GMЋU;J9 @vuЋ];suCteEЋ};Gsx u@uLMЋU;JcQv R 4D4%3]Ѐ{_&}Ћu;~v R諷 4D4% EЀ8_MЋU;JuBtfuЋ];s> u@uJEЋ};Gv R5 4D4%rUЀ:_f]ЋM;YWSv R 4D4%uNuЀ~_tEEԋ}@UԋP%EԋMԋ%=t EEԃ}u)]9]}uu9uHM!Mԋ}@Uԋ%=X0=Xw.=Hm=Hw =8tGj=PuZ=p=pw=hH8=x(uND#D }GL4)ME)ȹ9E}OG E̋uM9ɉ8UP @M9t @Eԋ}9uuuE@PuEEPHuuE@Puuu ;uu%UԍDPuuuMAuЋ]t@PuE@PuVQx}GMЋU; uHPuE@PuQWQuFUЋ}Wu%M)@PuRVL }HPuE@PuuV&]MA%uԍ\0uSQuuu *}@%=CKP%Ë%=uK럁EH4|u}EЋ}+G tuuE@PuuWa }WM] \zuNt| u}EЋ}+G Dt uuE@PuuW u,}WM]L\  ȍe[^_ÉUWVSEX(P,U@0EU UE;Pt RUEUpjStEShSuPU2ËUpSuEEEEU;BtUEUދ}H98uEEܾ} u U@u}uE@u Ux,} u U@u}u#E@uUx0t'~#vSVSuuE0à Ot@}Uv R 4D4%uF}_t@}t7Uv R躰 4D4%u}_u}t{Uv Rz 4D4%u}_uHt;}t7Uv R6 4D4%u }_t{wSVSuuU2à E<uWU9UtOUpSu9U puS%SuuuuE03E E܋UBU<tE@e[^_ÐUWVSEX(P4U@0EU UE;Pt RUEUpjSLEShSuPU2E uUE;PtEEE u U@uuE@uEUx,} u U@u}u&E@u}EUx0t&~"SuSuuE0à Oށ}t@Ёv R 4D4%uG_tB}t9Uv Rǭ 4D4%u}_uEt}Ёv R腭 4D4%u_uK}t;}t9Uv RB 4D4%u }_tEE-wSuSuuU2à E<tUU܋EE؉ދ}H98tRU9UtJEpSuU puSSuuuuE0EE܍e[^_ÐUWVSuE EËU9MA} %=P=Pww=(X=(w1==== o=8Y=8w=0M=@7=HD=xu=xw>=`=`w=XQ=h=p==w=)=~=t==tR9E0}}6E-|5}mD3U Z}QI}ED3} ;2%UJ}U"AD3M  3T3ρ)11<1)}M]3T3%<3}}}EL%=t"%‹EЋ} %=uލ2 32E3ED3Eȋ}W%=tU0vD3 3D3ECM9M[^_ÍvUWVS E} u]UH 8eu9Eu A(t v1y w%u RSVWQ RSVWQee[^_UWVSLMu]ʁuEPu ƒW=t9t 8ut08tpEP蠧RhEP\UPׅt&9v RV_CPRV#D3e[^_ÐUWVS u} =t'vvst ;u;uqR3h.W豚ve[^_UWVSxE%tt t#E U9Bs iUB+} } эy h_à *@@F PܴF Fu S ^E U :FFFD DH@ ~CCCC tCC(C,C0C<C@CDCHCLCPC4C8{\@CTjhV"FHC tthV*tt VhhhV jhV'"FHC$SV!SVD#SV#{L~9SV;(SV({Hu{Dt sDcCDSV)CXECPUBZ eC(tjV~t uVЍe[^_ÍvUWVS ]Es;Cs/<|t);E t! S;Cs<|t;E u9sujSK;Csv8|uq@}t"VC)@PhxS$!uEC+EPhS CPU )PWSj!{ jhS 7}u(C)PWS9! C+EPhSX e[^_ÐUWVS uE@~Ã$X$;FrjVOF@PFXP FD ShhV;Fs8)tj)Vc FDHShpV;VsB:)jWjhVvFH(F@,Ejh VMFH(F@0jj VqF@t Vjh(Vp Ve;FrjV&@:;Fs3=wtj VPV;VC<vD?t?{zB;FnB=wF}tj VeÃ+tr+ *tv?t~{WF)@PhHV& F)PhPVWF)@PhXVF)Ph`WF)@PhHV F)PhPaWF)@PhxV F)PhVV F)PWV jhV6 jFHPV jhV V@E;VsX:,uSBB=wt# VÃ9E~j V ]SuWV;Fs 8}u@D;Fs8}tB;Fsz}u;Frj Vj Vv;VsJC<v6?t1{u7B;Fs/B=wt j V4e[^_US];CrjS;CsR@S;Sr]ÍvUWVS ]CE;Cs(8^u#@jhS]CH(C@,;SsNB;Cs;E u B;Et5VSrǾ;SsB;Cs;E uB;Eu̅t#Kjh SCH(C@0E9CujSe[^_ÍvUWVS uFE@\u!;FrjV@)L)0.tc.*[tw({tj{y}cvF@t VVjh(VA V{3j F@PFxP FD WhhV;Vs#B;Fs :\uz)tj)j\V FDHWhpVA;VsB;Fs:\uz)u BjVU߁0|Ht3Wh8V tHD @PV\ Wh@V jVF@T%} uj VPV;Fse8*u`@uF+E@PhHV F+EPhPVJuF+E@PhXVF+EPh`V2;V-B;F!:\z{B Vǃ;Vs_:,uZB;FsIB=wt% VÃ9~j V vSWuV;VsB;Fs:\u z}uBn;Vs5B;Fs :\uz}t"J;NsB;Fsz\uy}u;Frj V>j V0 v$te[^_ÐUWVS u \ABG;Fs.=wvt~~~j V؍e[^_ÍvUWVS(uEEEBM;As*кƉ8u jh5MB;As;кƉ8ujhuEU;Bs8^u @EvM;As8]u@uB] FB]fF])};Gs8-u@EB-M AB-fA-u;VsV:]tQ;VsB;Fs :-uz]t9uu&};Ws:]t;WsۍB;GsӀ:-u΀z]uȋU;Bs8-u@MB- AB-fA-vu;Vs B:]tju}G@XKxoӋM"AtZv Sɗ 4D4%t2 S E9tȋu FfEfFKy} tWu0}UBXKxNvˉMuF}t!Јff)FvˋEu FffFKy}G@tE@ B fi u~ tVuuuu*uu]Pu uuuuW Ph0ue[^_ÍvUWVS ]} ;Cs-t[u!B;CsBj S l:t= ;CrjS <-t<]ujS WS;CrjSq ;SsB;Cs ::uz]t|j;CrjS1 <-t<]ujS WS;CrjS ;SsB;Cs:=uz]u B^jS I S{E;Cs>8-u9P;Ss1x]t+;Ssx-u E- S:EEEE8Euȋ GfEfG=tHE8Evj S ]E9ƍvˋ GffGC9yEPEP~j S vSEPҍ+EPS轍ˋ GffGC~e[^_UWVS uE;Fs-v Rk 4D4%uʋ+}=t-Wu3*\u<t ;u;ujV Z{ PC$Ӂv RΒ% 4#L4ȅtˋ}  GffGC묻Ӂv Rp% 4#L4ȅtˋ}  GffGC묻Ӂv R% 4#L4ȅtˋ}  GffGC.묻Ӂv R贑% 4#L4ȅtˋ}  GffGC묻=w D1tˋE } GffGC~븻Ӂv R% 4#L4ȅtˋ}  GffGC 묻Ӂv R覐% 4#L4ȅtˋ}  GffGC묻Ӂv RH% 4#L4ȅtˋ}  GffGCd묻 Ӂv R% 4#L4ȅtˋ}  GffGC묻@Ӂv R茏%@ 4#L4ȅtˋ}  GffGC묻Ӂv R.% 4#L4ȅtˋ}  GffGCN밻=w D2tˋE } GffGC~e[^_ÉUVS] j=u  SffCe[^ÉUVS];CrjS;SsB;Cs :[uz.t @Hj.SBƃ;SsB;Cs:.u z]uBjSe[^ÐUWVS ]u E;Cs9@;CsU9uz]t#J ;KsB;CsB9uy]uދ;CrjU+}`=`t(vWu6JVu<t>uۃuUFjSe[^_US]v S v4D4%t&v SQLNv44Nv S蟌 4D4%t*v Se 44vË]UWVS(]3{U E؉EډCUE]ESc3{e[^_ÉUWVS u] Fx8@tMӁv R 4D4%t" S9tSV]'PhV<;u FP4;@4e[^_ÐUWVS]3{EECE^E@ @]@S3{e[^_ÉUWVS ]u}CE{~~u vv$8E+E )Czu C+E @PhxSrWjE @PS\C+E PhS C+E Pu S jhS jCHPS jhu C+E @PhxS C+E PhS C+E Pu SO jhSs jCHPS/ jhSS E@PE @PSGPjZu C+E @PhHSl C+E PhPS Duu SGPuu SkWFPRS jS e[^_ÉUUzuE BBÉUWVS EPr FB UZKM;rBBщU{u P虖vMYPsyCEX{u ubCQUZusyC9},MAxЅyBEAB9|ՋEPzt!ztE+EBujP0j uMQZyFEByF)CfCCC ؍e[^_ÉUWVSu EPB BEz9sˋF ff)FC9rE9u UBH [^_ÍvUWVSuZVu "tGU B4EPM Q4>^*<;uSVu 9tE;C~ډF~e[^_ÉUWVS u EURU)tN؋MAPQ8EP@ <4ЃtfЃtUZUЍe[^_ÉUS]{u7C;C|C@@PSKS E E C]UWVS u}~uc^uu VF v9| |D 9|H|DH@ ~F)PF PP:]F e[^_UEM xuP % EÉUVSu] 9^}.Pv euj V#F ^e[^ÍvUVS]u CFCPs Fuj SC Fe[^UWVS} ExE;G }O| tEB;W |EG@w%=X=Xw^= = w#==w ==~=0X=0w=(=H,=xti=xw)=h=hw=`.=pM==w==tr(}uFEEDuRVƒv%4%=`t=t =?%=`t=uE;GL~#EEEGL~ W@W@UE;GL~EEEGL~W@ W@~~U~vBsE;GL~EEEGL~W@ W@~ U~BE}t:3vE;GL~EEEGL~W@W@vE%=Lt GL@PG<uGLG@5O(/O h ۃGxu P Spt e[^_US]I…u$=u h 5S5‰Ћ]US] …u$=u h 5S‰Ћ]US]…u$=u h 5S‰Ћ]UWVS<}hu詋U<t }уQuÃfuSshSsE EPEPS`(Ɖ$REEPEPh8(ƃuAtu e[^_ÐUSj BÃt*Su u1t S蹘؋]ÐUSj Ãt*Su uEt Sm؋]ÐUSj 誗Ãt*Sju膃t S"v؋]ÐUSj ^Ãt*Su u9t S՗؋]ÐUME t$Ѓ|~uf#fuv賅ÍvUEU tu US]t.tu" jƒtC#]ÍvUEU tu ÐUS]M t:v迄9@D@f@ǀ]USME tK˅t t>ǁ;|1RTE]ÐUjjuuu uÐU juuuuE PuÐUWVSu `u@ h蓇Ãt*huh~4t9Pu S2vwt=huh~t$9PujuuuRuI蕅tUEE EEEPh.jPMPWPE0à tW P: Ph5] v06 Ph5t]vzt8zсw!hrh`Ut CvuDžl WqjWֈ PWjDžpDžvPTye|8#t ~tvg8#u5jjhZ[&D04 Ph5B\tjT> vvTڀ TԀ80u !軀8=u Džl~uflt p~T茀024PM1hڍ5[ jPj蘈iv~_6hj"jjhhvvEhh5[h8$vuEpBPRx}ѥpDžlvj"jjhhvv9Ehh5mZ}u'jhT藂DžvPOdF|djd~h.jPC׉QRTP׉у9Pt(i~02 Ph5gYBd`T9}```v5jjhX HuTT dd } jjjP`} ~uTe}8t(X}00 Ph5VX5j*jh@0Wd|PHPd~ƃItufJu V dy5|0D0 Ph5WDže}7=v5j+jhWVUװQRT UװQRTo UװQRTQ j{PTNt0{0d/PE0h!5Vt{tBj{Pj~{ tJj{PT~u+jPj舃TMt U2P~ T?~ jPj8蒁e[^_ÐUjuÉUWSĀU x 󫈕yttLƅxzDž|Cvƅxz`KEdKEhKElKE7z/KvjjyPzǃx=fxPW!u W(}fҋEe[_ÉUWVSÃDj.PE#@E8uV}IQ5hMhISOEP5h\hEE8ur8u Ex8u ES86E*E8 J8t18thS:!E^N>.o_O\`"\(\ ݢ|]EQ Q@Ԉ@Lj@ ES@E8OX*O:X,Eu#Spu;nuE. E-uE+}t_}Q5d.Kdt5Uud@PY5du軡EEe[^_ÐD$L$A,tAPjju L$T$QYai qyy1ÐT$z,tjBPjt T$D$JZbj rzju@L$ÐL$APjjt L$T$QYai qyy1ËT$jBPjkt T$D$JZbj rzju@L$ÐUjuu uoUjjujnÐUWVS u}] v SVX 4D4%ub$t]-tX_tS.tN+tI!tD*t?'t:(t5)t0,t+%FS~PjV覟vv SW 4D4%u>u t1u t$u t t/Cv u"F\M@A\8 $ \Fn\Fr\Fb\Fa\Fv\Ft\Ff\Fs\F0FE0<0F0؃ tt'\F0F0F؃0S@u\FyMFv SSV 4D4%t^FC@u?v-FFe[^_ÉUWVS M] uϊtCPVPQ\u)e[^_ÉUWVS Mu ]}MvvFPWRQKwtjWPQ+Ee[^_ÐUSM@BEӺQCeEjQ"f]ÐUWVS u]Ut;%$} \u .y} %u E =; U v R 44jp+M,}tjuMuP uOt s'$Ou5\EPh']M$H=t hBEU :ruRuRƃuu uQƃuUOẺpX=t hDỦ=t hDЍe[^_ÍvUWVS u=t h6Dt9st ڋuu!=t hJDxu =t hD VS}vjjWs3Nƃu J8t߃ SFtEe[^_UVSjjuNƃxu VÉ4$M؍e[^ÍvUWVS }u VWuCve[^_ÉUWVS]EPS{H}} }}x}~IjjSjjujPE }0uˍvR tJtB؆%=t-=t&= t=tuV J~Fxȁ t't%= t =^ȁ t"t%= t=uIVȁ t%tf= t%ANЁ t'tf= t   v%^Ё t"t%= t=uDNЁ t%tf= t%{u2f~}u+f~u$6E=v WEPu VS2 t߃j{S ÃuӃWu Ve[^_ÉUWVSMu 9tff9uff9tVf;[u.ރf;]tf;tf;]tf;uf;uf;{uGvf;}utOf;uuf;uuuPU9v[t[ ,tK{t7}t5f>]tf>tf>]tf>uf>umiGft O_tf>,tU9svff9rKfffuuuPUNv99Ee[^_ÍvUWVS uf>~u E@ u EU |B^9s&f~tf~/tA9s f;tf;/uE 8uL<u hZ:BuF t Pƒu(>@$ u ƒtFJU 9s19tvffA9s9u9sfffufE ve[^_UWVSu hSuƋE ߃??*[!uf>tj]FP4 uf[!f[!uf!ff>-u^]tf-f]uɋU J f]?M I f?.vE H 9tf*tf*fffuu P…uwU 9 u2B u %=uuu u?8E @ u*h\ j‹+PBRP(Ѝe[^_UE 0E0[<ÐUEf8u vuu PEPRRÍvUWVS|} ]Ef;fuEPuO E@ t^f/tWE%f=@t-f=uCuEPuyu*E%f=@uG;Ef/fGE@uPu+f;t8f;/t2f:yEA;Ew`fff:tf:/u΃}u)ωf;/G;Ew'ffۃuuRSuWu Ɖe[^_UWVSE9E hU f9uuvƃuoExt\hPuq90PURu E@ t DžUB @tzTxx.u Uf:.ui] Pv;]sffBfuuuu u E f)u uuuSu] u V׃wUB @t VR V1Ѝe[^_ÐUWVS } U:t;~A8GtPw4 P2Åu" w3Gsu~GHxvHy_Uffu+EE P>2ƃt0uPut VR3G4GHe[^_UWVS u] ;]yf=?td=? =*t==[t]0;]EuSV(ff͍vffEf>ff;!Etff]vf;-ua=tf8rFfCf9v5:EPPCPuEvf9uEff]{E9Et%ff9u;]f>ȉȍe[^_ÍvUWVS }tBWG4Kt>t 6I1Ku w21Ge[^_USU] f:ufDž.$vhPRGu(C @t PS  P )‰Ћ]UVSu ]hPut4?*C @tVPS$VP2e[^ÐUVSu ]hPuwt'4?*C @tVPS(VPH2e[^ÐUSU] 9tffu[ÉUVS]M UJtAt Ju[^ÐUWVSjjEPjh3N  u-à jjEPSh3@N y) S.p } S.Zv98eM9}%v4FPu3tG;}|ރ S.2Ѝe[^_ÐUS] =jjj4x-v=~+S554y 9wh=t 5- P,tS5P[4x9vE]ÐUS]=u+jh .y n1 =t]ÉUS=t h) EPtÃ=t h)؋]ÍvUW=t ho) EP ƒ}u1;E ~ E"vPRuO=t h^)E}ÐUWVSh]@4Ã8j EPS{ƒuE8txuEMtVMGt*GtT_Kt+Xkt$kgt Gmt$@@Jb9M(@Shg 9~jh}ځ, h  WRhjhcIEE e[^_ÐU EEE@jjURhjP=1 tÐUWVSuE tj. v j,(à EC U S$EtЃC$ V5=vV"PS<xjhSEELf@2EE>>щHP6Sf@2EGG@G C$PWS fG4fufG4}t UW}G}u}Ex}E>h}t}~uuS EjhSOtBUPf@4 C$ujjh/CyK$@, uuR( sD( S8(e[^_ÍvUWVSu fF&fF$؍CPv@Ep_j/v@Fƒt1;F@uxt&BэYQRv@f^&UBFFF,B e[^_ÉUVSu>t8f{2x#ڋCuCà Rm'f{2y߃ SZ'~t v ~t v2' v$'F$uK v .t + vP.t V&* V&e[^ÍvUWVS }?wG%m7V8fF8ujVW fF4ivuofF4 fwbjVW fF4f7G$-jjh-F y3*FfF4fN6f~4tG$@tHF,;G t@fF6ft v '-t w GfF4thG$t%G$ w Gt;vjVW tOo)FfN6wt9F@Fvt)jWGuG%H!wGv P$f~2u,G$u w+VWf~8tf~8uWjVWfF4fu8G$u2jjh+F y{(FfF4fN6fF8OFP$Xx/uT F@$/BF&@Pv@Rkp P#f~2u V#'V$Gf~2uG$ w*kfF6ftCG$u- v *t' v *'3 v *4fF6fu(hjvW tO$v~tfF4v7e[^_UUv ' E fP8ÉUWVS }] tt &+7&G%uf~4 u Vf~4t t wuO$f~2uF8/tG$tSWGNjjh)ƃx/SWYG4$(u V5)WЍe[^_ÉUE@(ÐUE@DÐUU EP(ÉUWVSDEEUz$PEpƃu&} }UfB4j%UBb} u E8EP$Ѓu!E@0E uEEEEE}u} ubj6uuhEtL}t} u $UBEfH6E$E܃ VEUR$UԉЋUBx/uMԋE@$tUP/BUEEԋUB+EԉE̋E@2@EEEEE UB$ u#{.u{ C%=.CPCPu\ǃt0C;EURUUԍDPutK#t Ws u4$Ef@4UJ$a#_UE;PtE@$t UPUUB+EԉECE=EfG2UGfCEfG${ufO6}t(}tfG4 E܉GfG4 UBG}t}t({t"{tE@$tGG@GfG4 ZUB$tGGG&@Pw@uG@GjWufG4}~Hfvf4uMG}u}} Ex}Et& V[&Ãt V!}tuuUB$tE;Bt}uMU}ta} t }Efx2uUB$u> r_$hjEputUfB4EH$Q}uR} uEUfB4: WuQ4$MEf@4UJ$!?'Ex t}~uuPEEe[^_ÐUWVSlU} B$t]_/u v/devf/>Ph-EPhu!E%f=`tf= u $ve^_ÐUWVS5 hh ,u = #t=  th^bhUP$hUP(hUPã4_ƿa80޿h28uM ,hUP< PQ8hUP PP<4q4/rz4xk4\4aGvhVÃt8t$;#hVKÃt8t(hVÃt8t,hVÃt8t08<hVtO8ttF PuO8hV}t8tt P@O<50SgDžhP#Ã޿q8޿/r8޿x8޿8޿a8hPaÃ>u jOe[^_U= u t$uÐUS]t)vS5$$tPuܺЋ]US]9t)vS5(y$tuܺЋ]U= t 5 T=u+t jv h?$wh5@9 t0BÍvU= t 5  ÉUWVS0jhj  @߉IQSj jhj 5hq]S ߉IQSjuƒ IQRjx jhjge[^_ÐUWVS u} ?t3Vt6;u=wt VFK)ve[^_ÍvUWVSEE@uPEP4`E`EM`9Es;Et0E8|t(8:t#EA9]sEtE8|t8:u߉EEPh@u2@~#u 8u (}t"u  8u j:hur3t EPh u$BtUEPhuAtU|PhuAt|xPhv-uAtxEPhu>~huufd1tPhu7AttfdpPhvuAuplPhu@ulhPhu@thfdPhoue@tdf`PhRu4@t`f\Phnu@t\fXPh*tu?tXTPhu?tTPPh,ur? tPLPh5uB?tLfEpxEfEbxEfEfxEfEoxEfEtxE``ǔa]]]]Ɉ]كHPEPu>u HHPEPu>HG DPEPuo>tDWt5@PEPu?>u@wG G tuXf.эT9v$:/u J9v:/t9v:/t J9v:/u9u":/uuP5XKJ9v:/t)=~k ?&)CPV5XXDXe[^_US$] =u5=u5 jjjjhh# u =tCEUEBf]UUB jEPRQQ uUЋ]US ] PuJ…%f= u0E@ jEPEPhh Y& tME0-=9E0RP%f= BPQj@hm?Ћ]ÐUS ]hEthPP<hPhW ƒxivƄ*uDSP t؃hPuԸv]ÐUWS]=\u h\t;u\f.эL 9v9/u I9v9/t9u9/u \f/Z9vy/t J9vz/u)Ѓ=~^ ?')ӍCPR5\\D\e[_ÐUu`ÍvUudÍvUuhÍvUulÍvUu upUu utUuxÍvUu|ÍvUuÍvUuÍvUuÍvUuÍvUu uUu uUuÍvUuÍvUÉUÉUuÍvUuÍvUu uUu uUuÍvUuÍvUuÍvUuÍvUuÍvUuÍvUuÍvUuÍvUuÍvUuÍvUuÍvUuÍvUu uUu uUuÍvUuÍvUu uUu uUuÍvUuÍvUuÍvUu ÍvUuÍvUuÍvUuÍvUuÍvUu ÍvUu$ÍvU(ÉU,ÉUu u0Uu u4U uu u8ÐU uu u<ÐUÉUÉUÉUÐUWVSLu }t-EȋFẼ ]ȍEP FEЉكvUH!ƒRQut ƒutEEGEGЍe[^_ÐUS0]S EE EPSj7 …uU؉Ћ]US0]S` EE EPSj …uU؉Ћ]US ]S( EE$]Ð̀ø1̀7 v̀rÐ# v̀rÐ v̀rÐ v̀rÐ v̀rÐ v̀rÐ v̀rÐ v]̀rÐ v[̀rÐ vÙrÐo vQ̀rÐ[ v̀rÐG v̀rÐ3 v̀rÐ v̀rÐ v̀rÐ v̀rÐ v̀rÐ v̀rÐ v̀rÐ v̀rÐ v̀rÐ v̀rÐk v̀rÐW v̀rÐC v̀rÐ/ v̀rÐ v̀rÐ v̀rÐ v̀rÐ v̀rÐ v̀rÐ v̀rÐ v̀rÐ v̀rÐ{ v|̀rÐg v{̀rÐS vv̀rÐ? vt̀rÐ+ vj̀rÐ vìrÐ vh̀rÐvb̀rÐvàrÐv_̀rÐv]̀rÐv\̀rÐvZ̀rÐwvÙrÐcvS̀rÐOvQ̀rÐ;vÒrÐ'vÌrÐv=̀rÐv<̀rÐv;̀rÐv:̀rÐv9̀rÐv8̀rÐv6̀rÐv/̀rÐsv)̀rÐ_v%̀rÐKv$̀rÐ7v#̀rÐ#v"̀rÐv!̀rÐv ̀rÐv̀rÐv̀rÐv̀rÐv̀rÐv̀rÐv̀rÐov̀rÐ[v̀rÐGv̀rÐ3v̀rÐv̀rÐ v̀rÐv ̀rÐv ̀rÐv ̀rÐv ̀rÐv̀rÐv̀rÐv̀rÐkv̀rÐWv̀rÐCv̀rÐUWVS}u @ B8tt)H[^_ÐUWVS<}@vGӁv R%@v4#L4ȅuˀ-u E E+uG}t}u0u?xt?Xu _E}u0DEEEEE"SEE}uEEEEȉURPuuEuuuuEUEEUĐC< wC<w7C<W;E}x,U9Uw$rE9EwU3UE3E u;E~E?vEEeEUUUċEЋUUUÙEUEUGL}y/EE}uEE'"#}u }t ]U]} tE}tGU EUe[^_ÐUWVS u >=uFIMEPuEƒt=}pI;MFBD\;t vG;u;\u-PR\H PÃPS5\;\\D}U:t:=tvB:t:=u}\ +EUDPtKE\MAMt:=tBMAMt:=u=BvFBuȍe[^_ÍvUS]U\BtvEPS{uЋ]ÐST$L$ 18uBu[ÐUVS]u XPSuEuP"9t)ىȍe[^ÐUWVSl,EE8vU:%pE]zT$MEuu} GUD|!uuM ywhA]D`uu}  wGtGU M A]D0uu}  wGUMcuuhK] KlQ>uuu }Nuuu h;uuhKE p 8,uuhԧU r uuu huuhK+uuhK4uuh U BjuuhԧM quuhԧ] C יY OuuhKE pSuuhKU B@;uuhvuuM y ~ ] }PJuuu huuu EuuhKU 2E Nju P% Phr]S uuSuuu h^uuhuuhKE H+H$I )/uuh.U B A)މ$I2ؙ)ЍXU JlrZ]vu)dȉәuȉәu EnEm+E ZE)Ѓ}E9S9VIu+dȉәuȉәu n\mQ}?VuuuhKSE8guuuhKdȉәuuhtQuuu hyuuhK} t G+OU JA$I ș)Q{uuh.U rhuuu M>uuu ]'uuhK} GldљRuuht] ClP'} (tuuw(,E x wuu@ 4uuhMcM y$xY$uuh֕] C$ۃuuhEuuhKؙUPxEuPhK<EәPYE 7uuu }nEE9EtUMAME];_Ee[^_USuu ]SF uuS]ÉUSMU ]9sAtB9s Au[ÐUSUE Åt@yu wfEfEUUEExEDžxDž|EEEuuEPHƒtEЋ]ÐUSE8eX ;E{t s.{t s{t s{<t s<{Dt CD-P{Ht sH S]ÐUWE ~ y) h3ƒtbЋ}UWV j t$bNjuUǂǀe^_ÐUEt PUWVSL}uE u`EuuhE0; 8}ȹ]EEEE PhjEP!EPSEPU2 t" P Ph5QzvExt(hph E uEPjjju h_u hOv| ujutjju hu h@O~ j  Urnu&0ğPEphU2; 8uPuuu;UB 8u E' E@ Ej/u݁$uh$"j/u迁 juuh7?U2UtPRu W0Puh5R$ ua$=Ee[^_ÐUWVS }} u}FE`<`R PF~݋E 8 hƒ}t t8u U4@fƒt:u hrKƒt:uIRE P} 4@ƒt8u IsR PF9뤃}t:U I/u E P\j/u <ÃuEU Iu  PF۾x/uC{/t{tS+E @Pu  PF] ;/uE E 8/tC;t;/uU :u# R PfF~݃}t# uvGv`R P4$JukE9}D P P<$ ufǃ C WG9|}8Fb e[^_US hh j`Pht=huh `Ph rC ˍvC~ ]USuÃt]ÉUWVS u `U쀸 .u{{.u {j/S):=u hTEt^uUUу+v$? uu w1$d*3,E%l +;vuS`Ut' SփtSuhUvЍe[^_ÐU hjjhr5hu u&=u @=u @ÉU=tÐUWSXUE]CE8IQREPEPjS@ …x!muuuu uEP‰Ѝe[_ÐUWVSE E}t?Džhu=u&"vu5 DžhhE}Yuh+EPuulE8/tLÉэt 9s4CN9r$K/)PuSXUEc"t^F DždhXE\Xt.X@EPhuLUpElDžxEPXU|EE9pu 9lt;\r?ѥddXQX`td\t.@.@t XCEEPU20t/@tDž`U9Uu( uǃ|9؃ uǃux.ux t܋@%=.t̓G@PtGP蹎EPXgt(`u "`vU9Uh|9EYG+Uxt@9}|h\+UP)މTѥhhu薾EPhT+TLPS΍LxuK/G)ÃPSGP褍u]EtDžxE8u`uv`ht u}t u X`e[^_UWS]u0=t 5EYэA Qu !vS5e[_ÍvUVS] uU:tSB<:uي:u:tvAB:u:u9uҀ:@t%:u :t::u 9uB:@tv[^ÍvU jjuju EPuUWVS\]} }=u5uk P:5Dž5FQ h/Dž;Dž}x jjjuDž3hhS$jjjS   uPwӍ{ S*ƃ SPR] ;E0jj2EDžߋ;rkhPueÃ8t u IEDžv(G u ;F~\dF;U)Ƌ)ÁSP5u,'  uMÉFu[88#uP>} tu , Džu78u 1Džj=hPCƒ-À;t C<:uCB+jE@PRuPPtNj t_}.t u Y'u DžuC:CDž;tC<:u+){:t :+)9)Ƌ)Í)‰)‰SP覶u1 t u ÉƋÉ+PS莅 tCt u)ʍB] 9vYRQ誵uB . R3 V J]e[^_ÍvUWVS(]u ƃuIM}jEPEPSS tt# VI V9vE8u @EEHG뫋UBE  VyE8e[^_ÉUVSu t=>t8]9u;|t ;:t;u&AC8tK;t;:u C<|t[^ÍvUu uSÐU=t 5ÐUWVS=uE =uNh0bu.g`QLFv=t=u\P5wÃ= 5KÃt 5HBz!h0a+d@t_v R 4D4%@u;:t;#t =t.x\ux\u  ڀ;t::t(:\t FB:ut :FݐP5ϋÃu^=tU 5諮Ãt ) 5e@3v:|t::t AB:ujjPju PuVÍ@ wCe[^_ÐUWVSj=u uÃs jdǃuD ?Ed€;:;;^u/C;:;;?u BC;\uC;:;0<w#tCIt ;/~;7~9BC2w*$- ( #  :CvCBMu$)FdPWDǃtEEd;:t ; B)K}t()PWǃt vE8؍e[^_ÐUWVSj=u uà jdVu ud€;:t=;t8vCBNu")σGdPQft>d;:t;uB)Kt%)PQ/tE؍e[^_ÐUSj#u uƒtw:0uB:xt:XuB  0< w 0&va<w WvA<w79}B뽋E]ÉUVSE ƀ8:tF>:u^FPu^e[^ÐUSEP8t AЍR8u)ĉE $EPD$tAЍRu5\Su]ÉUSEP8t AЍR8u)ĉE $EPD$tAЍRu2SuG]ÉUSEP8t AЍR8u)ĉE $EPD$tAЍRuSu%]U 5\u uÉUWVSDžj/u$TtE|Dž*|E8 h(4_ƒuу)̉u0 Rp;uvэq}эyD7=v6jhj- VSj! jhj VRSyƄ./ W.PuyEƄ5\u |4@8?wp$U :t @U <uB)ĉ$v|D$RFPE PTy 5\Vh'}P|uDž t BhPTÃ[t a Te[^_ÐU=tÐU hj:j:h5huaÐUWVS,]tE;t@Iw,;.u{t!{.u{tj/SYt ޿8t޿8u482= t3hSu 4$8=ut hƃtTuKу+? V}u8up 5VyhuV˵SVhV賵hVaVƃu ?8t 5.$ P#u( 8t O V V8u 88u 8u  8u ^8u .8u K DžOu~= tQ ƃ8u L 3 5 "4 8$Sh e[^_UWVS]EPS$S}}}S  uGE SMs8uSjuu號tP u'>OEtUUT tL t8t ttB0B0P P 4 4 < < D D tD4D44444G~L 8 4 ЉL u9tL @ t< ЉL u9tL H tD ЉL u9t;4 t8 DL4|DDu]+AtL D L E9L  I~8xxD3 I~D Gt;4 8t;< }Ft@ DDDDG;< |t;D }KtH DDDDGt;D |tL P ;Ev u׾OmtP u džL t4 u ǀ8 t< u ǂ@ tD u ǁH tvЍe[^_ÐUE@(N@,,O48ÉUVSMu ]ut 4@0?Av ww 4P0I  At [^ÍvUWVS}] UF9ust0(vtV~ CJ[^_UWVS E@(Q@,QL EL ; t; u C; t; t j$ϻǃu"8t  EjEPS=;]]E;}E; t; uvC; t; tjEPSD;]tG]t@; t; u C; t; tFojEPS謪G ;]t}u WO%EL ǀP $4E8e[^_ÉUWVS]} t>4L yt@Ƌ ;M v}tE4@0J~ICI~ CI}tE4L B ! D[^_ÉUWVSMu 4L #Z Љ!;ZuO4L X9]rp}t3MJ ȀFJ4L ;Xu 9]smO4L ;Xu X9]s}ttEi24L ;XQX 9]s}t@M5FJπJ~v FJ}tE0[^_ÐUE@(S@,tS48ÉUWVS]} ut-^ЍH9vt4@0Ix  CIyt[^_ÍvUSU] EMfyv2StC#ttC t$UE@(S@,PU48ÉUWVSM} uxE%=uE%=uEgv%=uEC%=uE "%=u;Ev9st($!AKt8v%=ttA4@0-? AKuˡ4;P0t;U}P0tЃ[^_ÐUWVSMu }uEovu EYu EFu E3u E x EtA9]st6.vS~ȃ?Ȁ2JE Ȉt3؃[^_ÐUE@(\V@,XW48ÉUS]U Mt`9vt* ttEtCC%=uqtCC?KC%=uBC%=u2tC S? ЊS? vtC4@0$ÉUSUM E]tPv7t& ?ȀAЃ?ȀAtA trv€t@v'tЃ?ȀAtA t*vtttA vt$UVSuU ]u CFlCB 3脴sysn$fNpe[^UVSuFltXPjV؃ue[^ÐUWVSEplEPÖt)E;F|^VWu@ރvu׍e[^_ÍvUWVS u}~pt V~p~=Flt9P}P@uA VG j*à u bku G 7Cu $ E0ޱCu j3SM j蛕CSMC RswQd E0sp>dFlC^lFpe[^_UWVS]u S[[lt3VY[ue[^_ÉUUPt= vft"tRhwh@@ÉUWVSDžpDžtDžlDžhDžj/u ?ǃ=tD9t<5t(~`t V Vkރu=} t E }tE8u ?5t#FPut6uu8 jt踯F\FhDžl~PPv\襶tu ff;FdtJ~\ WÃ~`t F`PPRFhF`WS踴$訷hh~h]~`t F`PPRF`F\juhhhSjSJǃu jjP8#DžDž jPWѾË9t W蟶JFHFLFPFTFIFHjFLPP` jFJPPx`fFJfFX<$t}t U:u vEPuCgEEȉủ]ԋUUЍEPEPVuxu8E܉ @PU 7PuvZEEPuUEEEEU؋MċA`XuuRhxEPhvjq` t&hEp`r ucg u0 ÃuCE܉ @PܦU 7PuYEEPEPuu EPhxCBڐЍe[^_ÉUS]=uhh轒 u Ћ]ÍvUWVSLEEut>t} tE 8u UUMEUEPV MEu]E C}UȋMċA`@uuRhXxShXwjq` t&hEp` ue urÃunEԋU @PM U2PuWMME̋U@$M U2PuWMMEPhXxZ@ډЍe[^_ÉUWVSLEEut*>t%}~} tE 8t}t U:u vfM EU$MEPuQ!EEUUM MuċEE}UȋMA`XuuRhXxEPhvjq` t&hEp` uX uÃunEԋU @PZM U2Pu VMME̋U$@$%M  U$2PuUM M$EPhXx>ڍvЍe[^_ÉUWVS<}tE8t} tM 9u 9EPu5EUԋBHE؋BLE܋BPEBTEfEjjEPjhEPà u h vEEȍUȋM JMAKWVEPhoRhXwjS t/h)Ep`(C$Pu CSP]ăEPho:=t SЍe[^_ÉUWVS}tE8t} tE 8u EPua5EE]E CEUBMA`@WVRhxShXwj q`  t[t&h;Ep` ua uÃuU܋EEPhx<ډЍe[^_ÉUWVS}tE8t} tE 8u EPuU5EE]E CEUBMA`@WVRhxShXwj q` t&hOEp` uk uÃu uXUEPhx ;ڐЍe[^_ÉUWVS}tE8u vEPuU5EUBMA`XWVRh,zEPhuj q` t&hdEp`uw uuUE ʐЍe[^_ÉUE$ z|u@ng``YRKD=6/(-!>PhOhÉUUtyw7tjw t\KtG6t3w t$ttÐUS]=u EPu:t hu hvЋ]UU hBPRu>UWVS<}EPu u%URh@y8E }ẺEăt E@Pƃ uPuNE0E@$à uPuNEEPh@y~75uSuVuNjEċU V$ٜu?EPh@y'7U EPh@y 7UċE e[^_ÐU=u h,ÐUWVS,}uhjWh h@v} uhK jXh h@ø]ԃWEPWRu hhum t])ƃFPuEPS~эA)ƃ}wyE$P ut vB:uAtBKu[^ÐUu u7ÉUu u6ÉU j@u u8U j@u u8U j@u u8UE hPPu=7UE hPPu7UVSu] SV;tKCPVBt2CPV)1tC PV0АЍe[^ÍvUVSu] SVt3CPVtCPVЉЍe[^ÍvUVSu] SVctCPVjЉЍe[^ÉUVSu] SVtKCPV&0t2CPV 0tCPV/АЍe[^ÍvUVSu] SVgtCPVЉЍe[^ÉUVSu] SV#t3CPVtC PVЉЍe[^ÍvUVSu] SVtCPV*ЉЍe[^ÉUVSu] SVtCPV.ЉЍe[^ÉUVSu] SV2t4t)uCPVt Ѝe[^ÉUVSu] SV;.tCPVЉЍe[^ÉUVSu] SVthyjCPV ЉЍe[^ÉUVSu] SVOthyjCPV~ ЉЍe[^ÉUu u/2ÉUVSu] SVG-tCPVЉЍe[^ÉUu u1ÉUVSu] jSV1tjCPV1ЉЍe[^ÉUVSu] SVtGtu+CPVv, CPVot vЍe[^ÍvUVSu] SVt3CPVtC PV+ЉЍe[^ÍvUu u0ÉUu uo0ÉUVSu] SVtct"wt @t 9CPV\CPV CPVt vЍe[^ÍvUVSu] SV;tct"wt @t 9CPVCPV CPV6t vЍe[^ÐUhĄh[ÐUVS]=t 莋t 2ht}hԌum 5t Mjj9bu 135ƃt 3辎ve[^ÐUh4h蓊ÐUVS]=t Ɗt02h<~h um 5t Mjjqau 135ƃt 3ve[^ÐUhhˉÐUVS]=t t@2hhDum 5Wt Mh j`u .35Nƃt 3+e[^ÐUhhÐUVS]=t 6t`2hh|um 5菈t MjHj_u 135艋ƃt 3fve[^ÐUjhhhhjÍvUuhhhhjlÐUhhhh@jCÐUVS]uS EE$uu ShhhhV0tUЍe[^ÍvUVS] uSEEPuuSuhhhhV0tUЍe[^ÍvUVS] uSTEEPuuSuhhhhV(0tUЍe[^ÍvUW }E@@ @@@@@ <$ÐUWVS }u =u< hu v EP55hV׉à }uU"uE 5É=w Paz}u"tEe[^_ÉUuuuu uUuuuu u2Uuuuu MÍvUuhpÍvUuhÍvUjhUVSuu jjjjhà u% jjjjhӗà t]EE@jURPSS u EBvRh`j09$S؍e[^ÐUS]tt PP S]UVS] EPu]tt1LE0E@t] C PEpE8t PPEЍe[^ÉUWVSlUEEu t.w tvt'ЃEE1ЃEE3E2ЃEЃEERU EPUt vu Eăx>]ă;u C PtEtF;E菊UlE"YvEċ@EEȉEt7w t rvt?hjuEP4iw@EIEăx  UU/vEvE@Eăx @ Eċ@EEUȃϋMċA  ˆUȋjEPEP1R uu E@w Eċ@ uuV}wuà u;E9GuuuyEċ@ uuuuà u }u Eă8t PPEvuUB(% B(}tE؍e[^_ÍvUVS]uM 9s :t B9r:uYtTuSuFD@2B9s :t B9r:uBB9sE;u ve[^UWVS]UM 9:tB9:u9BS9:tB9:u9BBE9CBE9C BE9:S9sg:t B9s]:u9sTBS9sL:t B9sB:u9s9BS9s1:t B9s':u9sBS 9s:t B9s :u9r vE7BBE9w(2BE9wC({s$EvE[^_ÐUVS]uM 9s :t B9r:u@tSuSuR1B9s :t B9r:uBB9r9ED@e[^ÐUVS]UM 9:tB9:u9BS9:tB9:u9BB9CB9C B9CS9se:t B9s[:u9sRBS9sJ:t B9s@:u9s7BS9s/:t B9s%:u9sBS 9s:t B9s :u9r9BB9w,C$B9wC([^ÉUu袀UEPuEÍvUWVS<UDžDžDžDžu tw!uЃ ЃЃЃR PAt N P}Ft蹃tw t YtPGhpv8~0hhSǷ=V|qtPSIu5u 8  V8IQ2ǃ t'IDž0\a;r"F*IDžjǃ u ;tHt EuH(0}tUe[^_ÉUS]K}$C}]ÉUWVS u]}SuO|q} txPh SV螵9skEPVu>uG|q} txPhSVO9sEPVuBЍe[^_ÐUWVSU EEPEPIQRhuƃ ujU])Pj:Rv^ǃtIG9sD)Pj:WX^ƒt+);Er")SWu0E u{e[^_ÉUEPu0Eǀ E{{EǀÐUWVS|MEE] twuȃE ȃEȃEȃEEIM EP/Uu+E8u/hPet~U EPj@EPSub Eǀ'Et*w t Rt;Iuuuh]uhpuuͲ;EEvEEUu,EPEPPPEPRUƃ NEǀEPEPUPPQWEPRƃW{y ueyETyEǀEPEP}IQuEPuM t uxsvE9EuuuEUuxuuSuu ƃ u uuuuuƃ vu urh5Ep.t7EU)JRUDPuuƃx6u EE@UBUB(% B(}tEvU"e[^_UW}wwwwwww w }ÍvUVS]u VC(tCFC(tC F C(@t sP/FtF{(y s5/Ft+C)t s /F tC(F(vhj'e[^ÐUWVS\E x(EU:t:щM}tWMExtPMExtPMExtPMEx tP M utEuhj& #vuEEU:u EuE)P}7VXt0Exu EuE)PUrVXt0}u E"vũE)PEpVdXt0Uzu E"vuЃE)P}wV0Xt0Exu E"vuԃE)PUrVWt0} u Evu؃E)PEp VWuUUEu }*U2])SPVWE9a}t7EuE@.vUr])SPVRWE9 }t7E̅uE@-Ur])SPVWE9}t7E @(@t@vEЅu UB,}w])SPVVE9Et0U z(yBEԅu }G'Ur])SPVvVE9sH}t7E @)t@ E؅u UB 4}w ])SPV.V9rv ur"6E @(t @UB} G(t G UB ure[^_UWVSu >u jjhXjjʁ t?]}IKEEE@EjPSRRu Yve[^_ÍvUWVSu] t.UIJujEPRSS e[^_ÉUWVSL]}L vR\Bvv u t-wtC_uY u,u(u$u h<hHu,u(u$u uh<h*u,u(u$u uh<h h8EPEPr0ƒEpU 2t} u{.u(u$EPu tU,"JC} t} t 0E 0uiuuEU ;BtЍe[^_ÉUVSut:>t PP{t CPP CPN4$ pe[^ÍvUWVSX] } EPt tWE0E@t} G PEpR\Bvjhph>E8t PPER\Bvjhphh8EPj Ѝe[^_ÉUWVSlUEEEu t'w t(tЃE ЃEЃEЃEERU EPUt u Eăx]ă;u C PjuuEăxEE@Eċ@EEċ@Dw ttDuuuuuuuVVuÃ0E@DEPEPEPÃuE@D4}t.E8t&uuuuuPujVueÃ0EăxDuWtMuuuuuEp@ujVP)Ã$Ep@lE@@E@DtPEpUE@E" U"EȉEEĉƒxBEăx @vEċ@EEUċB Eȋ jEPEP2Q ÃGOU+t-qBt@t$E@D] BP&E@D6]ă BP#C@Eăx@uhjE  E@DU9U]suuuEċ@ uusu !EăPuE B@uX BPC}tU:tEăPRvEPEPEPuEăPBPEpu?ut Eċ@ uuV}wuà tWuEU9WwuuhtEċ@ uuwuà uvUăz{}uEă8t PPEu'}uUB(% B(}tUE؍e[^_ÉUWVS ]}uE 9s v::t B9r::uyttu,I)9uS98:B9s ::t B9r::u)j EPBRQ!ƒE8:u ;Utȍe[^_ÐU }Puu&D@ÐUWSp];v=t5SPmIEPhjy Ml8tE Euhh.u=CEPh5#5r}+u=t'=t=t{ 5{sh Sot) QfSPGW=t 5se[_ÍvU=t:PEPE P EÐUVS5 t*6 sfs ~f$vfu =t 5Nf5tSv6{t sf{t s f{ t s e Seue[^ÐUWVS ]} эq@vCv RoV%@4#L4ȅuϋEE9C;,t0;t+v R!V 4D4%@tʃVu Wu)9tJvC;,tv RU 4D4%@u΋EE9_Ѝe[^_ÐUSM] UE8~ qvt-tVt&t7IЅuPSh,Sh!ЅuPh hvQ H]ÐUWVS,u] > VF=Dž hvPPIQP}uP5蔹ǃ tue8V_ÃcvPuEuPP4E V&ttSgu]}t!tu]gu6}t!tu6gu8vPPPXcvЍe[^_ÐUWVSu tsVftuu VÃ{t CC En8eE8( j(`E@E@@ UEhEP7EEhEP6ƃtl8 t8 u F> t> th^Vt)эA~4 XSp_MUD SPV#MEDE}%^hEPY6$eu/}t;E8 t 8,t8 uEE8 t8,t8 t}t E8e[^_UWVS<u==u h PPIQVh5ܵ t- _=t VhAhP2_+u%;#; t; u C; t; t; t$; t; t;tC; t; t ; t;u+; t; u C; t; t; ; jM]@G$5]B WPBэyDž| uO|\u ODž Dž DP\~&PQ]WPS)tQ5hP3tэy DžB  VratHv=5hP 5`Ѝe[^_ÐUhh<XÐUVS]=t Xt2hHh Zum 5<Xt Mjje/u 135< [ƃt 3[ve[^ÐUhdh@WÐUVS]=t Wt2hh(8Yum 5@KWt Mjj.u 135@EZƃt 3"[ve[^ÐUh4hDVÐUVS]=t *Wt 2hرh0pXum 5DVt Mh j-u .35DzYƃt 3WZe[^ÐUhhH/VÐUVS]=t bVt,2hh8Wum 5HUt Mjj -u 135HXƃt 3Yve[^ÐUjh h$hh@jÉUuh h$hhjÐUh h-hhjkÐUEEURuu uh h6hhP+0tUÍvUEEURuuu uh hAhh@P0tUUEEURuuu uh hLhhP0tUUWVS }u =\u< hV\u \`v EP5`5\hLV׉à }uU"uE 5\wW`=w`` PV\z}u"tEe[^_ÉUuuuu ubUuuuu uUuuuu ÍvUuhÍvUuhصÍvUjhUVS]u 9s6;#t1v RJG 4D4%@tC9rʸ;#t9ue[^ÍvUS]t;t 3b SV]ÉUS] EPeuftt8UEU:t 2n8t8]hhWE8t 0aEЋ]UWVS,UEE} t!w t "t'ЃEЃE ЃEЃE܋E؋RUЃ EPeUЉu/];u1hhWuXMЉEt.E" E0*E@EԃE| uHE uuWuSƃ uUE9EvuSuo^EUuЋUE)HPM܍D PuRQƃ u!vEPE0cÃb}uE8t 0_Eu}tUEe[^_ÐUurSUEPuEÍvUWVS<UDžDžDžDžu tw!uЃ ЃЃЃR Pt  PMt2VM"7vt.w tvtKvhphS茊=vHv80hbhSK=vttP$u.ufhP vu3u 1U8#U V8IQ2 ǃ t#Dž{S03ǃ9{Dž)HPDPWR ǃ u tt u}t Ee[^_ÉUS]t O$O]ÍvUEPu0Eǀ EKOEǀÐUWVS,UEEu t!w t /t!&ЃEЃEElExЃEЃE؋EԋRŨ EPỦu,E8uHhP9t3RM̉vnEǀ0vEt*w t Rt;Iuuu<1uhpuu衆;EvEEUu,EPEPPPuR*ǃ NvEǀEPEPUPPQSuRǃSPM u:ME)MEǀEPEP}IQuuu" t uL|Eԃ9EuuuVEUu{LuuVuu:ǃ u(űEU)JRM؍TRuPQǃ u u}tUEM"e[^_US]t) sK;t 3W SK]UWVSX] } EPgt t_EU:t 2tuhhWrR\Bvjhh$BE8t 0 WEvR\Bvjhh-hEPj0 E@ EpJE@Ѝe[^_UWVSlU} EE} twt "t)ЃEЃEvЃEЃEERU EPUt ];u3hhWuMME:Et E0GE@EE@ tR|Bvt,wt@rum uuuuhh6:uuuuuhhLuuuuuhhAhEPEPFE0EYE@ vRDBvuuuuEphhAhEPEPE0t sttWgE0u(MGhj"U EM"EUE;PtE EpGE@E@ }HEE|0 uHE}>+uj:^S)Et9uE@ ] E)PFCEx])CVPREpqQEXCE@ z uuWuVE uVE9EuVuQEMuUE)HPD PuRQwE u EPE0ƃ}uE8t 0^RE}u}tUEEe[^_ÍvUWVS ] }Suytt]U9}"9s::u@B9}9r9tLwt k_}эY+E9uFu}98)j EPRƒ9]sE8:u 9Utȍe[^_ÐUWVS uEUFFF X))ʉ~~hEPtd8t_hEPFtDhEPEt)8t$EEj EPuƒE8taV^ ~4}t.hEP3t 8tO~}u}uE"e[^_UVSu]=t V,Su VcÃ=t VL-؍e[^UVS]u 9sHs VsDlDƒt SDsHe[^UWVS }=t W., WPwj 7u%Ãt7CE)ƋE 0fO )w=t W,EwEvFPPW+EUWDP7RLu<$6Pu_wj 7$Ãt?C+EƃVWuLEGDu7PLE)G vw`E 0=t W+GD$E =t W+e[^_ÐUWVS ] =@u hI@C(hEPE}u迢w8EE8t8+uxuK(hEP3Cy8tK(hEP ƃR8t K(+v8+t!8-tEDPh.j EPV!D8"uE jVhE8tEVh}ttE hEt'=@tvhVh{hEPƃG8tK('8+t 8-tE<Ph(&j EPVC8"uEjVh;E8tEVhTEt'=@tvhVh{ EhEPCX8tK( hEPƃ18tK( VChEPƃ8tK( VaC$hEP~C8tK(@hEPVC8tK(hEP+C tuƃ}tB8tIuEt& hhvPVBuȀ>tK(hEPƃtEt hZe[^_ÐU=hu hhthU=ltj5llhUAhÉUWVS=ltj5lClhhyƃv;#;/t;tC;#tw;/t;u;#th;tcCv RN-%@4@#L4ȅu ;#t;uC WIP5l&vVhSV VHe[^_UWVS,}ؾ󥤃=ltj5lelE EPqvShj EPt h~EPuƃum?8uMD@E.u@PC@P`(G[< ;t 3*8{t s8t S8e[^_ÉUS]s7;t 37 S7]ÍvUWVS@} EDžhWP=-j@V5Ãt\Cj.St)ljGhSut +;Iҋ}эT 8t)ωI8.tTʍvэA9.tTv2tutd:(hS&uS&8t78t08.thSd&2PJ&9.thP(&P&tu PÃu {9 ؉e[^_UWVS}uu WxƃtAVwÃu!(98u tVw à V4؍e[^_ÐUVSu t&>t 34;u V4e[^ÍvUWVS4}GG hu ƃu9 ht$fG?ylGb#M @ 3 t u C; t; t; t; t;=tC; t ; t;=uCv R}$%@4@#L4ȅù;=tȉCv R=$%@4@#L4ȅthqthWuJh=t_  6 EhDž8;t;,t C;t;,u;tCh蘹uDA/hEguD@;td%DAVhP V=ttG;G u5e[^_ÐUWVS,u.@ hPjjjjuu jh+Ã0 hPSPÃ=v4=f+Dž9}HVx D0;v}4(<t19| P.u364 &4 mv4(ZDžDž9V 0x ;T1 ЉD1T1 \1D1 É;;X;Uu t S- B;9sKF<3;w%SV79;r2(;9V9}HDž9}D 4U.9|u#J2 .vvЍe[^_ÉUHÉUxE=pt 5p-u u5xpupÍvUyxE=tt 5tM-u u5xtutÍvUHÉUu5xÉU=Du;D hxyHHÍvU0 t2  t&(t=tHH HUSj +Ãt!@@ jP*uhj!؋]ÐUS]SB9Cu'BCP3 u vKE C]UVS]tD;t6} t#;ssv 4{+F;sr 3h+ S\+e[^ÐUWVS u} ;^s%vW40u C;^r޸e[^_ÐUÉUWEfEfExEI|MEEEE؉EEEEEEEPu xP }USP]E E؍EP 6ESh66uMEPEPSz6xUЋ]UWVSu Ut5Ǎv@A9uu@U t؉[^_ÐUVSu=t V~uu V$Ã=t V ؍e[^ÐUWVSuE H+F8xu@Dž<Dž8Dž4HBHv S 4D4%@tV 4N~ VR6uv R} 4D4%@uj%u4DžDDž@HAHz$~ V59NB4@띁@@t @v@m@^@O@ @@4@t@@@@D\CЉDADž0@Dž0@Dž0 }@qb@QHPT H@ "@@ @Dž08@?@@tEE4@tEE4f@uL@u @tEE4Q@ u$@tEE4EE4s ~ V 3 @@ t+Z4N~~ V2 v R%@ 4#L4ȅu$Du DžD@@uEE, Dž,D;8 C@NX 󫍅XPSP, u@u ,t$4D@u,~ Vx1t tN D8@ @tP^;Ds$)D V1tۅ DD)N4 VDjEE0 HDH D@@u EEP,Dž$D;8: C@NX 󫍅XPSP, u , ,1X t@ ,0@ (u#ttKV+P tZv4D@u,$~ V_/u D)$%@*,@th(tECNBDt4~ V.t(uEE8(tCNGDt1~ Vc.t 9$(u)ى%<,DH D@@u EEL, ;8C@NX 󫍅XPSP,9 cu ,t|,v R 4D4%@t(KV+Pu4D@u,~ V,t tGv R%@4@#L4ȅu D@?,@tn@&CNDtG~ V3,u1v R^%@ 4#L4ȅt4EE8-vNGDtJ~ V+u4v R%@4@#L4ȅt)4<.DDv DžD@DCՃM$0uDž0@@tG@?0`0"0`00 ~w@??@@t_@*@tJ9u@Dž0@GN~~ VF*u D@y&9 VGPf_xtXuOVSC@f@x0jP< 0jPщƒ@up@@tEE@tEEf@u+@u @tEEHEEDDv DžD@DCՃ:wP$8@?[@@t{@F@%=u`@@8+uB@t6@GN~~ V<(u DY@yd@t,9ÃVOPN9OetEtVS(OVS@uZjP @t EE8$@t EE EENy:HvEp46PUr0ǃt$>VWS!Ex06UB4e[^_ÉUVS]u tI=u)=t VVS&Ã=t V؍e[^ÍvUVSu] C8xu@fS ЃfuPЃffC ft, Sfc CCfK {0t-C;C4| S@ueBB"fc ߃{t;SvB9uBC.vCC;EE>t+}u%}WEPEPVI u>t}t;t+}u%}WEPEPS ]܃;t}t}t+}t%E;EuD}u E+EEԀ>t;a>u;t ]]'>t;u 6u+E >u ;uEԉE؃ u$uE؍e[^_ÐUWVSFЁv R%@ 4#L4ȅuˉ<-u E E<+u>F}t}u0u>xt>Xu~E}u<0TUEEEE"!EEȉURPjjEUuujjzEԋEEUĉG< wG<w7G<W;E}x.M9Mw&rU9UwU3UE3E u;E~EAvEEeEUUUċEЋUUUEUEU>FE}yEEH"#}u 5}t ]U]} tE}tFU EUe[^_UWVS<}@vGӁv R%@v4#L4ȅuˀ-u E E+uG}t}u0u?xt?Xu _E}u0DEEEEE"SEE}uEEEEȉURPuuCEuuuuEUEEUĐC< wC<w7C<W;E}x,U9Uw$rE9EwU3UE3E u;E~E?vEEeEUUUċEЋUUUÙEUEUGL}y/EE}uEE"#}u }t ]U]} tE}tGU EUe[^_ÐUWVSEDž|DžxEEEE܋E-w.$h vDžxE܋E܀8u&EʍvE܀80@Xtxuu xEPEPhEPGà u UUu5EPiuSuEPEP Dž|vE܋E܀80t8 E܉tDž`DždE0/~O9JdDFЉd`DFЉ`GE܋E0/~9~}$9E܋E0}u:0uEE܋E00tFσE܉tUUEFЃ E0EE9}9Gdd``C;]|ȉGdFd`F`EE܋E0FЃ ]Eet Eu}u |E܉EE@E0+t -uEE܋E0FЃ 0uE܋E00tFσw^NЋ]܍CE܉0/~!9LFЍBE܉0/~9~E)؃ MN~EN}t]EUU܅} | NtaN Itit ntHh|EPM܃h#FEPuEE[huEPtPE܀8(u4EPhEP uE EEȉEE EE1 EEDžx U)Uu}u}~dRP,$d$] ~#xGM苅`RP,$d$]DžXl} }~?}EE G?)C9E6)]GE UU }|EE4G]C )Et E G]4~ "EEe~@GEt A]EhPE @G]P`|w|v@EEPމt E4G]tEj~@ Et A]}tN]C%k)~3~$E4~ Cp !E !EEE@u+EEd "X1tdWutXXr\XB\ փ ЃtfЃtEPEPuuEjfT}xuuUډE}x}+u}E+M]K}3 6+Mu9~;]~]~)))]~4RTTuPÃuJ]~WuE}~u\\~V\\}~uTT\uPp @ TPmy~}E%=Pxu xjP$PTPwv4ttU%=]}t+dwk)9UB%BEvEuV}uP}t"MpUJ BEEtuuE]huumUE@8TPtݝh0 ݅ht$?EUhlv}u Et(}u }ݝhEEo݅hEu8 ݝh݅h 8 ݝhhl"݅h 8 ݝhhluEU]C%d=unEUEUkPuu1ME]C%=|v&}u }>EE|EP}d@ ݅hug}fE fEm}mE`u Dž``RP,$d$ݝhhluEU؍UB+dBuu(ME]U%`}9d}fE fE݅hmUmMQ$$d$ݝhu}u t(vH ݅hEtcP X ݅hEt?v u\TP&؃}t.EP9EEM]}u}u &" ue\WTIX;P-} tE܋U xtEU쉅HL݅HEe[^_ÐUWVS} +] )ސUB‰M UBU9r[^_ÉUWVS=uE EU4EtuEEE8Gu] wBU9U}x9sQSV ;uvVMM>)u}uPEA~;uv ЉGd}GUs9sQSVx;uv$];uv;]w!Mt )ʸU!];u ;]te[^_UWVS,}E׀=uPUx0u vCM< 0t]MuSE9uA΋UBuH90uA90ttΉMvt AuE9u uAt AuEt )؉E؉PtpurEA+t -uEAt~>SAt TCAt~}tUؐ+]K~ G WEƒUܻ;uvEU׉N9t2 uM܉9Mܿ ǃ;uwE܉8+][UZ W)ËM 1EEE܃9~v)Su? tPE{ыU# t)E~CPu tESu]"9}!)ى˃QuE)]؃E܃M؋U ;J~ u*EU؋E ;PE@)9M A t2t at)Z9u~$CPu0  }t3}t-U BME@UMb u7Pq{}t E~Wu EM#tM)ރSuE @E؃}M A t~:t&t-.Et%EM t+UUEx PEƒU܃9x!t> t2 )ڃ9}$juE؃U؋E ;P +}u%~M#tEM MUEE؋MEe[^_UWVS,]޿8t޿8u  hSu:5VhuV#SVh` V hV蹈jj EPDžuؿl 8u Dž$uؿq 8u Džx>tSjjP+uU( O!Džd h Cƃu hǃuh V Pu6 V<${jh VOu?jhW4u$j;tE V<$ aShc=t 555=t 5==t 59u|t  A~e[^_UWVS ]IMt;u hxvEyE EEPƃtOE;t=ыU| 9},EEPVƃuhv jGBPCU2P};ue[^_ÍvUWVS uE UE;tR:uBIQSV u!IU C UC$;uЋUDUe[^_ÍvUuuh jGÉUWVS 0E³LjIQRj jhsj } IQu j jhsj4$ E IQuj jhjuyUEU EUM@~MEE/vE)ʸEEÐUSMU ]؃wY$ A2BA=RE3 ‰QAAtI$UWVSUWVE08u4it 5ƒE pu҉ȍe^_ÐUS]$!t o=uS=t hi=uh h=t hvS5m hh#u uuuuu u33]ÉUWVS} Uut+jjjhSPR uVSVjWu0e[^_UWVS ]E;t' j qƃt$ jj^Fu4t V CvE8jjjZUSIAU:xPS2y5  C}?t@ 771^Fjuuuu VE0FE v4$Ee[^_ÐUWVSDž\Y`!{ ts  8t `讒Ãu?7 S sdxfƅyjhuzVgIAxjjxPdDžhjDžlj jj.ptnjjxRP{t.hdy p& uu hPSdE\ `\e[^_ÍvU uu u*ÐUWVS,}fEEuhE jQh` h8 XofGhhEP5, 5( jhW:ƃ E E؋EE܋EEEV54 50 EPh`EPhPljV t'|^}|PVSf}u `| FVPfGEҍe[^_ÐUS]t"{t CPPR Ss]ÍvUWVSEEu(Džt rv=uS=t h=uhD)h=t hv 5Ãua h4|Ãu!B{ 7{CtP5Ct>u ;tM9CuCE 9C u;E9Cu3uCPuVP{t CPPRVuu uACiC{u XzUBEC@RjsP CPEPjsRtjjuE C EC}Iw9Iw+uCP8VP(EEC@uuu$u uuus te[^_ÐUWVS<s߃=t hRukjdjdzÃu&=t hpv=Pujh`"耳PPC,EEEEċE EjjC0PVaEPVvu h 菇 FVPC`Fxt VPjh`"s,V`GS=t he[^_UWVS\E EUփ}uhdhh h S=t h}u%=t h=t hvFjVPE@0 Vp`E0PVR tCUUFURVPt(UP VPRtuVUu  FVP$VFjVPEġEȡE̋EEԋUU؃}WVwsu WV^sEPEPu]u"EJ EPRQu&EJ EPRQ u>EJ EPRQu}tEPV>pv؍e[^_ÉUÍvUVSs=t hu!=t h*=t huVU e[^UÍvUÉUÍvU=t h(=u<x-D0//X0L0=t hU juuuuu uÍvUWVS8EE}u uuu u2à E ECuujhpjhpjSƃ uEU ut9}voSEPSRU܋E;EsEM9v;}wPCURj SPCuujhpjhpjSƃ0t u9}wSEPSRas0ZsU؉PU܉PUP CSPe[^_ÐUjuuu uÐUWVSLUE]u #IwRSJ SbÃurr Sbu|r8ugrrZ uPuu uƃ u:Er8t+;r8 t!1rE'rPU؋PU܋@ Et r8t r8 u'}t!qUqU؉PU܉PUP Sce[^_ÉUjuuu uÐUWVS uEuquEPuVuu dà }u vEPSjPRu`} u 6荐G }u vsGUJE PjRQ UJEPj RQ+ EPPR jjuu SVj%E s$Ee[^_ÐUWVS,EE}uw}  u dE;} PEEE XEPubeju"CvEPub6 uiÃuoAUB@9Eto tW ti} t9u F Ɖ8u jEPjjus u uuuuu6u uuuuuà tq} t& E 0VC U rEC@ @}tCjjSP5n nC}t u3e[^_ÍvUVS];}85jSƃ؃tG Vu V( SuSh jKe[^ÐUWVSDžxDžtDž|]S EPSj>=t h=YƍSjti=ڻЃtfЃtتPj躧uN 5X=t hEjEPj^9}vjPYC9|吃=t hjEPj} uQlEPu^t5uuuXE uuuuXE}tukk@jj聦x EeEeUMPjHtU rrP.M AtMǂǂǂǂEǂǂǂjEP 3E3EEEEċEEjutӁèS@SEPS3hujj@ tPRt |Ph~futAExBtJExBB tǁʁfBfBBB Bxhv hH xi iCxt+ xtt te[^_ÍvUWVSE E U$ UrDžDžXS7 hPSj=t h<t2=thP<u΃=t =t hu v8<t2u2FP6fdžtDžDžVDžPDžT04jHPx nDžu }%BRP@DPDPRt2UP PRtuUudž BRPj6 ;tdž8u <@EġEȡE̋EEԋUU؋0;8u4;<0;8}"0+P((4 8+P((<+TBy (B@B(x ,yDž,Dž(( ,BRjxPPDž f~%@fjjjP6 à y8tЅy8#Zv#O;;u8j(P,(+HPP,+LBy PB@BP;8uT;< P;8~džvP;0uT;4 P;0%ѥ`x?B~ h@B000BB=?B0j@BjSP]StKEPS_}u}u džPEPauYEJ EPRQudždž}EPR\bvuV~MEJ EPRQ t3Edž džx dž=t h=t hjhPj=t P:e[^_ÐUM EPAAUWVS8Ep]S2 EPSj=t h<t4=thP<uuWU Ã=t hjEPj=t P؍e[^_ÍvUÍvUWVS8} Ep]S5 EPSj=t h<t3=thP<u΃=t =t ht tF*F}$h  urMQUFPu~ uNMQ~MQeFMAAA]{FssPCCMH8@#MB@ UMB UM|=t h=t hjEPj=t P z=t h"=t hKjEPjd=t P萿e[^_UWVS8Ep>]S EPSj =t hv<t5=thP1<uӃ~t Wx zt PR V"Uz tB 8t PExt@8t Pv u=t h̿jEPj=t Pe[^_ÐUS0]SH EPSj=t h=u<8<dEDDlDHlE=t hjEPj]ÐUU@=wz| z@B~ÐUWVSX]EEPo}Uȉ]̋E EԋEEЍEPRh j,}ąG @9G h辿ƃ wt;Gt0t*WNMPRQ E@f@UfBTuAfy:NMF Ph SkEXFE@f@UfBB VS*džMA0AEv? uuUЍe[^_ÍvUSEt Pտ؃u]ÍvUEjEPj hu ~ HÍvUWVS\]0DžDžDžDž,DžDžDžDžDž  u  S`Gǃ ~PVJzMǂ(P . dyDžUӍ0B B0r @ $C@fDŽ|0x j BF9wuF u=, PDž W/Fƃ>uVDžGu1Dž" 莻ztuDž jP433EEEEEEMXE \U`MhElHM PETEBEBEB EBEBEjMQ<EPEPXPUR E̍MQPẼxt URPEEEEM(E ,U0M8E<U$M jEP;EPURt(PMQ<u/Dž Dž  E̍URPẼxt MQPE(U,9|;N9,sDžU‰ CS04=uC@j0 ;t h [tdUЃ8uM@j0_ ;t h `DžF;}$xP誺ÃtۅuDžDž;9Džf~tf~ ftDŽxN(JQRjMD0ƒ y)8t h` _Dž;u1EEEHEE(dR;qEEEEEkjREP68EPURL}}t^tZf*2E H*0hhvSV<t7CPV;t#CPV;tC PV;e[^UWVS =uE jjsj`jsƃtu7hhhjP(8 8蚣C@ ]S9 EPSj莞=t h=#SjVrV=ڻЃtfЃtت= thhhh Pjq u 5{;}Ij P詙C;}*ߍv= uhhhhDžPPu购yq89uU rruϡyLW6 L6ɡC=t h袚jEPj軜"=t hrPu(jEPjnFEF FU 2ϛFUU rrP?U FFjP胠\333EEEEEċEEjjF,P^HSEPS2u ~ u軣v FL^HSPFDFLxt SP Br4u  E u  Eh}h|puuFHP Ovt>t ~t v芛 V~t de[^_UWVS|E EE U$EUUzwHG,EDž|uhhOhh w ]Ș EPSj!=t h茗<t2=th PJ<u΃=t =t heu EP` u EUGW E}u }u}tEG UHÆVwDG,PVR tCEEFURVPt(UP VPRtuVUu  uG jVLvuV8=t h=t h0jEPjI=t  PuG }u~=t h|=t h襕jEPj辗=t  P$}}=t h=t hjEPj,=t  PXG EġEȡEEEp V5EPV,u tv9]uG PEP/ ufEJ EPRQuG G$uVUu  uG }tEEPV)-||tEJ EPRQ =t hQ=t hzjEPj蓕=t  P近G e[^_ÐUVSu] uhhhh-t uhhhh-S VB B$CB(Ce[^ÐUWVS,]uhhhh< s~H ]SZ EPSj诔=t h<t4=th P֐<uuWU Ã=t hjEPj=t  P@؍e[^_ÍvUÍvUWVS<]} EEąuhhhhLvs ]S1 EPSj膓=t h<t3=th P讏<u΃=t =t hɐt tFvFj}$\ uMċQFV F FV MĉQ vvuxVFMFAFAF,1M@F,F<MF<F8UMF8v=t hN=t hwjEPj萑=t  P輍z=t hҎ=t hjEPj=t  P@e[^_UWVS,Ep>uhhzhhvEp ]S: EPSj菐=t h<t5=th P赌<uӃ~t>t 6BVLzt FHPR~t v踐 V謐u衐=t h蘍jEPj豏=t Pe[^_ÐUWVS,}uN ^ Mb)؍ȸEfESjEPt u+F 8tF F$zEEPEP6eu}uWu 6Wu 6ǃtu&F$6F jF$F e[^_UWVS0u }EEPEP7מu0}u*]~_vSV7t()ƅ~@]~5SV7PuגG$G  )ƅ̋Ee[^_ÐUS0]S\ EPSj豍=t h=u<q;}wu9sU:u_uumUtr^NVjfOËE u h#vdVjS9s#}tSuUE]F9suU:u E 0{U vUЍe[^_ÍvUWVS }] 9sSuUt ]F9rЍe[^_ÐU=<t <*EPj>u E< vÉUSU Mt`"t(#t9~؋$ÍvUUt j tÍvUWVS ut>uAD;=t$4VtC<ue[^_ÍvUWVSbvEtD@E=HuS=t hv=Huh hHu=t hvv 5HjuE=LuS=t h-v=Luh hLOu=t hFvv 5LtÃ}$Eh j)-vEp 8Epu8u3 E00E}t @cvu5HHEp8u3 E0^0Ã}tDP5L9w u$E' u&u8tuuM8u t9u v Q&e[^_ÍvUSj RvÃtx uCwV$|vu )C;v3#uh j"(S!w C ؉]ÍvUWVS ]fv{t 3 3F#E}2UBHwƃ{C$MAtE@tUBwMA{ExUB]J Mο 8tu8EpuXExP Uֿ 8tu8Ep8Ee[^_ÐUS]t${t 3J 3f#$Fu]ÐUS]KRPjhpjhpjS H!؋]ÐU0EPu:t*EPEPt u#UVSu] DžttPxPV}ztC Džt tPpPhhVw xPyt(pupu ySpCЍe[^UWVS E0[E@xt;U28uqM@8uR[DM HA EpU Bt& M 1kU B CFe[^_ÐU EPutuuuv‰ÍvUWVS]h!EEURD;uyH;Cun@Ɖ8u}u} t%E } tUR@M }t u#'E}c}t u#e[^_ÉU EPutu u<‰ÉU EPutu u‰ÉUSTUE t"vtBXjEPCPR1QfC† PPE5Xj.EPCPRPtbfC† PPEPhEP] PBPPh=EP< x UЋ]ÐUWVS(}Eu |(ƃ >/t\j.V à @PEj.Vp à @Pӫ ] j nEt mtzc junǃL@@@ @؆fGGPVj WpE@x jnE}UB؆fBЃPVjz ununE|E@UPe jjwmEtQjjjPxE@ jgVÃSlQIAUUBEB VOnEe[^_UUt  tÍvUUt  tÍvUE HEPB:AuI<uEfB%f=ufA%f=tfB%f=ufA%f=u ABvÐUDžttPxPuCsx@yt t#vufzzÐUVSu] uhjMhhDGuhXjNhhD*vSVv thCPCPV0 e[^UVSu] uhj_hhTuhXj`hhTvjSV e[^ÐUVSu] uhjphhbouhejqhhbRvSVtfC PV tM{ w@C $xsVS&CPVtCPVЍe[^ÍvUVSu] uhhhhuhphhh{SV thtt+=CPVgtACPVN CPV{ !vhqRhhhЍe[^ÐUVSu] uhhhhuh{hhhSVt7CPV t#{u jhC PCPVq ve[^UVSu] uhhhh(uhhhhCC>u]SVtLCPV/ t8CPVt$C PVtCPVe[^UVSu] uhhhh`w7$8 0 (  Cse[^ÐUVSu] uhhhhtt Cse[^ÐUVS]u uhh*hhuhh+hh_Ct t"2{u [Vs Vs  CF>w($CFCCF CFC Fe[^USc 5(cÃti=t hch h( ct=t` hdN=t hcuT jeÃP5(ett SfCCC ڐЋ]ÐUS]fEfEBheEEthEExEDžxDž|EEEEPu EPIƒy$ uei EEЋ]ÐST$L$ 18uBu[ÐU0Eu EPUÍvUÉUSM] t,rtJCvEQEPQR.AURQtEvЋ]USM] t,rtJCvEQEPQR.AURQtEvЋ]USM] t$rt&vASQPvASQ]ÉUSM] t$rt&vASQPvASQ]ÉUSM] t,rtJCvEQEPQR.AURQtEvЋ]USM] t,rtJCvEQEPQR.AURQtEvЋ]USM] t,rtJCvEQEPQR-AURQtEfЋ]USM] t,rtJCvEQEPQR-AURQtEfЋ]USM] t,rtJCvEQEPQR-AURQtEfЋ]USM] t,rtJCvEQEPQR-AURQtEfЋ]US ] EEPut EЋ]ÍvUS ] EEPut EЋ]ÍvUSM] t4rtVOv;EQEPQR3AURQt}Ћ]Uu uÐUWVS ]} Uփt )ƃ;u4CRWSPtit`CVhPSP7;u7CRWSP t0t'CVhSP ;uȍe[^_ÐUWVS}]E 0SWM;]v?uyt r=tGftbu)SjB2ƋE 0u h1SVW&t V^E Ѝe[^_ÐUE hPPu%ÍvUWVS}u ]VW3t?{tv9t{u}tuWU uWSЍe[^_ÉUWVS uE t)ruIMEPVE9EMAt rEtQktgu*Qj0ËE u h6EuSV$! S3]E vЍe[^_ÐU ju uÍvUVS]u tSrvFEUBCRSPtlSEPSRZCURSt@CURSt'E¸M ډVЍe[^ÉUVS]u tSrvFEUBCRSPtlSEPSRZCURSt@CURSt'E¸M ډVЍe[^ÉUu uWÐUu uÐUu u/ÐUu uÐUEu`ÉUEdÍvUEPu ^0u>Uuu ^0uvUEPuu uUVSu]=`u jZf Ph5`9t)uS5`>5`jjhsF8 u  Ph(5`49=dt Vd VRfU EPu uvUVSu] =`u je Ph5`8tuS5`v5`j 38=dt Vd VeU E Pu;]0=ÍvU u u]0U EPu uÐUS] =`u jd Ph5`7t)uS5`菵5`jjhs6 u- Ph(5`7]UE PuUS]=`u jPd Ph5`07tu S5`5`j 6]ÐUWVSjxVÃCuh ji C hC_ƃu CS seCщ $UCu SWVsGCC ؍e[^_ÐUVSut> tZ~ uJ~uFuh j vÃttCtWv^t];tXj:SF$Ãt- jU‰@~uFFP^t;ue[^UVSut> tZ^~t v~ t v U^t 3j؋[$Uu VUe[^ÐUWVS]} WS:ƃte9v,~\u&C9v~\tVFPPEWV5Fz\uBZSR(Ej\SҬƒuՉe[^_ÐUS0QD=@u`=t h<sQ=@uh h@PÃ=t h<QDuX 5@8PÃu? jSÃP5@LStt S(TDډЋ]ÍvUSj RÃth0=huhhKhtC4C" 0 SSv]ÍvUWVS ]t\=htS;uK{uC4Ct"N{tCxt @C3=,u hQƃ5hhV>#t܃ j zQǃu VY jDaQEu V7EGG@7PViu V\RuQR<$IR+=4u)=8=40 V'R,%8x8@88C8@e[^_UWVS ut>t > tvFF 0=0~ VQv40,48tB{Cxt p1Q s#Q3Q$Qu VP5h\he[^_ÉUWVS E*}[E8Ou85j%jh`.5jjhZ. 5j'jhr.5jjhn^. 5j)jhG.5jjh3. 5j&jh .$ =4t/4tuC0Tto[u=,tUhhKEu , h;NƃuB ug[n  sI uhVÃ8#t݅hPEt}эQE)9uZRuSuF jDtMEt@@uVu uNE@}u V]N uSZEe[^_US]t- 3,N{t sN S N]UWVS ] D EPhSDU EPhjdDÃZƿ 8u M Ay޿ 8u E @S޿ 8u U B.޿8M AEPhjCÃE @;t>btb-t&vuU JM I QC;uƒEPhj/CU B !EPhjCM AEPhjBU BEPhjBÃƿ8uM AAyE xt pK jUJU BBޅtBj,VËM QA4A@APq(LU Bޅuȍe[^_ÉU-8*w,$` !); `ÐUPuhڍ5)ÍvUWVShqIà  jDUIEu S}uE0St:UjSXMq SR:UB jSXMqS/:UBjS֡XMqS :UBB$HMAu 1IGE;ps5vjSqXUB4S9MQF;qr΋Ee[^_ÐUVS]M0j*j hhhPS  t.hhMch+ j hMch+ uPhhu hu( L0e[^ÐUSLt" unPu hu'L]ÍvUEXÍvUE\ÍvUUu  UWVS }}EG;  Su9u?A;Fu7yuy u yuytcA}8tFC; }O뙐; }?v S9uytA;GuEvC; |ǍvEe[^_ÐUWVSu UfBOv hPVuu xeƍF;EwV VÃ4$;] u%;Eu uPtOyЍe[^_ÉUWVSu UfB;u wQE ;EwFUBuUBUfB9}vO~j hPVu u xƍF;E w V~Ã4$quuPSPW tOЍe[^_ÉUWVSu}EuB 9Iu at+5jjh# 5u u4Džu } ~ DžDžDžDž<DžBSy"H 0h5 Dž;} Dž; J 8t :xu Dž"xu Dž Džv =XtbDž|PWVE PEPPX > $Dž| C)! |ttKj"jjhh u h@Ph@5""Džx=HxA=Pt*Bt@9T=Hx @TjjPwFHy'jFZF 0hvCF5H Fy,F F 0hPPE PEEEEE E jEP5HPU 9t%EE 0htfDžtff)fft'Pt5HHÃ[EE 0h5m 6  Džx Vl9~3t5jjhDžxf ff w0P t tf)ft)Pt5HGÃ$CC 0h2`xtfHf)fftGfw SP5HF~f)fuff;u a 5jjh;+ 59~PVC}v=Hx=Pu@9Ttf=PtJ@TjjPBHy&BB 0hXL = t=LuK5HBy B 0hcvLju u5H;E A 0hݿ5=LtIƅyDž|fDžzjxP5HVAL_Aju u5HdL ;E t< A 0ho5} ~ =  DžCjP @CC=?B~k@B=HyjhvHfDžfDžDžDžDžRjPjPWJ ?8jP5?;u; ;}^++BBy B@B ? 0hvu0t5j jhDžy>DžPPjWV5H@ *z> 0h5NDž Ith5?Dž( ff;t,u a 5jjh u? PXu)u a K5jjhK ui7PVUE PRuNu a 5jjh2 59~PVJwBt tuat35jjh 59~PVv =`{ u>Bt2t5jjh^Dž`u`%!=!u5jjhu a t2h5 59~PV vttu  u!=\tqDžpPWVu u\ w $Džp ;C)~ u>pt Y>; ;Y >u#u :=:< :Ѝe[^_U=Hx9 5H=HLPTÐUWVSu] }9mN=tv9tBu2;Xt f^P }}DžE u)E uuPPW&t4Ѻ;Mu0J؆PhhSkmу;M4uPuFt t2FtuM _~uD~uS~ u9Ft@zu6z u0zu*9BtfF%f=t~uM }h}^E E D8hP2 Ѻ;MuPumdP7wÃtC8;Mv SQu3u$/aE uX8u# u uuVA …u,%uu2 tЍe[^_ÉUWVSu]hPu j< эy9SPV%ExtmuhPujxLD9w9T7PR;7%:D0vЍe[^_ÉUWVS ]} uKfS%f=t%f=tf=u+v&WQ!tэQ#shVWix9rЍe[^_ÐUÉUS] EtzuQjjj4y1 P7 jjj4y P7t%jjS~4xv P7=t h,uSuhhfh}hEPyà =t h-uE‰Ћ]ÐUWVS,] u}tt t~EPujuuZhEPuquetLut,t#E؉EEEfEfEWEPuSWVSu/Eԃuu|utltcWVjuÃ}u WP8t'0E03t SWSuDEԃ ue[^_ÐUE UttRuPuOÐUWVS,u] }Et t;tSVEP18u؃>tSVEP7u؃>uv~u ~u~ t]>u_~u9Ft(>uC~u=~u7~ t19F t El=t h) uWSVhhoh}h EPQÃ0=t h)uEԉe[^_Uu,UWVSEE}E8t8эQMYt-;t(8tэ E;u݃UMT}G E_ttEuEE‹MT R*ƃuE (vx}܋E8t">0WM܃U2FMYtPE;tDv8t2FU܋}G}3RNUװM܃;uFUFDE܋MAFA F }܉~YtJE|}E;t4FM܋U BU}w 3Q5EE܃;u΋FUe[^_ÍvU@UM؋E EEUHEEЉEEEEuQÍvUWVS E }8E} +EȉUuU EBDžEtE ptH C>t>9}vt6tC9|9uDG >u~DUB U ;B t@@ UBBUB B 8BDžvEtE pEtE @ ;B u.>v8Cn>ugb>t]vEǂ@f@fǂ 98C>u!DŽ8uau@u 5e[^_ÍvUVS]u tY{uO jr&u/@@@ @VSP7e[^UWVSx_Ut$z tB xu @9t uu jrSv uD8ډЍe[^_ÐUWVSu} 5=5 H9sutWs t _HÅuك=uH؍e[^_ÐUWVS ]ufu u@ZtSu uh. hWjjjSu uj4Ã0~! @tuhWP Ã&t h@AuuSPÃy,t h~@Fu fFfutt"fFPFPh5Fw.$@%@@ v@Ѝe[^_ÍvUWVS}EEEEEu u@v@?tv8.uF@8u9v x.uu, Wt uuuu PdEd9r3uuuu jW\ …D@UEvu=x ED=Duuuu 3W a8=@tt#uEUBuEE uE܃;t }{}u-u  @u uuuu jWQ …=}t E@(}t@}t @Ѝe[^_ÐUWVS<u] uu@t# uu؅uPVh@+ uHэybOx!<7.uWVPƄ/b]vщ߹ыL~@0SVhPA uuuue[^_UWVS u   hfhPǃKjPPEC;v R~ 4D4%@tʀ;VP貏@Cv R%%@ 4#L4ȅuЀ;sF>t+v R 4D4%@t`?hSh`;<$`;4vWhP{ WvЍe[^_ÐUU hPRuUWVS u}}t}wy xv=t VE V~0tF@9F0t v0F0FF^ y v\}taEPEPV Ãu E }} u_ WBE uEE;}t} W E } u!؃fF FFCFF`ˀ;}t}uf^ E F~ttF؉F ~F=t VUEe[^_ÐUWVSlu$](uu@;vt uuu uh~   FFuf@@f@fEV ˆV ˆVf~ uE} }}}~u EPEPSWu ؗ \)ÃWEP膙WEPuUfB}}  EPEPSWue ǃWj WEPWjWjUfB E 9GWEP諘WEP蚘WjxWEP{}tuuW }UfB )Ѝe[^_ÉUWVS U} Eu}:)к ~mCSj)~SPڗCCSjėSj趗UfB @fB )Ѝe[^_ÐUWVSDžxDžtDžpDžl=u =u u f=@u f@5f dd`z h hPh`[_t`DH=`tn=\s>; t9; t; u tDžpC;t0=\r€;t$; t; t; tC;t; t ; t; uhh|J;#8 t t t u C; t; t;V; MhSh`_hh`tDžp#8 t  t t u C; t; t;; hSh`(_j h`Vt`DH=`tU=\s/; t; u t C;t&=\rр;t; t; tC;t ; t; uDžp 8 t x t u C; t; t;X; Oހ;t>@v R%@ 4#L4ȅ?F>uǍ󫍵DžDžj5h.j W,6PVWS zzw"xrrPx 󫋕zw"xrrPF0xǀDDD x pv8g t Ql ; t; u C; t; t;h; _;;VC;tMPhSu5;;t0;x+v R 4D4%@t3PW虪,lhVhMSCC;t5;;t0;x+v R- 4D4%@t3PWtllI l4h7ll" l4hlllǀhlAl_PWjAlǀTTT ThCC;t5;;t0;x+v R 4D4%@tʼn3&t/u. W{5ƒ#hWjtxC h#hyٿhh@v‹lhl@l.8u+ t uh|P|hP肊x~ x ld Тd |h=`uAhS%u&j.SOt@Ph`.puD`Ht % hthP e[^_UWVS ]tu Sh@讂;; t; u C; t; t޿8uX CP3ƒd Тd d(dPhL޿8u;uu uh  hq޿8u  ޿ 8u m޿ 8u H޿ 8u @#޿)8u @;t#; t; tC;t; t; u;De[^_ÉUEx%=uÉUSjEPE3]1Á؋]ÐUEv`ÍvUVS]s{t s Su׍e[^US];tEEj EPS 8u}tE8u ]ÉUWVS|uE}UȉUEEEEEEEE}u} ~~~~Ftt E}}tE}t?`=`x1U;u {t{tE;Cu E;C&;yԉE% =t= =t%= u}teEv}t }t}uF}u}uEu EPx Eu}}u`=`u};E;tCt ;vE;CtCt {E;CtCt {}uE}u {tCE}u {tCE}uEPu UREPu uEPE}}tUztE@Etxu퐃;}+Et E5}u E#Et EP- `=`u}E;E;CtCt{u{E;CtCtmt{uc}u {tCE}u {tCEEPu uURE}tExtURUtzu퐃;D}tE}u%}tEU0E E}t uEEe[^_UWVS ]}E=t hWSkt$= hSu h( hr!h}h@ EPr tt!Dtt]3TM]tjWSƃu/[u=t h.UE0=t h}t ue[^_UWVS0]u EE}jjsy8t PVS  s tit ppPSGt(jVwÃuEU}t uډЍe[^_UWVSTu}EEUȉUWVDt vEÃW8EPu [ F;tEPSVUBjWEpÃ}UzE@ExuEPu 3OusF;tu`EPSVUBuUjWEp5Ãu;}t&UztE@EtxuEU}t u ڍvЍe[^_ÉUWVS}uVW wxtj%u CÃuvuVu W u 蹣E un+E UC]uVRWǃu;Et2v{u"sEPVutEF[uу uЍe[^_ÉUWVS ] uEtI QCu&QVsve[^_ÍvUWVS8uEh~!ƒt^EPRjەuGE 8u?~u9U؉%=t!=tttE ]E M A PÃtvC CU rjPSM AACSCBC}uQ E؃qPRU B ruP؍e[^_ÉU ju uÍvUWVS u] VtV}$t  St- t{ S$ƒ w`І7VutH%PSaƒ t#R}uFtuFfPe[^_UUt"=tv9t 8uÐUVSu^uUjjjy5 PK jjjy v P#t%jjSx P^Ѝe[^ÉUVS]uE ;twf%f=t %f=u S1u@Sj EPS~É58u}tE8u9u ve[^UWVSE}PEEPt ERu}& EPTǃEMQtkdEEB;us&XEȍv#l9htF9rEljt}u ~ ;t}EERu}tuM9M}>uNx-D;D ~! \DT TL\ NyEE9E|‹UEM9M}MωBAME9|B W~e[^_ÐUWVS$]}EȉDžU ډ}t}}}fCxfCS fS +PSw  xt0}t}t }uAщEDžtDžpxx9 +PSv % (w  x|xuxx}t}t }| hWSu xL WTvt<щ+9~ pQ+PP}u'||tpE9|tT| |&Pu &$ j@&Puh#j%譒 |t |Ght,h j%\#|u |uttu"񉍀}u󥃽|HE Pju|PEPBupt/~t#@txuvputxx~9s pttmdt)}u# EPy u;vuu uu@E@e[^_ÐUWVSU2RU}}}ȹ]hǃt# hEu Wv@UBtYt ~tZuuEE}EEEuEEMMEOvuEEuEE}E WSuHvEPVy W#u uuuuW tCtt[t{u}t! uuuuuJ tC Wu}u#@t#tUEve[^_U=uhhxgn 5gÐU=t 5UWVS< u =u<hhxmu} vv5h PZnǃ=?#tσhZWecth^WMcÃtDžCt;t; t; uC?߃uh^SbÃtCWu(ct 1륍}UȋFEEEEPRhqRt7FCF C tSVG[uɋe[^_ÍvUWVS,U2Z}}Gtt tuSVuUE}ue[^_UWVSl] uE}UȉUj VA2t @EEh^VXau}u@t<8t78 t&8 t!}uEh^P at @t8uˍ}EEPEPju5u.utZvtuVSvt މE}t&EUBttE@EtxuuEe[^_ÍvUWVS\UERU}]ȃ=h?u hh?:K=d?t 5d?d?Ext xEPhd?}IQuh!5h?. uL}uEEP5d?tCttv[t {uvEPhd?}IQuh!5h?T. u5u5d?HtCtt[t {uv}u@UEЍe[^_ÐUWVSEEu t h-Eu@} FwfGE_ GEGEtSuuh7b hujjjSuujAÃ0~# @tuhuPÃ5t hQ u@uuSuÃx;E~ FFFu fFfu:FEt6fFPFPh!HavfFE_? uEuC}w.E$ @"@@ @e[^_ÍvUWVS}E @EEEEuu@g@?tv8.uF@8u9v x.uu$ Wtu PL?vEd9r'u jW=…%@UEu=x ED=Dtxu 3Wj8=@tt#uEUBuEE uE܃;t}t}u$u  @uu jWO…;}t E@&}t@}t @Ѝe[^_ÐUWVS<u] uu@t؅uPVh!I^uJэywdt%O<7.uWVP͵Ƅ/jbщ߹ыLv@/ SVhhP  ue[^_ÐU EUB E EjjEPujR HÐUWVS@}jjjƃtDjW]S Sh i V-t V$U V EP'x` C p6]ąt*{ tC xuWsMtɉuփ uSu [Ѝe[^_ÐUWVS}=E 5_ N6Wt^;t23Wt} t u v t ƅu=u7 e[^_ÐUWVSEEEEfEEEEEEEvjjEPjjEP  uƃjjEPVjEP y+8 %C VtE9߀{C tevCtKfC fEES`U{`tC`MLMEEPUBMLM%fE]f} fEf9C tUU~f}MAMEEMEEPM!Щt)E8tEE}tMME}~EEEURwM"wtt;> t,> t'HDs3h^VcKƃt Ft>uCe[^ÐU j ju薲UWVS u} Wjjhd(&u#Ft Sj PhuzWu؃Wj e[^_ÐUWVS< u }`#E=`tE@ ! ӽPSVu0tdS8t#F0z Pht(WI-+aWj >u4t+at"V Ph(WܡuP P$ PPtPh(W苡 lhPjjPu y#70y Ph(W:$WPDWj Ce[^_U5uÉU u huUWVSLuuIEPu u.y(|0"y Ph(V ]# E# U}MƉMMȉMMʉM=`t aut R4@4h@,V =`t atVj;=`t aRVjjh(謞E# tVjjh(脞E# tVjjh(\E# tVjjh(4E# tVjjh( E# tVjjh(E# tVjjh(輝E# tVjjh(蔝E# tVjjh)l=`t atxWSjo Ph)VLuSjR Ph)V/ uSj2 Ph)VuSj Ph)V =`t ` tVj Vjj]SVj jS Vj@jSVhjS u }u}u}uVj 藢e[^_UWVS(uE }hRVURP Qà x.uWj.<WP 3e[^_ÉUuhu usÐUWVS]uSuEEPu Pƃ x2щJt|.tB;E} f.Mȍe[^_US hPhu unà tuPB؋]ÍvUWVS ]} u{t)sW Du t {uׅte[^_ÍvUSEU ]xt;ut@/ xuRh.h`D(t`D]ÐUSEU ]xt;ut@/ xuRh.htDȟttD]ÐU juh$+ÐU} u$`$juPÍvU juh$ÐUU+wr+w/w ++  w ++@vw/+txw +I< tI w +,@t')@tRh,hD'DUS]j(hDS%1yShhDD]ÉUWVSMf f׃ȉfӉ؃ dȺRQEUEPh,hEhEe[^_ÍvUWVSE LPC=wD1uӀ;.u^C=wt:3 C=wt t0C4;4rA~4 ~  ȋU[^_ÍvUWVS EEEE |PC=wD1@tCv R%@4#L4ȅu=wuEDPЉEC=w D1@tCv RO%@4#L4ȅu=wuKEDPЉEC=w D1uπ;.C=wt@EC=wtHM荄A EC=wtUTЉUvCv R%@4@#L4Ⱦ@uŐCv Rצ%@4#L4ȅuE2wg$&U<M<U荼8M<U<+}E2w$'M E  U vCv R%@4@#L4Ⱦ@uŐCv R迥%@4#L4ȅuϋEe[^_UWVS4EEEEEEEEEыE\EPEPǃEPEPEE}u}u }M!v}u}u}M VE8-u E@EE8+u@EU tABUE=wD1uˋE8.uu@E=wtNE U@E=wtEM܍L ЉM@EU܍}ǀ@vEEv R£%@ 4#L4ȅu9]rƾ@vEEv R~%@ 4#L4ȅt 9]rX9]O EPEՃ@EEv R%@ 4#L4ȅu9]rƾ@EEv Rܢ%@ 4#L4ȅt 9]r9] EPJE׃@EEv R{%@ 4#L4ȅu9]rƾ@EEv R:%@ 4#L4ȅt9]r9]s EPEփE UՈPM׈HUֈPEM AEAEAEAEAEA EA UQ A A AAЍe[^_ÉUWVSE  Ph/xSE4PE0PS DžSE4PE0Pu,E Pu u Dž!hPU )PR ~/E4PE0PjhqDž/y s;}gE4PE0PIQVE4PE0P)؃0~0P+Pq0;|$E4PE0Pjhn/Dž E4PE0Pu,E Pu uL Dž+u 9؅yCE ؅yC)tE S PhuzxP}E4PE0PxR xgC9"v//Ph/xSC}E4PE0PS DžDž9} DžxhV|Ƌ+E ~ Dž;}$E Ph/V|ƃC;|܍E4PE0Px)PRDžME4PE0Pjh E4PE0Pj0U)Ѝ@qP xh/V{ƻ;}SFE u3=v P豈 4D4%t E .C;|E4PE0Px)PRM} 9E _E0+e[^_ÉUWVS ]} ހ;tNtWSlu )9v5H2;t'v;\u C;tv;.tC;uC;u)e[^_UWVS ]}]EEUuWjh;] s_3D;E wSCN~KPh/;tuWjh vx9uWjSx&CNuWjhbx+E/EEUe[^_ÍvUWVSU}uEEEuPE0E PR(E W6_Ãt ?t<u%t x.tCU;wI.CuE8v0@@EUuVS3CUUEe[^_ÍvUWVS u} ];3vh/hh0h0/I 7)3e[^_ÉUWVS ] u};vŘ#Su6 WVSe[^_ÐUWVS MU }uEE}uB9r4VWjhErxE$NFe[^ÐUUt7BBB@BBBB$;8uÉUWVS }u v>xuxtf j(DÃu h<FC {{CCCCC C$ S؍e[^_UU:t@<uPRÐUWVS}u FEPÃu h<_9}v:B9|DuSÃu hG=vC؍e[^_ÍvU uh(5<$jvUuJ\Uu uS^ÐUub]UÉU5u5Ph1h=j&UUR UMQ Q Q ÉUM UfQÉUMU BBJÐUWVS }] EE7G";] t ;].C;EvUG PjtC;E\ EPgC;E\CfE ȉfЊTCU(fҍfTC fU(ŠT ;]s,ECN&7G;] u ;]s .C;]rv_( C+E e[^_UWVS uU UUU UBUFAShT²t}-T<FEShT菲,-Tu2tE9EUBUE+E =lthUUEU9UsTUBUF]+]Ku0E9Es(UtE9EsUBUE+E =~](Ѝe[^_ÍvUWVS EE}uEEE9E 9F%t =t8vD;;Esk3;E scEDEGSVW7cރV;u s;}y +E@E؃? Ћu;ur;u sEE +E9E|\( FX}y+uuEe[^_ÉUWVSEƋ} UUEE}t/UUEt&UU:t EU:uUUETt3uىƍvtq}tkuuuV$ƒx#G;EGG}t*E9Es+E=?E8Eu>D;;Es5CPVWat3|;V;}v!}t U![(+E e[^_ÍvUShPuu u\à t$uuPH ؋]U hPu3t uuuu P‰ÐUVSu] 9s-@t%сt t)v9s@u9vZ( @琉[^ÐUE":w$h=vÐUE!]UUBуwJ ÐUWVS EEU9EEU:}7G%t =tfxUBU9t-UBU PuG$g9uTNuՋE8u=?uE+E \U:u(2? Ћ} X(*v7GZEE9E0Xe[^_UEM UttRQ"RQgX/ÉUWVS uEE}EFtovShT>Ϋƒt1B-T>=wM}u0EE}~ 3.u,}t&}t GEFu}~ UE e[^_ÍvUWVS:u F>:uEFSE_>h_>ϪuSEp>hp>質t +E E:uRuȃ}u}#UԉUsEԃM9UԈB BUEA.]ԃE9uu]EvF}t)EԃM9UԈB BUԃ}t/u+uл9M)ى)ڋ}Њ::C9~EEԺM9Mu+"E؋} E܉GEGEG vЍe[^_ÐUWVT^>fjhT^EPjA1T^e^_ÐUEPutUÍvUWVS,]EUjEPS> T8"9]EЉt؋]t.u}EC?8v RhA v4D4%@]}t}}t$}tJw`}wWElwG}w>}w5UE Bw}w}w }v1EU ЋU ƃ} tU e[^_USE4< Sx( B+ ; };| ;B~A; |[ÐUVSu];s~s~Vu 3sY3)se[^ÍvU EPu uÐUWVSl ]u tSh>j#كpnRu lDž jjhjPc)ǃ  P0 ShFWh-PP Ph>W@-d t# WG5+=huZhtW5h,dt7T Ph>W,=htWjjhs+hV@ jjhjP4(à u WYt^v<%u@~muFS$>+-<%u~%uFSj%+Sj% SP+FuSj+$XƅuVW荩<$}X+d tK+DžDžjPjx[=l^ujdP5hjSV5`+jSV5`+ysdtjjjh>SǃxPj>VI@))ÉDž=Dž jPWZ<$Rve[^_U=`t 5`sR`h^ÉUVSp=`u?jjjN`jjPO=`v=h^EjEjhh>u]Se- jjV5`pNh^uSjhh>S/- jjV5`:Nh^u 5`sQ`e[^ÐUEUthE dtuldtl^ÍvU5`P`hh^ÍvUUptpÐUWVS ]u EFt7эyCt:UuWVSuK؍e[^_ÐUWVSL]EMyپ ̐KȺ:EUEu؃}yK-uh>u + uSu ,e[^_USEU ]~;M|SRPY S4@LRk+9ރ"]ÐUS]~;M} @L!+Lj$h^S^]ÐUWVSuSFǃt SVWRe[^_ÐUWVS}uFӁv Ra8%@v4@#L4ȅuȀ-u E E+uFtu0u>xt>Xu ^u 0|?EEG"щEC< wC<w7 C<wHW9}>}xU9Uw 9Uu9~ EvEEljEEF뙃}yEJ"}u pJ }t]} tE}tFU Ee[^_ÐSD$L$ T$@AJt}tm8ui@AJtnt^8uZ@AJt_tO8uK@AJtPt@8u<@AJtAt18u-@AJt2t"8u@AJt#t8u@AJtt8t )[1[US];H A~[UWVS^; ^}.CELPpLA;M|߹;K}6CE LPpLA;M|׃[^_ÍvUWVS#ut4pFt'>:u~/t>/tj.VItu?>:uF>/؅Džd?dd҉к=qdxW3huWF4VW<4j.V艛txtjVIjVJÃEPSExE%f=t SJ^hhPSJlj$J| Px`$d\ $PU  $=U B $)U B $U B d:2zzz~zrqz gz 2]`;BtJ\U ;Jt4+dhE p@@M Q `\9JE ;x}_ d+U DdG;z|ۿ;z}0dU :Ad:;BG;z|пM ;yU XƁL dXLddFBd~wFBd~x M ;A ~ RGE ;xxU ;z } R dM 9LdG9|E Ƅ8L;8}XU TցL dTLddFdGE ;8|U ;zM L`u B dB Adz GE ;x|;x}EM L\u BdBAdzGE ;x|Ѝe[^_ÉUMt<ƒ0 v1,t,-t'+t"Atƒ0 v,t -t+uߐUVS]ut= 0 w+vTP9C 0 v;U| E ؉[^US] hjEPutsU)9:uVAj;jEPQKt;E@9:u&AjƒtqB<.uej0 whmj >CPRƒt%8/uBCPR1ƒ C щȋ]UWVSMEE u)dE әuE әuEut\ ttgEP)}Uz;uǀQj]S)<IϻuF H9}6EE4J3@?)C9|ދEX ؉љZu~ M IM Q)ƍ)[\gfffEUUؙE)ЍȅyÉyFÍ6)CؙӅyMA)yu;^}(EEV 8CCE؉LǃPFTE؉`ǃdǃhSU}EEuEPuuuEPuu 9~ UE@:U@EU:}GUG}Eu'dEיuEיu?)EE}0?} L؉|AL؉xbDž|;{};PtG;{|Džx;{};PuG;{|;{}y; P;\u*tXu E+x E+|DLڃPtx|G;{|E؉LǃPǃTE؉`ǃdFh7vECCE؉LǃPǃTFC }t UDC { v BLVuWG}tuuWE8Ѝe[^_ÉUS ]Sh ?+tjSh ?]U=x5h^jt h^ ÉU=t h2=t hN2ÐUWS h?>=Ãu Xv=~Ph9ItSh$;u<^^ ffh ?h z$>h^St,;:tjh^St h^Fe[_ÍvU=t h0=t h0ÐUWVS }EE^=^t;^}-Pt@B;V| 3vPt#;V}E;D|B;V|LWV3EP)SW CLG(e[^_ÍvUS] =t h/Sju=t h/؋]ÍvUVSu= hv/=y2h h.y h/ h{/55.Ãu, j,1Ãt^S5=1 h. SjV"$/hjVe[^ÍvUVSu ]=t hs.=u h}=t h.Sh}Vu5t C(C(e[^ÉUVSu= h-=y.h h-y h.v h-5,Ãu, j,~/Ãt9S5/SjVhjVe[^US] Sju؋]U hu ufÍvUWVS}EJE׍L;L;LuzEu~ F;H~E}tP~LD@9Lu;H@9Pu*EJ~"D@9LuH@9Pt֋^J]U Qȉ֙EE )y M€QxQ~QEQЙ]C<ЙCUEљSyBCEmEәMM}yIME+E<<t AJt9u)։)uэD#;tvtAJC;u)0[^_UEfEfEEEEExEDžxDž|EEEEPu EP yUÐUVS] =t SjC8xu@MڋCHCy ;C| t RQ&vƃ=t Se[^UVSu] CCfS Ѓft{u!%fu SZuxC8xu@+S;S| S{uAKB;StfC ft u S?uvЍe[^ÐUE@(@,48ÉUMU} ut 4@0 tAÉUME U}t*tvtt@ tÐU=<LPPPTP XP\P`PdPhP iP$jP(kP,lP0mP4nP8oP<pP@qPDrPHsPLt@Pu<=@t(@PD@H@@ÐUShxjjh5huà t @u*x8u p@x 5؋]ÍvU=txp@ÐU j juNuUShjjh5huà t < 55w5a5ĞKĞ5Ȟ5Ȟ5̞̞5О О5ԞԞ5؞؞=ܞu Ğܞ 5ܞܞ=u ̞ 5=u Ȟ 5S=u О 5%=u Ԟ 5=u ؞ 5؋]ÐU=t@ÐUWVSu8tu8u E &}t*uuuU v}щ|5ShuS@uS4huS&uSjSƃPV"x wjO| Pǃu< fuP|9 PSV13 y u:S)U9|#M9|O V}t uYDžt9t}2߉э tE At9|֋tM9}tU @tM9|E 9 W Vve[^_UVSEu 9sj P5j@C9r؍e[^UVSu>>9;9-uy1uCAv=wtG0A=wvt ATBЈu9u ACA9e[^UWVS}uFӁv RE%@v4@#L4ȅuȀ-u E E+uFtu0u>xt>Xu ^u 0|?EEG"}щEC< wC<w7 C<wHW9}>}xU9Uw 9Uu9~ EvEEljEEF뙃}y}EP"}u = }t]} tE}tFU Ee[^_ÐL$T$QtLBAtBBAt8BAt.BAt$BAtBAtBAuXW|$T$ W1OtLBAtBBAt8BAt.BAt$BAtBAtBAuX_ÐUS]44 Jx>+A 0v;};|;Yy uًAv@;|[UWVS\EuEu}EEE} EEEE EE9EE EEEԋ}Z}u+U B+EM}N~ΉCAN+};}vW+EPUUUM9MqE EEE} }E HEE} (u u}Љtqdht#hPdP tdh ddxuE tC<u V PƃxJ+B B-|F PZF tHFe B u rB RB2[ / 8Ѝe[^_ÐU=u=EE@EjjURhjP tÐUWVS u=t F POvVl>Fv f4$=t ^ SV$ V2<$ e[^_ÐUWVS<}w(H} 9EEuEuE E EP~Eȃ}EEă uuu uPE EEȉEEE EȃU9kEĉẼEUȉU֋E9EE}+EEĉEЉEU9UtEEE+EEĉE;}J9EuWU,EEԉ}؋UЉUE*E_]v}ԋEE؋ỦUE}u8 E}tËEE؋U9U uuU;EEE]];]r)]+];]vSuU;Em]3vSuU;E]܋U9Uu_EV]e뜋EE9EvtE+EغuE]SuU;E]]؋EE9Ev5E9Ev+}]]SuU;E]]؋U9UwՋE܉E؋UU9}uU}t.UUE9r鐋mtqUBUFE9r퐊GFMtN}t);}rUUmtGF;}rUBUFMu;}sE9EDU9Us<}tUUE9sHvUBUFE9s0v;}s&}t;}svGF;}rE̋UEU9UuċEȉEĉuȋE EEU9E9EuE EPuu/UĉUȃ ue[^_UWVSEE}w+uuuuU EEE MuuQ])]]S]+EM TEEȉMuU2PVUE;urM<1;}s)U:PWU;Eu };}r׃FUM1+EE E}~E0FBIu+uu9뺉}U<2;}saW+]SU;Ett$ 6)CKC =?~tFC4~t F ~tFE~t-~t~t %vFCuSH!‰Ѝe[^_UWVS]E H{4@}P(ADDDHK C$jP AQS' uP~{0{(D6C,K@C<{@ P(;C~CPS} ‰Ѝe[^_ÐUWVSu4jV-t8tc 0t0 J4uЃ b Vt ub8;}(v8t 8C;|ۃt X Vt8ve[^_ÍvUSU} t?vtLZ4t;jjS,u S*t vǃ0v]ÉUWVS]4aCj hA C@WS jjjV !Ѓt8hWVYt!=t!O,>8t$ jjsP8S赾 uF~̸e[^_ÍvUSEX}t\ǃ,uu jS]ÐUSUEXttǃ,uǃ,vuu @PSm]USEX}vǃ, uǃ,vju jS]ÉUWVS,Ex URUM Mjj RQPUPu&E uurEEHUR MԃUػ9Hvuf~vJ)9Eu)EE܋My׋E9u܉8FExE؃Ufzu>juPu%EH1uԃMػEx Ufz uuSuuqà u\MMEPuffjuPu1%E\pEԃuػUz Ma;v;]} w1} r+uuuujE` vUb+} t} r)} t} Mauvuf|^w juSuu oUDZMAuZMTY)ЉFqSuu菰uuuuu蛶tCuf3SuuXu,E`Ub MaЍe[^_ÉUWVS UEXt$ttǃ,$xuǃ$ǃ(ǃ  uc$;{(w7jjWS#ƒp pf>uGǃ(;{(vɉ$;{(~ǃ$G p(f|Fuuǃ $"f>f(f|Fw' juu RS   NBU NfvDNC )ЋM A DVAMVTV)ЉAf;>v&ǃ $ǃ(vlj(Ѝe[^_ÐUWVS uF(@F(E#F0EN};|c;~|0FPSPt~FjvȳtV F(@Pƒ;F ~F DDDDV E;F,v F,F0 EF,uuV-‰Ѝe[^_ÐUWVS}u uÃt/V7PDE) PjR7؍e[^_ÍvUS ]uu #C,;C(~#C0]ÍvUWVS]} js跲tjKP蘲Eu]0 S>M049}&vKu B9|ݸe[^_US]M CCACAACACACACAC AC A C A CA CA CA C AC ACACACACACACACACACACACACACACACACAC#A C"A!C!A"C A#C'A$C&A%C%A&C$A'C+A(C*A)C)A*C(A+C/A,C.A-C-A.C,A/C3A0C2A1C1A2C0A3C7A4C6A5C5A6C4A7C;A8C:A9C9A:C8A;C?AA=C=A>CEA?A@EUBA@BAABABEAC]uvDDECDDCDECDFEDGfQfEFQEQB~L[^UWVSu,HH7Xt#X= TtT vDžT\uDž\H`u Dž`duW,dIDž\HDžLDžH,dDžTDž`DžXdtdD h$ÃǸǃdǃ\`ǃ j${ƉC Ǹ󫋅,9t ^FLCFWF H;F ;FRFFhD}tRE L t>t 4 uu ux#*E  jj EPE EjhPzhb1u ] hDDBhBiBjDkl@@BlBmBn@op<C t~]ÐUWVS EX{tjs3C}t+vEPu Sqƃta}uj63莡FvjPujjVS~ǃ !@tj63NCe[^_ÐUWVSlUE } u RӋEUBBCBCECCEUBCBCBCECCE܍U܊BCBC BC E܈C C E؍U؊BC BC BCE؈CfCfE֊E׈CEֈCfCfEԊEՈCEԈCCfEC f;u}ȉfDSfEҊEӈDSE҈DSDS E̊EψEΈAE͈AËAEȊGGAGAEȈAtAK;]r;Xt{} u}tR;]vMv;/u?EPu/E%f=@tLK;]w} t'hh uwU ,!}t'hu 8t%EPu;t9u-PhASt@8u0C̊Me[^_ÐUWVSjhPp jjhAÃxjttPS$guHDždGD\0VڈWdW*hFЊD2DD1\2dd~e[^_U= u*@vD@=~B  h@UWVS= u@EEU U @M܊\1F؈E}ME NъL2E܈L0\2G~[^_ÍvUWVS = u!@E@؊BA4ȊBBBBUB4ڊBBBB ЊUB4ڊBBBB ЊU@B4AڊBBBB Ѓ [^_ÐUM9s@9rÐUVSuM Itvۍ 1FIuغЃ[^ÉUSM] 9t"vAu9wi vt tu SsVЃЃj63蹃EE@u!CPEPSFPujSƋUBuuRSuB3Pu3v/u Ѝe[^ÉUWVS@}jE 07薄 EPEPWzT^0U;!FEąXjV7HEDj37fƃeS@H9jV7EG,9tuM}t`EDF\0f@jV7菃 jS7躁ƃfEM}ujV7Y ju7肁ƃ$,f[Cf]ȋUfP;U;U;jV7 EPEPWR 0U;aFESjV7舂E>j37覀ƃHf{jP7DEG,9tuM}tgEDF\0jV7 jS7ƃ@HfEȋUfPM}ujV7蚁 ju7ƃti,f[Kf]ȋUfP8U;jV75 jE07\U ЉЍe[^_ÉUWVS }EEPu WPÃu}P}u"j07贀}qE0CPVu Wp  tDFuVW9jV7;vESF9sSu WdiSF9uEfSBfCftISu Wcu5CPVu WtIf{uEfSBfCfuFu2VWTu;rvjV7WjV7C}AЍe[^_ÍvUWVS Vj3E0;}ƃf{DF0CtC PueRFu[>u#fFUffFF vVuVuQy MF0)RPPxEfFf\FVGftf9sMf HfuFf)fHtfJf9sMf fHufnjVE0}4vE,U9t{M 9u.jQE0w}MjVU2`}6u uuu uxt؍e[^_ÍvUWVS }UB( <u/B;u(B;EuuWu R*UDW8ފCt C PucCt$ PucCà G8)RPPvf_EftGWEHftf92sfHfuGf+EfHtfJf9sf fHufoUB( <uB;uB;EvfJЍe[^_ÐUWVS}u_cE  } u0tI0 EEtS0t,I0AoEEQ0t*I0 \EEH@tC0t%[0CEE t<0t!@0QEE90t!I0AEEy ƅ- y Dž-%ƅCu Džy Džt 'b0t"I0 QIEE HPE؉U܉M,P(P$PPEP#I 0t@0LEEHU؉M܃,P(P$PPQRz; $'u Dž$(tƅ-$uP :Nu"Dž E` Dž EƅDž E` Dž E ,+ gtGu{$~Z9$Lƅt$)ى+$y&Džu tOP$HPP\! C $~$u t \$~{DžDž$:t=9~,)ytA8uËL $;  u(um5tE0tI0 EEQt@0tI0AEED@t@0t@0EEf t@0tI0AEE0t@0EEm  t>0tI0 EEtT0t(I0@EE=0t'I0 \EEH@tC0t%[0CEE t>0t!@0SEE;0t!I0AEEQ0t+[0 EEDžLBƅ7xt 80tI0AEEDž !tzPm uX0t![0 CEE u Dž !x<j rt+ ; эY "t0@t>0tI0 EEtR0t(I0?EE<0t'I0 \EEH@tC0t%[0CEE t?0t!@0TEE0t$uH]U;U|EPEPRE9E~UUEU]^@vE;E|EPEPumU9U~EEEUBUBЃ C|BCBЃ v$}ME@teM M@MEte MpM gM[MOME9E;E|EPEPunU9U~EEEU`vMEt?E;E|EPEPu U9U~EEEUEEE tAE;E|EPEPuU9U~EEEUvEt?E;E|EPEPutU9U~EEEUfE;E|EPEPu5U9U~EEEU'EtAE;E|EPEPuU9U~EEEUvE;E|EPEPuU9U~EEEUEtAE;E|EPEPufU9U~EEEUXvEt?E;E|EPEPuU9U~EEEU Et?E;E|EPEPuU9U~EEEUE t?E;E|EPEPuU9U~EEEU ~Et?E;E|EPEPuDU9U~EEEU6E@t?E;E|EPEPuU9U~EEEUE t?E;E|EPEPuU9U~EEEUE;E|EPEPuuU9U~EEEUgE;E|EPEPu7U9U~EEEU)MEt?E;E|EPEPuU9U~EEEUE;E|EPEPuU9U~EEEUMEtAE;E|EPEPubU9U~EEEUTvEt?E;E|EPEPuU9U~EEEU Et?E;E|EPEPuU9U~EEEU E t;E;E|EPEPuU9U~EEEU }Et;E;E|EPEPuDU9U~EEEU9E;E|EPEPu U9U~EEEUBUf^}~ UR PnuUU;}}E<wm$DEEU E E PT?E0E E HPTLU EE E G;}~}tE9Et uue[^_UWVS E 8UEE@9E}Eu& u{tƃt'SPW/'uWWƃu~]͐;=8v j6uÃyGE 0j6EPlÃyU 2Lv9=E؃SPu~>uE UԍD]])oE 0Eԍe[^_ÐUS$]U u]EP58SR4P,}uUwVE)؋]ÐUWVS<}]E fEE 8uSEPEPEPu uSEPEPEPu u ƸEfVf)fVfTF0U yGEC0UBGECr2S=UZ w7S=] ;E y'uuSPl)jVU2Buuu u4EEċUUj3E0@ƃfC@fEUB tCw tiR]C؉E̋8 vUBЉEȋ8 ]tp@uf~uf}vY]CD؍M؋Q E؍UЋ]ȋB؃ EЃRQUE 9sEvFV)ЍW9sVu >uWEPEPEPVu-vWEPEPEPVu{ EuDFf9Es"U)PVBPR;fFE]C t]w tJUfFf)fFfDVEDF0WuS;UfFf)fFfDVEDF0EuUȋUUȊBCEuPEȃ PS:]ȊCs u f}tEDF0EPT u UċCUfFf)fFfDVEDF0u UCvf}tEDF0vEPTUBCUfFf)fFfDVEDF0UBCw}] ;u;E yuuSPEvuuu ujuċU2> ju]3s>E,U9tju]3-> ju3>XjuċE0> juU2=ju]3= ju3=s|e[^_ÍvUWVSEPu8ÃdM fCUffCu FCCF C ~u7EF9u$NfCUfE0U ukƃujSE0<\U FBFfFUffFU B F ztDjrE0:ǃu VkhGjWU2{<uuSVu uǃEVu 69u} Vtku U2Ee[^_ÐUWVS}EPW*7ƃtEPW7ÃufEEFCCFfCfFffCfFU B C F uuSVRWU2Ue[^_ÉUWVS u }UffFfF0G t G WCCfFfFfF0E@ t @ uUCfFF F jVE0:e[^_ÐUWVS } Uf fGfG8ECG t~UBƋ fGf)fGfG8C6F PS4Ftcv utoFEP‹ fGf)fGfG8QRS[4UCMrfGG G jWE09Ѝe[^_ÍvUWVSw tUvtRtfCEދU DBƋ vEދM DAƋ^ FE8EދU DBƻEދM DAƋEf9}wEƍDU9s UEH9uOhvf9}t.fE׋MfAf)fAfDQSVAP2fEƍDfEƋUf9r}t}tEGMf9MUfBDxfBUBt@t;B uB\jR6+4뺉fGjR64ojS62ƒt@tB u%BD\jR63믉BHfGve[^_ÍvUWVS,u}^CtEPu FPV;+j36v1 t tvCupf[Cf]A9YjQ62jS61fEzCtcE fCU fBdf[f]fuGYjQ6o2t@jS60t%AHfEfMȋE UfPe[^_ÍvUWVSuVu uÃ>E  e3{Ev;tjVU213{f{f{uMy;tjQE0v1jUrM1/Eu(;ujVE0;1UBfCfKSu u4M;tjQE00U2zsS A9uQMqjQM10tAjVE0.E}t fCUvSMQe[^_ÉUS]{t su_C CC(U SUfSC(]ÐUWVS E,UvjSM1.ǃSExfEGft]UU쐉ffuƋMfq uu QwuG EU~FfuKfuG U  u^f}u$tuu WREMQUG9u"tuu Wu~MQufEfMUfJ EPJfuftNMfpDG\8jW1{.Ѝe[^_ÐUVS]u jv3,Et[Ef@PuS!u*jV3.EUCS Eju3-Ѝe[^ÍvUVS]u jv3+EtgUE@HfBRuSu+jV3z-EUCS Eju3M-Ѝe[^ÐUWVS|EU EUUExy`UB%=u8E'}uBuju h F:ju h)F*EE@u!Uju hqR$c EPEPuu8EEt/EUE؉U܍U؋B% ?BEcE}2 ~@)EOE  )EкRP,$d$]؁m3E0FE 8F@FHFW $d$}fEδ fEmUmEuEE@tME}w#UGEEuJUEux Eu މuE}xEUUUM)MىME} !E}~ mE}wiE$FEEECE}E}}}$EUM|}GE W+"|E}EU؋]M~S؃GtɃ5`G]مt@GtB GuE:؋E؉Et5E GUut@GtB Gu]؃}t9EEu%}~#}EEM 4]BR$d$MPF]Ёm@}uBEEXFmUEE=E`}8 U4ոGe]п4}fEδ fE̍vEmUm΋UR$$d$]B0UBUEEEEG;}]]EЋU ոG]п}fEδ fEEmUm΋UR$$d$UE@u}B0UBU;}u>8 EEEWeEu/MU:0tlG4M]v؋|EE؋U܉EU]Mv}R}HUG}y<}6EE}] XFEXB}fEδ fẺEm]m΋UR $d$]B0MAMEـE@];}UEt.E@8, MU:9uv|9MtME89tUBUE|0G4M]EĉEuEE}t1}t }3 6+}}} j+E}~}~};}~})})})}}~Y}t?~.Vu,EuP+Ãu)]U)tRuu,E j=+E}~uP},E}~}t"}uEut EE}t MAtx*})}Gt )ǃ~ }}}}~uu-E}~uu,E}tOuu-y:Mjj u(E}tjj u(EEE}^}t}uR}x)jjuy(EPuR-؋U҉U ؋M1AME }-}~uu,EEEtV pV&EUB} փ ЃtfЃtju+Euu0Euur,ƃuu,Ãx uPuK,E vE S`&}u#}tEu}9~nEixup}tjEuaUzuz~B}~<ju*EuP+E uEt E}:tMEqv}~&}9uU9BUE@M4vEUBU;}jj uT&EM9Mujj Q9&EE%jj u!&E jj u&EGWvu]Eu0EExu x;}}jj u%EG뱃ju)EuP}* uIEt@MU:9u|9MtME89tUBU!E|1AMME80t@E u?$}t:}tU9Ut u$ u$؃ u#ME@U} tE |e[^_ÐUVS$uEHPEUMEUEÁ>@EEEEuuuowC$`FE;vE/vE#vEvE vXvuVuu EPEPShp >ue[^ÐVWt$ |$L$)9rу_^ʃON_^ÐUUuu PeKv36pM/F3C P6G vGC }CtA EPuEP Pu UU} u E!@tzC@U;Bv<:u PJC@PE0LtUUC@Bs PE0CUBUUCUB Ѝe[^_ÍvUS]EfxuzuB u uv@DBŠBtJ B EEt1 PPEPQS uEEPu ‰Ћ]ÍvUWVSu} O;NvNItv:t)‰BCIuF+G[^_ÐUWVS}E P;WvWE Jtv:tCAFJuGU ;Bs@[^_ÐUWVS} ]ujWEP> jGPEP,UE;Es2;u RpH u3+u{EEU;vjuE0^ƃtŋ];]v]SFPW jVU2E)؉Et ߋFE룸e[^_ÉUWVSE UMEUxEPuÃECCC fCfCu9vVuCP}tMAjQE0 U)tMM]_jSE0e[^_ÍvUVSu] jSEP^ jSEPL ju6ƒt^B tjR6DBERVL9]v"ju6ƒt )]Ƹe[^ÐUWVS ]u 9} v@9| PǍF w9v)J<u!uGE-J<tBG t:)à Ee[^_ÍvUWVS|] EEЃϋMǃ$FE ju$h FU ju$h)FuEPM MQuE]ĉ$6EtPuPE])EExu, PXU ju$hqRYEPu!]EHEUB% ?B0FE 8F@FHFMuyށ5~FV $d$}fEִ fEmUmEuEE@tMEEHE}w#UGEEuJUEE+uNx Eu މuE}xEUUUM)MىME} !E}~ mE}E$FEEFMm]m֋EЃEEJE}EUUUU(EUMDEEHE}E uj x|UJ IMtyEt +EE}}}EEEE}t= GUt#@GtB @u]E؃}t9EEu%}~#}$MMM 4]BR$d$MPF]؁m@}uFEEXFmUEEE} 8 U4ոGe]E4}fEִ fEEm]m֋UR $d$]B0|A|EEEeEEIEU9U]E]E؋M ͸G]E}fEִ fEEm]m֋UЅtR $d$]؍B0|B|M9Mul 8 EEEeEua||:0tB|EE@@ vE4M]<؋x|]EMM}EG}y>}8EE} XFEvE}fEִ fEEm]m֋UR $d$]B0|A|EE@;M9M}t#E}KEx0tEUEt(E@uktc E ||:9ux9|t||89tዕ|B|EtE4M]M̉M}EE}tp}$E+E)@EE;P};؋U+B@E-uN9|) )uuȿMMy )MEEEE jIE}~}~EU9~ЉE)E)E)E}~Y}t?~.Wu[EuPÃu]u)tVuuE jE}~uPE}}uMA@9E~ EE}t UBtM)E@Et +EE}~m }EEEEE}~uuE}~uuoE}tNuuAy9Mjj u@E}tjj u%EEE}o}~i}x)jjuEPu؋U҉UEE |1A|Ec}5}~uuEEEtV pEUB} փ ЃtfЃtju"EEuu0Euuƃuu&Ãx uPu SuW}uQMuI}uC}9}ExxtE EE U|vx(}E}Uz zE}ZM|@|jj uU9UuEEjj uEuPEE0uuEE }:u\q~@jutEuPQ uEt E}:t4E MyytEE2~@}t:}9u|9A|=E E@|B|M|@|U9Ujj uEM9Mujj QEE$jj uE jj usEEMEu||u*0EE9E}jj u EE빃}t}Uz6z.juEuP u_EtVE ||99ux9|t||:9tው|WSø )؋U  A )؉E܉M ?E;uvFSU؉M )\;uv EE tH )ڋ} ?E;uv~E )ڈ ЉE ?E}}Ee[^_ÐUWVS(EU EUjƍxUB%EB%BtMEEtK EPwƒt )E EmEEG@F& EP,‹EF tM5)ЋU(U t{)ËMe[^_ÍvUMU Bt ABuÐUWVS,u}EEЍEЋ] މX]EE=t Wx G8xu@EPW8t+uu ƃ=t W e[^_ÐUWVSE x"MfQ Ѓftyu'%fu upu E{UfB ftYu M{tvPuuCƃE)NjU B)Bn먋MfA EEfGvu3u{tUfB %Bf=BuK9zsFJ)ȉEBErPQUBEMqfA %ft*9s~VuE0*U)r2yM;Av+9v'VuP)E0$FnDUr9rVuRƃHWuM1)E)x8u)U B)B uE M{t}u+Wj u1t +E@EwuEU9vMAq;Av'9~#VuP(E0$Su@Mq9|VuQƃ~]փRuE0(U)r2)uu uu&Eu)M A)A ufN @Ѝe[^_ÐUVSuu VÃut Vv؍e[^ÐW|$D$ L$uG_Ð1_ÐUS]=uLfS ЃfuXЃffC ft4{0tC@9C0t s0.C0fc CCfK {u SGfC ftCC؉CvfC fuSSЋ]ÐUVS]fC fu-EPEPStƃuGufK vCCCC?v΀CEC}t CP tf s e[^ÐUWVSl]u }f{xEPCPRy vE%f= }u *EȉCLE%f=u{(u e[^_ÐUWVS][P)E}tPUC‹MYQKx)׹B8ǹXKy׋Ee[^_UVS=u=t h_)t^FHxf{ tjXHy6u=t h) j ƃ=t h(05^fC =t h(CCCCCfCC0C4CDCHC8@؍e[^ÉUSH)+~m=t+C~[;u~R P Ãt@=t h'=t h']ÍvUh ÉU=t h'=u6vA xA~=t h@'ÐUVS]u hx V=t S^fC u  Skƃ=t Se[^UEu hx (f@ u'  PÉUWVS }W tZwtN)7uG fO @(G~SVW1~)ƅe[^_ÐUVSu=t V2 VZÃ=t V؍e[^ÐUVS]ƋC89pu@ " C8PC8pC8@ e[^ÍvUuUWVS ]ƿC89pu@ 0v C8PyuC8pC8@ e[^_ÐUS]ES89Bu1z ~J &C8@ C8@ C8P3]ÐUWVS]} E9}}3+uvECMDC ‹EfC@E9|ڋUSMfS[^_ÉUWVSEE]u UM u1 EE}Mq9w#r9s}tEpE؉EEȉEEE]ufEEfEڋEfE܋EfEދ]f]UMEfEʋEfE̋EfE΋EfEEf}M}UrMAfxA ‰кA ‰кA ‰к}t E@x ‰U ‰UEUfzT+EEMfyuME]f{t]ӃxEfXKy+EUBUEMqw Ev}~/uEEPua uEHPEPJE]f[f]Ef@fEU]f SfDSftSf;Mu 0 ]ȺӉMȉ 9v&OEÁwElj 9wܾ]~>E EHEXt))֋Uf4J)K‹]UZ)fZtLO]~5MUBpU Zp֋Mf4AK͋]Ef4XUMf5$US]=t SShtI5Y$]ÍvUVS jÁE 49rN Vmu9 +ıPȱ5;бr RtډЍe[^ÍvUWVSE бEjjjhj PjE }t^5̱б}ЃtfЃt б̱U̱uP e[^_ÍvUWVS\u8 j?EPhI tD.]"u hIzà v@;7<>$xH% -  znbVJ>2&5 hJ5Ct ;GPu: t U u =t&EEEj EP=t =t jjjhjhjḆ u hI j ıб=u % j e[^_ÍvUWVS Eu Աt<9qr/9quy9tABQMy7A)q u u VnǃtU +ı̱9s̱A9r=t PhW+}t!= u E  u,e[^_ÍvUWVS EwEHt Eu̱U<u R&̱] 9r7;̱r"w S Sƃ=ttSjV e[^ÐUWVS }=t +ı w hJv;ȱv hKv̱4>u_t hI>u>t=9] 9E >v{@Ht hIn%EC mUM#Dt hI2X=u-9] s(9E wu] h JG u ƃt1} tt;] sSu WV6  WЍe[^_ÍvUMtw=u h@K4=u[ +ı w hJ;ȱv hK#)̱w PRQX PRQ#ÉUVS]=t h J=tG h.J =t h_Xv=u=t t Sƃ=tE]uj EP1 =t h=tu" hu / e[^ÍvUS]=t hl>J=t< h.Jo =t h$X`t S=t"]EEj EP  =t h ]ÍvUWVS,]} E=t h JJ=tD h.J =t h8 Xt=u# h@K2=uH!Ã=tu( S{u Sg+u W# WSƃEԃ=t]؉}܉uj EP  =t hC =t}t! h}t  e[^_ÉUWVShyE}OMEU]9~+ u(Ãu u@MfC}f{ MfC fC}{vD )Ѓw9}vу |B9|;[uM}~BM}fs у!LNfKE)EB}fs E +ı̱̱U̱e[^_ÐUWVS M EEu hYJ'vt h JEt hIv_ẕ̱ƒ|u C ̱<t =tVhu[= tjVu }= u j"  UP x p=Աu*  @Ա Ա}ԱE9C s;tU9S s;u9{v' S P C BxE9C uA0C KK;;BuwUB C ȋUBCtdXV9{u sECD;u,  X    hoJVv;C;v|C ;uq jg9u\SS C RC C + ıAȱ˃9w̱C;ȱvv}t uge[^_UWVS }uN FHt hI!ك#Dt hI=tFPhWك DfF V ̱f~ u9:t,8t#@;Fsʃ9t 9t @;Fr萋2PfF f;FuF92t92uF +ı̱^9t V9 S-e[^_UWVS EE=\uw+\Ej];t;=tvC;t;=u+]]=\t8v]ut9tCA8uNt 9uuA<=tu˸ [^_ÉUWVS}=\uw+\E h];t;=t C;t;=u+]]=\t8v]ut9tCA8uNt 9uuA<=tu˸[^_ÐUVS =t u؍]SNjS jSjj$EE$  jVj~jS jSjzj$$eWS|$ D$L$W~$ĉ Љڃ)ӉكX[_VW|$ t$L$)9rу_^ʃON_^ÐD$9v D$̀rD$Uu ujuuuu ujhÐU uuu jujhÐUS]U BvJ ]ÐUS]U BvJ!]ÐUU@~UU@~USU Bv  JU#]ÐUpÐv̀rÐvT̀rÐUVS85tv^Kx TKy6u=t uL$tD$̀r  P&YUWS E]؅t+8t&E؉IMEsE] 5@EIKC U؉)@PRje[_ÍvUUKx;4}  LÐUÍvUhVÐUhVÐUVÉUE t uЃÉUhVÐUhVxÐUhV`ÐUhVHÐUÐUÉUÍvUÍvUÐGvk̀rÐ3vj̀rÐvÒrÐ vF̀rÐv̀rÐv̀rÐv̀rÐv̀rÐv̀rÐvỳrÐvx̀rÐkvỲrÐWvK̀rÐCv+̀rÐ/v̀rÐv̀rÐv̀rÐUWVS ]SCv:tuv9rC;C|N C@PnEC} s ЃtfЃt$]CD@C؍e[^_UEP@:t v9rUVSu U 9su$9rt [^ÍvUVSEu ^9X} P-$etCXP 9s9rt )je[^ÉUWVS] EEEPEPu u7ƋE8)}EEE} }ugG5u}8Uz tJ*vt=t1]Kx2u} FكDtEEE}uVEtEuVŹ}trE V`ƃtM)ى˃ Ft9t9}u FEjViE}yEPV[ƃUM;QA)ӉE9ytEFE$PSU܅~}u RVE}u }UM܃#DE ESV贸M$}t VME`C}t=EP4EU;B~)B@EM$4"EFUEVWuUE$ E V@E؍e[^_ÐUEU EUEEt EPd5E E EPE)‰ÉUWVSEEDž|DžpEEEEEEUUE-w1$M`GA2% ?AE]؍MQ%0?QE@Gt EM ]E݅ۉكt E4G]~=MGA2% ?AE]؍MQ%0?QE~"GEtU E]EPEPuu;EuԋE+EE~PuqMM؋EEԃEEԉu+uU;r~-E@Eܣ "MA@U EԋMU)щtMIM9E)ȉE~PuEEE}UU؃}}}(E@E@MEEPm EE@@OE@E@EUMDEE!E EPuUtUԃlt F9OPWuhDDq7HDBH փ ЃtfЃtEpLEPL p ЃtfЃtE+EE]]$詷@}x}}UډEx)߉uM+MAME +M;M}+EEu}9~;M~M~)))M~=R@k@LPÃL薴L+u~VL[LvyPL-}~uHH~WHH}~u@@EE HL<x x;urMAU +BM M9s?E‹M<%ƒE%EfVf>;urÃ}tvUB;BuY B@PE MA} ΃ ЃtfЃtu>E EUBD@BEe[^_UWS]PS uSh Xjr;vBщjuuu RSe[_ÐUWVS$] j(j`ƃuh`Xj5vhtj1uh`Xv@@$ǀhǀlǀp@(@,h3sP$ڳ׈уHAQjqU׈эAB QjAA9t8t4}tqUQj B$uhXUуQRp$B+}t}pA @B@PR1tG @ Puw[EG}u( FP y#hXj̓PMQFVF tF ~$jVtLJpt Vs8t 0Nzt r4y$t q$ht hlt l e[^_ÐUÍvUWVSD}u _$C4ECLEjCXP;CXC(CXC\C,C\=?B~v-@BCX=?BC\CXE؋C\E܃{4uFCECHEE@E PjjEPGPU jjEPGP~h@Yj`E؋U܉CLSP{4uECDECT C0CHCT{4u[FjVPƒt؆BGẼVEPVR]ȃFURVPvuV FjVPƒt؆B=G EăVEPVRt4]FURVPtuVЉЍe[^_UWVS,uE ^$x @UЃMЋQ@EjjQFP~ hYj>EІ@E؋EԆE܍sX}ع8thYjEC0C4ve[^_UWVS }_$s4{tD hPlPs$pC(P uChZj4GWC`SdUChBщMC`PRsjyh@Zj~C`SdFV Fe[^_UVSu^$ 3s{$t s$ht hrlt lX SL4$De[^ÐU=t h=u2,;4;= P>$$?=t hÐUS]ujjSjPS]ÍvUWVS ]u EPuU]߲֋=<эL w Su 5<h~ZuЍe[^_ÐUWVS<uu% P:} uhSZ] ҋ} щ=<ȋ)L w Vu 5<hZu,Ѝe[^_ÐUS] tZhPuPt<j:hP"tj0hPS躭C0Ћ]ÐUWVSDhhZ[ ~hP.\t8#tԀ8+ Ph"uDžPPUIQRhZ. ku ιhPtuPhZhZ9hZV>Ãt 8tu$PhZhZ5TuSu e[^_ÐUUE =@tPR@ PRjUS@U ]UEE؊CEيCEڊCEۊCE܊CE݊CEފCEߍEPuuRu_U؈UوSUڈSUۈSU܈SU݈SUވSU߈S]ÍvUDE EEURuuPuUWVS M} u]Uu vq؃BABABABABABABAB=DtRVWD RVWt ЉЍe[^_ÐUVSu] SVfttt tGbhCPVhtGjCPVft,jCjCPVfЍe[^ÉUVSu] jSViftjCPVNfЉЍe[^ÐUHÐUVS0u U؍EPEPEPEPEPRh[uƒ ~I^D؍ B~^EE֍U֊EBFjFPRMwe[^ÐUWVS };u }4 v4ttsF;u |΍e[^_ÉUWVS<E} u+vu$ u e)@Bƒ8;} 0?sPh[hP9$|U$ |UD$ut|UDFGP<t;}|Bƒ8;} 0rPh[hP${U$ {UD${UDFGP<t;}|E UzEBB BBUЍe[^_ÐUWVS,E UDžDžDžDžDžDžDžMAM93tu6 j PPRu^ Džp@9}gt uYh[tIu߃hu[tIuC;}ttv~&RDž%~ DžU:tvM $P PPPh#[膖$ h0[hS:DžDžDžDžPSu-jjPjhP\ƃ u/vtPDžDž Dž@ RhjhpjV uDžt FVP$P PPPh#[$ hB[]SӣWSjjDžDžjWjjP ( Hu ( Pjj(PW$Oà y 8t2DžPPjjP zhFj:H$ jPw=HjPuyDžH |3DžtU| DžjPyt  t FVP jtjtrE8u cuU= ~@;v+ +‹;sڋMAtP!ȍe[^_ÐU=(u4(=v ((ÐU,UEEEEEEPRjx }tEUUWS=LuphP<x]װI~= ׉Q褺Lt P5LӫvLЍe[_ÉUS]Ut]ÐUWVS}j j謎ƃtaEPWF?u uu1@ uuu@FFj`jKÃu h[@$pP@T@XCDCHCL S fC;DžT TPXPWy h \]XC0C,Pj訍C4u h`\0XXPRs4C8$( vat VЍe[^_ÐUWVS}uh\hh\hS[;.uu WmƃPDžddPhPWzy h\hF0F,hPj蕌F4tthhPSv4}Džd dPSWy h]hF+CPDžPhP3覼ƃyM診8t螺8t蔺8` jjPm 눃r2PÃjfC@FhPs@LCFe[^ÐUÉUVS=t h蹠5u =t hF=t hƠ^dFdCjSPu See[^ÍvUVS=t h!u =t hNV=t h.sdCdFjVPu V}8t FVPЍe[^ÐUS=t hwu"=t h褟(=t h肟uCdPU ]ÐUS=t hu"=t h,/=t h CdCduPU ]ÉUÍvUÉUS]=t hh=huFhhlhpjthixj|kkChC =t hB]ÐUWVSEut)ǃ+ h_H6uu h `Hs=t h 肝tU6p(荥u.Vuu _*4$uuu 3P tE [uurvVuu uƃtW jÃu1 h`G=t h O0CE=t h  W(ƃ WA*Ee[^_ÉUWVS }uuWu h``@G^ jjjVj_à tGVWu ()4$uWu S u!6Wu h`FC$P؍e[^_ÉUWVS]uDžDDžPuU} u h`a u +ÃuE 0h a<EPu *DžP*EPS)u h`a+FPu S0ucjStyEX ׉E؈YE䈅XuRSy hah,uvSɡy hav S耡EttL^DžTTPXPSIuuuS{9uuS(uuSv h bDfDDtR u/DB\} t- } 7 UDB(wTDG$DKPt SDt(Pu D DBRPe[^_ÐUWVSu ]EPu'u hb5Vuu=!ƃ Suu,!Ãtuhbh`bCpj`j@oPPhj oǃ9sPjnPBPj7PGPLJEPyTG AH $PB8DžT TPXSuxIhjWnPA4A,TQ0 RSP?PPFhbh`b{BPt#t W誚 P虚e[^_ÍvUÉUWVSu~TGXDžddPhPj7vP6Sà u @8túF<;ds1t v@dj,mF@dF<hdPv@iu!V@FBFBFB FF XBjRPu X;t`U GtJ`P\PRVt.dhPj`\6UЍe[^_ÐUWVS] ExTwEGFjVPGSV9.tN FVPÃEpE C Pj~iCuh=hchb=qv{U ЃtfЃtE PjiCuPhchchbe=s袕$蚕=t h葒[v{U ЃtfЃtE=t h4e[^_UWVS }GTE=t h覑V FtSGTѺF:t9tP$x$t 9X$u:u hMc)C$Sgj(jgÃuh^ch?c<E0jgƒu!hch?c;$#E C GPCWPjM1RȃPUBFCFCFC G8CGK~A9t ~+V GB^ w|CF xwwp=t hi|=F5{t ߋ[{u 3V}sK}C p=}s 2}{t s}tGF5 5F S|=t hq{e[^_UWVSDž E=t hz}tE 0uǃ_ jjjhSu jf t8}t w@4U=H hz3CẼ szEЃu Essu$=t hVz}tO=t h_z EP4=t hz ua{EPu su}EEEEEEE x t]p  8uD/  jhyU jhhReP]v$PEPh ut$ $]؍vGEGE؉E܃jjjhSu j\ tC}tSu 9SEPE 0uw}tU vu$t $覄 e[^_ÐUWVShfhjjj}dƅiRejfjIAhEEj]jjj,PPjhEPdà t@jjSP dA=t hu=aDž\$Xh j)`X ޿8t޿ 8un`Bw] R xM Pt`\p 8uhevre XB$`9\u+;=t htU \2&Xr%=t hQtj55de[^_UWVS\]}EuRu@vƸWSEԃu FVPEhEEȋE E̋E|Ph.j ]S]؋V5`5\EPh4EPhd`jV$FVPu;vEe[^_UVSP]EYƸttEE؋E E܅t E vEPeEPe|Ph.j ]Sp]V5`5\EPh4EPhd`jV$FVPEe[^ÍvUWVS u ]tWsvRzu;s v =zu&F;Cu;t8tPV|ǃ[ue[^_ÍvUWVS +vdx tp  8t SK!dud S"xf jjjxttx}ƅyjhhRexzS.WIAx PVtxy tf{ tQ{e[^_UWVSDžpDžtDžlDžh}ttE}uE\Ep 8ifEEUru8uL hg"Ãu $EPSuLp$$EPuu*pppBhdjRP pPEPj pRUUE EUru8HEEpPEp0EPh`EPhPljp t@ Gf}uDžlQfEfEpPEPjpR$ plt uuplBuY4 pX PpSl lWqDžluulr{lBfUfPElB=ltkEp  8uNu:p e @EPSuplUUȋE EEPeUEЋBDžxpug hƃt?vEp s uc VÃu҃ Vp~.vDž|pP|Pj pR}uEPepBhdjRPpPEp0xPhHbEPhd`j p0ujuxlt3xPhHb pB]SjRPSxPhHby L@Džhv:u-cpZpt4UBw pBRPDžppu#EPuup}uEPepBhdjRPh|0upP|Pj pRpPEp0tPhԯEPhd`jpÃ0tt t8u<tultPhԯl|pBVjRPVl`v u'pPEPpR}wh v/||lt lzu2jpXPPpSpt pBRPDžpExt&pt pBRPDžp}t pEpt pBRP}t}Pet ulle[^_ÐUVSujjuuu uà t]C;v' sk$k?1ssvuCFsvk$nke[^ÉUVSEEjuu yƃP5`5\EPh`jhpjV w]VEPj VR}uDEVEPj VRV5`5\EPh`jhpjV0t&/^PVS FVPEe[^UWVSPu,}0Ejuu }ÃuAEE4@3E vj4$iU4BChHejSPEEȋEE̋EEЋE E؋EEEE(EE$EE}SEPj SRSWVEPh(dEPhbjSE0ub}4t\uuƃ@U4;PvrtsFU4Bv i4$ivEw M}P CSP}tEPhԯ0Ee[^_ÉUWVS ]t;u u ?K9 h ƃu uA V;u8u&jPSLǃtÍv VG5`5\u h|jhpjWÍ@ w[WEPj WR}uBEGURj WPG5`5\u h|jhpjWÃ0v GWPve[^_UVSu E}uvuB;øt0C5`5\URhԯVh|djSCSPEe[^ÐUVS}u @D} u-1øtoj j9ƃu CSPHC5`5\Vh|dU RhԯjS t V!f CSPe[^ÐUWVS u=P8 uO=IJ~^h?Vth?0u.Wh1hjjc VWh1h@kj|K;IJ}$vV4tC;IJ|߉5ȲhȲhse[^_ÍvUVSu "''~')tPRe Pctrp=tP5le Pfv6f=yy v6g|i;ul;r 6BgfrBB=7 ,6@gt0x( i;ugv=u h>b=gtcx[SfiuG;r *BgfrBS;Z-cv=6`f) C$Tj hdIJ̲ 0̲{ p1f:t̲ B̲L@!̲: . "    ?)‰2) fuau]BfBB B=yy =a?gt$x i9u g ?f;r u-BfrB B h#?`e[^_ÐUS]u\u@/  tjS …uvjS ‰Ћ]U Eu uhkhlh}hkEPp uUUEuu uhkhlh}hkEP) uUÐUWVuu uƃt}e^_ÐUS]S$$H]ÍvUM\ÐU=puhhxKp 5pEtÐU=pt%=tu 5pipÉUVS=pu*hhxpu @+5phhHÃu@vv8#tÃhZPEth^S-ƃtFhSj~ ShSj`Q  t$hh v> t> u F> t> t5h^VIƃtFFt@>t;> t,> t's3h^Vƃt Ft>u@e[^ÉUWVSUEzjI@9{u;u3t2s>tu6t>uvÅuED@e[^_ÍvUWVSEƒUU@Ej'vE9CuC0}M98t /ÅuED@e[^_ÐUSt^u u^]UWVS\uDžEPU } t'}  }v}Džl DžfFfFDž Dž ^ ;WN )PRSV  \;}t}uBщP‰EDžTDž`DžDžB;6 )PRSV  tC ; S$l}uu S5 S1;O؉t}t }! hRSV q WV;щ щ+9PFP}  hPSVi xZ R tD;щ+9~ GPEfvU9tO ™Pu趙$ jPuhlj%Z > t%  ^dtu )PRSV  L;u P/s Džщ~ q`v5PLt#5Ph@lj%;\tu(Pщ;r!h!mHr)uj#h4mWlPSy;t;hl#u~;s dt%~}uh0=PuU}щ)9iauRAP  tPPhP' @Pv@e[^_ÐUEtuX\vX\Puu uÍvUWVS UrEuxNu@@vttE.E @T/)5X\j.SZu SFGt=wڀ:z.h SVhSh 2!E!E P T ķ`  tEPEPhP@UPv=wu:.uB=wtj:Su ;:ڀ:z.h SVfThSh 1!E!P T ķ`@EP=wu ::t:.u B'v hLǃu@ hPujSCAƃ y WMVhMm=v WMVhm9uSPWU<$ME8t@e[^_UWVS<Eƒ@EuJulucsl Ɖ8t l Ɖ8u" DžDžt t P/v;tP@tt:PBPBPBPhemP/ rv;P;Ph~m/KyʃhhP/Tv hOJƃu@ hPj jP=à y]u9hhW.$Vj jW<à y VKShmvv" VJShm j PSV&Ãu VJ VJSs Vh  ķu,  t#h h hCC @}D@e[^_UWVSlEEEU 9}ndEE;Ms-] EА#`9htA9rfLu}u~ Du9}uFE;u |}tOE 9E}GMIx4fDMf;DM~&fDMfDMftM]DTIyEE 9E|l[^_ÍvUu tFt}t ÐU%oÐUS] jEPu@C@ ~CCjSEP]ÉUWVS E} xukx ue@@ X;tOvʃ)֋U)ȍV9} &P3K;ue[^_UWVSEEu.@ǃEP7J5jjuu;|$SFE}t SU CPFƃCFfCfFCF@PFPCP|9Er$(PuGtfE| UE4BU W;OÃB WD}t}tujuu7E UEG V}F}t MEU4`F}u uLF<$Ce[^_ÍvUE PEPJÐUWVSu]}t,uu u_MddtUoEFEEEFEEEF E SEPhjv Sjhjjjǃ Xt+t FFƃ  }u  d}HjjjdO!ЃupH8ufE Q  hdlN. @ uUvE t t  hPdsFE Ei G<G8G G GTG<G(jj3ƒtiH ȃuȃB jjR3Bt%t  ujStGcGXGt Wy}t dvJ*Ge[^_ÍvUSEX{tjs3C!tF]ÐUWVS uEX{tjs3EC w~$mvU 0tivC(ts$FleC(ts$NuTv  ujSv Fvt;v?  uVS…t;v kvjFPS= EtJK(s$ uu VuS ǃ !@tjE03UCЍe[^_ÐUWVS EX{tjs3C}u E 0uD;v%  tiVSuWNjVSJ ƃt< ujjVS ǃ !@tj63Cve[^_UWVSU;sXu >E"UUUE苂E싂EU 9E UoJǃtKu>tSUPVgIjEPuuSKu@FEtU 9UzE 9EsU Ѝe[^_ÐUWVSEEUUE 9U EIǃt;EuDUEU)ÉZujEPuunJuufE+‹u P<vE UtEÉCN'tEU 9UE 9EsU Ѝe[^_ÐUWVS U;sru #<E^Uu#E UUE苂E싚 ;} sl9sEst3vCAJ9s uvtRUPQFjEPWuHUG;} rEe[^_ÉUWVSE EE;} s_9rE U]9s;EtC9s;Eu+EEjEPWuGuCG;} rEЍe[^_ÐUVSuEX{tjs3M Ctt&XE tM;w$HPSbGC(t*u:C$HPS4u%K$3?u e[^ÐUWVS}ju Wt?@PSW8ƃtjS7n jS7[ Ѝe[^_UWVS } UDW8ފCt CPu>G8)RPPf_EftGWEHftf92sfHfuG8)ЃfHtfJf9sf fHufoUЍe[^_ÐUWVS }_{tjs3H CjW!t">p uA@t Et% N@H ƃ W?oH ‰Ѝe[^_UWVSf\Ff+Zr2Í0PGfFEf+X p0Í0PGfVf>f)ȃfDVf\Ve[^_UWVS E p>Uf|VwPu/}t UfDVUfB Uf+DVfEG9t}LFˋE XUEDFE)PSRM9Af|NuNfNfPfTNNfUfNfPfUfTNfP9~fUfTFf~fEfD~fD~GfEH8U Je[^_UWVSn?E؆E܆?EEJ9thQnhjnjdPpVffyh{nhjn& $)¡0T ?Bv%hnhjnӝtr)0J;Bu ;A")0;B}hnhjnTNjP);u; ;|&hnhjnD@EЋHE؋EjjEPViI~hnhjn臜E؋U܉EȉŰM Y(EȉẺEЉ}G@DWA(BHW+A(BL)؋0AQ Sf?G_zt rQQjBtqr`h[hjn`VWG w5ABWAQ G Ae[^_UW hjǣ0hj44fPB?~}U4@~ÉUVSU֡4fff9t4fXf XCf9u[^ÍvUWVS EE0EU9uqCM;Auf{t`U װыCE9ɋu8u6U;CuB;CM;C} <)8EE}?x@ [^_UWVS }EP?vhnhjnk)Ѝ40\0u#j&j[á0\0fCvf{ WEPEPEPUr uhnhjnfCXhnhjn˘EfU EfCUEfCUUJxOffDSJyAf{u 6U CUCUSJxvDSJye[^_UEtf@ÐUWVS$uSVhP PjU h)oP P8Uvh)oPHt PUC~͋E3vj.VcÃ)P5VCj@Scǃ)ށ~hSPƄ.$OGPUunPhrPJuF #t*@U A Uu1UvЍe[^_ÐUWVS YsvC 8tcvuC 4u=tNE9svM ;CuEB9r}u CU GFC <u跳Åu,e[^_ÉUWVS$uPVt10u(:uuPu j.VaÃ)P5VuuCj@Suaǃt[)ދEH9~ƃVSu hE $MuGP5ЉЍe[^_ÉUWVS4h5Hƃu'Dž֕Kv VtVhP諚tƀ8#tՀ8+ P`uDžPP}IQu5^ ku J(t VvhPuP5hZ=vhZWÃt 8tu%P5hZ5uZ {Su o4$We[^_UEPh uh j t}tÍvUW}MEPhLjhpj  t!}u}t} E}ÉUS@]EE؋E PE܉USEUEPhEPhj6 t}tE̋UЉSЋ]ÐUS@]EE؋E PE܉USEUEPhEPhj t}tE̋UЉSЋ]ÐUS0] EESEUEPhEPh<j\ t }t vE܋USЋ]ÐUS0] EESEUEPhEPh<j t }t vE܋USЋ]ÐUuhhjhpj HÉUEPh uhjv t}tÍvU$EPhuh j 2 t!}tUME HÐUS]t ;t PPR S]ÐUWVS<'Åt p=DuP=t hi=DuhhD=t h 5D9u[ j t5D8x 9Bt PPR89BtiA P PR$jjphO :u BRPPEPj 1RøDžPhun S"q  8u>xu&PuhPY(u] Sۭu8u.t%uhP' S$9t\-BA jjjqhM :u BRPsDžB@Rj1P PPj1Rtjje[^_UWVS ]u#=tu,$&u7=t.u$MPQ@A3u3=t*j$PMQbCv t t u j jbƒt*BWVuuuu SR e[^_ÐUu u˞ÉU j0u u轞U hu u誠ÐUVSu] SVtCPVЉЍe[^ÉUVSu] SVt3CPV蚟tC PV衑ЉЍe[^ÍvUVSu] SVt#;uCPVUtЍe[^ÍvUVSu] SV諘t?CPV蒘t&hjjCPC PV谀 АЍe[^ÍvUVSu] SV't#;uCPVatЍe[^ÍvUVSu] SVt3C0PVtC`PVЉЍe[^ÍvUVSu] SVwt#;uCPVmtЍe[^ÐUWVS,u EE]C}OEE1E܃jjEPVjS u 8 u U܉ Ev7E]C EHE؋UUE܃jjEPD7PjSL u 8 u U܉ EvEDE]CEHEԋUUWE܃jjEPU؍:D0PjS u '8 u U܉ EvEUDE]CEHEЋUUE܃jjEPU؍:EԍD0PjST u 8 u U܉ EvEEԋUD:EԍL0EHEt"‰ <w AJuUE]CEHE̋UUE܃jjEPU؍:EEЍD0PjS u8 u U܉E>EEEЋUDEe[^_ÐUWVS ..., where is one of: ăڃ(:benstuvstdoutstdin%6d usage: cat [-benstuv] [file ...] ggggggggg3gggCggggLgggggsgggggggggggggUs^ggggggsggssssnssϋϋϋϋȌϋϋȌϋHLPRXfghorstuvwxinvalid file mode: %s: 0%o [%s] -> 0%o [%s]fts_readfts_openthe -R and -h options may not be specified together.usage: chmod [-fhv] [-R [-H | -L | -P]] mode file ... ɎɎɎ.ɎɎɎ<ɎCɎɎɎɎɎɎɎɎɎɎɎɎɎɎɎɎɎɎɎOɎɎrɎɎɎɎɎɎɎɎɎӎHLPRfinprv%s: name too long%s is not a directorydirectory %s does not exist%s -> %s chmod: %s%s: directory causes a cycle%s not overwritten %s -> %s %3d%% (y/n [n]) overwrite %s? %ssymlink: %sunlink: %sreadlink: %smkfifo: %smknod: %schown: %schflags: %sutimes: %sthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s%s: name too long (not copied)%s is a directory (not copied).cannot overwrite directory %s with non-directory %s%s and %s are identical (not copied). cp [-R [-H | -L | -P]] [-f | -i | -n] [-pv] src1 ... srcN directoryusage: cp [-R [-H | -L | -P]] [-f | -i | -n] [-pv] src targetY@,,ɡ`,ZyOM@@e,|i,Ƣl,B,Ӣ r,*@@Q*@@e.B|- `)e^- `*- `+c-i-q-y- `&- `'- `(-- ->s--X____F___P_Z_________d'''''''''''''''''˧    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxconvibsifiseekoseekcbs cannot be zerorecord operations require cbsbs supersedes ibs and obsunknown operand %sno value specified for %scbs must be between 1 and %jdcount cannot be negativeibs must be between 1 and %jdobs must be between 1 and %jdlcasenoerrornotruncoldasciioldebcdicoldibmosyncsparseswabucaseunblockunknown conversion %s%s: illegal numeric value%s: short input recordtruncating %soutput bufferinput buffer%s: end of device%ju odd length swab %s %ju truncated %s iseek/skip%s: illegal offsetskip reached end of input%s: write failureoseek/seekcbs meaningless if not doing record operations%s: illegal argument combination or already setunable to allocate space for the argument "%s"seek offsets cannot be larger than %jdfiles must be between 1 and %jd%s: illegal conversion combinationfiles is not supported for non-tape devices%s: short write on character device%s: short write on tape device%s: seek error creating sparse file%ju+%ju records in %ju+%ju records out %ju bytes transferred in %.6f secs (%.0f bytes/sec) ư>?@׽׽׽׽׽׽׽׽׽;׽׽׽׽׽׽׽Q׽׽׽׽׽׽׽׽׽׽׽׽׽׽׽׽/Q׽׽׽׽ho׽Ƚ׽׽׽׽׽ufsabgHhiklmnPt:BLOCKSIZE=512BLOCKSIZE=1gBLOCKSIZE=1kBLOCKSIZE=1m/tmp/df.XXXXXXmkdtemp("%s") failedstrdup failedBKMGTPE %5.0f%c %5.1f%c 0B%-*s %*ld %*ld %*ld %5.0f%% %*ld %*ld %4.0f%% SizeAvailUsedFilesystem%-*s %-*s %*s %*s Capacityifree %*s %*s %%iused Mounted onvfs.conflistmalloc failedsysctl(vfs.conflist)-l and -t are mutually exclusive.only one -t option may be specifiedusage: df [-b | -H | -h | -k | -m | -P] [-ailn] [-t type] [file | filesystem ...] $@-n$FreeBSD: src/usr.bin/yacc/skeleton.c,v 1.37 2003/02/12 18:03:55 davidc Exp $B[aim3O (                      !"   (:%&)*+%-/*+-/:<=>:%&)*+-)/%&)*+-/<=>%&*)<=>/%&)*+-:/&|)+-<=>&)<=>&)+-|<=>&|)&|)<=>&)&)<=>|<=>|<=><=>|&)%&|*+-/|<=>:<=>||%&|*+|-/:<=>%*+-/||:<=> #1>T`lxmalloc() failed|&=<>+-*/%:()EXPR_COMPAT%jd usage: expr [-e] expression syntax errornon-numeric argumentdivision by zeroyacc stack overflow-l-s--illegal process id: %sillegal signal number: %s kill -l [exit_status]%s %s %s %s option requires an argument -- sunknown signal %s; valid signals: kill -signal_number pid ... kill -signal_name pid ...usage: kill [-s signal_name] pid ...<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<$<<<<$<<<<0<<Cfhinsv%s %c> %s replace %s? not replaced link file1 file2 ln [-fhinsv] file ... directoryusage: ln [-fhinsv] file1 file2@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. 66666666666666666?Xq666y6666666666666666(7F6Ud}6@Lquy}dCOLUMNSCLICOLORCLICOLOR_FORCEcolor support not compiled inLS_COLWIDTHSmallocMAC label for %s/%sfflagstostrtotal %lu %s %*u %-*s %-*s %*s%*jd %3d, 0x%08x %3d, %3d %-*s %*lu , %e %b %T %Y %b %e %T %Y %e %b %R %b %e %R %e %b %Y %b %e %Y -> ls: %s: %s %*.*f%c %*s 1ABCFGHLPRTWZabcdfghiklmnopqrstuwx %lu : %ld : %lu : %u : %u : %i : %jd : %lu : %lu usage: ls [-ABCFHLPRTWZabcdfghiklnoqrstu1] [file ...] m:pvusage: mkdir [-pv] [-m mode] directory ... finvrename %s to %scannot resolve %s: %scannot rename a mount pointoverride %s%s%s/%s for %s? %s%s: set times%s: set flags (was: 0%07o)%s: set mode (was: 0%03o)/bin/cp/bin/rm%s: waitpid-rf-PRpv-PRp%s: destination pathname too long%s: set owner/group (was: %lu/%lu)%s: owner/group changed; clearing suid/sgid (mode was 0%03o)%s: terminated with %d (non-zero) status%s: did not terminate normally mv [-f | -i | -n] [-v] source ... directoryusage: mv [-f | -i | -n] [-v] source target"EE EAfEEjdfiPRrvW%s: is a directoryremove %s? unlink fileoverride %s%s%s/%s %s%sfor %s? "." and ".." may not be removedusage: rm [-f | -i] [-dPRrvW] file ...usage: rmdir [-p] directory ... usage: sleep seconds @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. W#W#]"i"W#W#W#W#W#W#W#W#W#W#W#W#W#W#W#q"W#W#W#W#W#W#W#W#W#W#W#W#W#W#W#"W#W#"W#W#W#W#W#W#W#"H#W#W#W#."W#W#W#W#a#$#$K$$$SMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyCCDVinumDOC2KRaidjfsunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660vinumraidABb:em:nRrs:wi386pc98alphaia64/dev/Unsupported architecturefopen %s%s: unknown disk type/boot/bootread error %scannot open %sboot code %s is wrong sizewrite %swrite labelverbwrite bootcoderead mbroffset%s read%s: no valid label found# %s: disk: %.*s label: %.*s bytes/sector: %lu sectors/track: %lu tracks/cylinder: %lu sectors/cylinder: %lu cylinders: %lu sectors/unit: %lu rpm: %u interleave: %u trackskew: %u cylinderskew: %u drivedata: %u partitions: %c: %8lu %8lu %8.8s%20.20s # "raw" part, don't edit %5lu %5lu %5.5s %5lu %5lu %5d %5lu %5lu %5u %8d badsect ecc removeabletype: %u re-edit the label? [y]: can't reopen %s for readingcan't create %syou have too many processesEDITOR/usr/bin/vidrivedata%lu partitionsbytes/sectorsectors/tracksectors/cylindertracks/cylindersectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: %s: bad %s line %d: %s: bad sector size line %d: bad # of partitions line %d: %s: bad flag Warning, unknown disk typeline %d:%s %lu line %d: syntax error boot block size 0 revolutions/minute 0cylinders/unit 0 tracks/cylinder 0 sectors/track 0 sector size 0 (to edit label) (to read label)usage: bsdlabel diskwrite to disk label supressed - label was as follows:headswitch: %lu # milliseconds track-to-track seek: %ld # milliseconds # size offset fstype [fsize bsize bps/cpg] line %d: partition name out of range a-%c: %s line %d: %s: Unknown disklabel field line %d: %s: bad partition size line %d: too few numeric fields line %d: Warning, unknown file system type %s line %d: missing file system type line %d: %s: bad partition offset unknown size specifier '%c' (K/M/G are valid)Offset %ld for partition %c overlaps previous partition which ends at %lu Labels with any *'s for offset must be in ascending order by sector partitions %c and %c overlap! unused partition %c: size %d offset %lupartition %c doesn't cover the whole unit!An incorrect partition %c may cause problems for standard system utilitiespartition %c doesn't start at 0!partition %c is not marked as unused!partition %c: partition extends past end of unit partition %c: offset past end of unit partition %c: size 0, but offset %luOffset %ld for partition %c doesn't match expected value %ld%ld sectors available to give to '*' and '%%' partitions total percentage %lu is greater than 100 partition %c not an integer number of sectorsToo many '*' partitions (%c and %c)number of partitions (%lu) > MAXPARTITIONS (%d)boot block size %% sector-size != 0 (to restore label and install boot program) bsdlabel -R -B [-n] [-b boot] [-m machine] disk protofile (to write label and install boot program) bsdlabel -w -B [-n] [-b boot] [-m machine] disk [type] (to install boot program with existing on-disk label) bsdlabel -B [-b boot] [-m machine] disk (to restore label with existing boot program) bsdlabel -R [-n] [-m machine] disk protofile bsdlabel -e [-n] [-m machine] disk (to write label with existing boot program) bsdlabel -w [-n] [-m machine] disk [type]%s %s %s %s %s %s %s %s %s %s %s %s %s %s usage: clri special_device inode_number ... %s is not a valid inode numberCannot find file system superblock clearing %d %s: can't read superblock_msgbufpaM:N:%s: msgbufp not foundkvm_read: %skvm_nlist: %ssysctl kern.msgbufkernel message buffer has different magic numberusage: dmesg [-a] [-M core] [-N system] $FreeBSD: src/sbin/fdisk_pc98/fdisk.c,v 1.13 2003/05/01 14:30:59 nyan Exp $5X5X5X5X5X5X5X5X^X^X^X^X^X^X^X^X^X)X^X^X^X^X^X^X^X^X^X^X^X^X^X^X^X^X^X^X^X^X^X^X^X^X^X^X^X^X^X^X:X^X^X^X^XFX^X^XRX^X^X^X^X^X^X^X^X^XeXqX}XXPrimary DOS with 12 bit FATXENIX / file systemXENIX /usr file systemPC-UXExtended DOSPrimary 'big' DOS (> 32MB)AIX file systemOS/2 Boot Manager or OPUSFreeBSD/NetBSD/386BSDVENIX 286DMCP/M or Microport SysV/ATGBSpeedNovell Netware 2.xxNovell Netware 3.xxPCIXMinixBa:f:istuv12345678read_s0%s: %d cyl %d hd %d sec StartPart %11s %11s SID %4d: %11lu %11lu 0x%02x Media sector size is %d This is your last chance.cannot open disk %ssysmid %d (%#04x),(%s) system Name %.16s Do you want to change it?sysmidsyssidsystem namebeginning cylinderbeginning headbeginning sectorending cylinderending headending sectorAre we happy with this entry?active partitionBIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorscan't open device %s%ss%dcan't get file status of %s%s [n] yesYESregcomp() failed (%d)statfs("/")OS/2 HPFS, QNX or Advanced UNIXAIX boot partition or CoherentISC UNIX, other System V/386, GNU HURD or Mach******* Working on device %s ******* Warning: BIOS sector numbering starts with sector 1Information from DOS bootblock is: We haven't changed the partition table yet. Should we write new partition table? -t flag specified -- partition table not written. fdisk -f configfile [-itv] [disk] usage: fdisk [-Baistu] [-12345678] [disk] start %lu, size %lu (%ju Meg), sid %d beg: cyl %d/ head %d/ sector %d; end: cyl %d/ head %d/ sector %d The data for partition %d is: Explicitly specify beg/end address ? The static data for the DOS partition 4 has been reinitialized to:parameters extracted from in-core disklabel are:cylinders=%d heads=%d sectors/track=%d (%d blks/cyl) parameters to be used for BIOS calculations are:Do you want to change the active partition?Are you happy with this choiceActive partition number must be in range 1-8. Try again.Do you want to change the boot code?Do you want to change our idea of what BIOS thinks ?can't get disk parameters on %sdevice %s is not character specialinvalid fdisk partition table foundcan't read fdisk partition tablecan't write fdisk partition tableSupply a decimal value for "%s" [%d] %s is an invalid decimal number. Try again. Supply a string value for "%s" [%s] ^(/dev/[a-z]+[0-9]+)([sp][0-9]+)?[a-h]?$mounted root fs resource doesn't match expectations (regexec returned %d)@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/mknod/mknod.c,v 1.13 2000/01/06 17:51:46 obrien Exp $usage: mknod name [b | c] major minor [owner:group] group must be specified when the owner isowner must be specified when the group ismajor or minor number too large%s: illegal %s namenode must be type 'b' or 'c'%s: non-numeric major number%s: non-numeric minor numbersetting ownership on %s@(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/mount/mount.c,v 1.51 2003/04/07 12:56:01 mdodd Exp $nnnnnnn0nnnnnnnnnnnnnnnnnnnnnnnnnnn)nnn>nnJnnnnnnnnnSnmnnnnnnwnn@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/mount/mount_ufs.c,v 1.23 2002/08/03 16:03:18 mux Exp $asynchronousNFS exportednoatimenodevnoexecnosuidnosymfollowwith quotasread-onlyunionnoclusterrnoclusterwsuiddirsoft-updatesmultilabelaclsffsext2fsadF:fo:prwt:uvnoro/var/run/mountd.pidsignal mountdgetmntinforqnoautonot currently mounted %s/usr/sbinmsdosexec: mount_%sstatfs %s%s/mount_%sexec mount_%s not found in %supdateforce%s on %s (%s, writes: sync %ld async %ld, reads: sync %ld async %ld, mounted by %s,%s-ocurrentno%s %s %s %s %u %u 1 1 2 2 0 0asyncuserquotagroupquotardonlyo:%s on %s: mount table full-o %s: option not supported%s: not a directory%s has unknown file system type%s: unknown special file or file system mount [-dfpruvw] special | node mount [-adfpruvw] [ -F fstab] [-t ufs | external_type]usage: mount [-dfpruvw] [-o options] [-t ufs | external_type] special node%s on %s: specified device does not match mounted device%s on %s: incorrect super blockusage: mount_ufs [-o options] special node $FreeBSD: src/sbin/mount_cd9660/mount_cd9660.c,v 1.21 2002/08/21 18:10:55 trhodes Exp $>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>ڃ>>>>>>>>>>>!*>>Hextattgensrripstrictjolietbegjo:rs:vusing starting sector %d could not determine starting sector, using very first sessionusage: mount_cd9660 [-egrv] [-o options] [-s startsector] special node $FreeBSD: src/sbin/mount_msdosfs/mount_msdosfs.c,v 1.24 2002/08/03 16:03:19 mux Exp $tttttttttttttttttttttttttttttttttttttttttttوttttt$ttttJshortnameslongnamesnowin95sl9u:g:m:o:L:W:stat %sunknown group id: %sunknown user id: %s/usr/libdata/msdosfs/%s%i%i%i%i%i%i%i%i [-s] [-l] [-9] [-L locale] [-W table] bdev dirusage: mount_msdosfs [-o options] [-u user] [-g group] [-m mask]u2d table: missing item(s) in row %d, line %dcan't read u2d table row %d near line %dd2u table: missing item(s) in row %d, line %dcan't read d2u table row %d near line %du2w table: missing item(s) in row %d, line %dcan't read u2w table row %d near line %d !*haltdk:lnpq/boot/nextboot.confnextboot_enable="YES" kernel="halted by %sshutdown(can't restart init): SIGTERM processesSIGTSTP initrebooted by %s???vm.stats.vm.v_swappgsinWARNING: some process(es) wouldn't die cannot dump (-d) when halting; must reboot insteadusage: %s [-dnpq] [-k kernel] @(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/restore/main.c,v 1.20 2003/05/01 21:18:36 ru Exp $ەBBBBBBBBBBBBBBBBBBBBBBBBBBBB"l{BgHm$FreeBSD: src/sbin/restore/interactive.c,v 1.13 2002/09/25 04:06:37 mike Exp $; Nş%Z CMl`+M+`+B+f+l+r$FreeBSD: src/sbin/restore/restore.c,v 1.16 2002/09/25 04:06:37 mike Exp $3N!I-E--E$FreeBSD: src/sbin/restore/dirs.c,v 1.24 2002/09/25 04:06:37 mike Exp $$FreeBSD: src/sbin/restore/symtab.c,v 1.13 2002/09/25 04:06:37 mike Exp $$FreeBSD: src/sbin/restore/tape.c,v 1.37 2002/09/25 04:06:37 mike Exp $>9h>9 3RQQQQQQQQQQhx$FreeBSD: src/sbin/restore/utilities.c,v 1.13 2002/09/25 04:06:37 mike Exp $$FreeBSD: src/sbin/dump/dumprmt.c,v 1.19 2003/05/01 20:09:58 markm Exp $b:df:himNRrs:tuvxyillegal blocksize -- %sillegal dump number -- %s./restoresymtableBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. /dev/sa0usage: %s %s %s %s %s directory is used (useful with ``ls'') files to be extracted cd arg - change directory ls [arg] - list directory Available commands are: Debugdebugging mode on debugging mode off %s: not a directory %s: not on extraction list extract/ setmodesverboseverbose mode on verbose mode off whatrestore > %s: out of memory missing %c ./%s%s: name exceeds %d char directory reopen failed ls: out of memory %*d restore interrupted, continuedir %10d %s %s: not on the tape ./%u%s: REMOVE Delete whiteouts Mark entries to be removed. [%s] %s: %s [%s] %s: %s|LINK [%s] %s: Extraneous name [%s] %s: impossible state [%s] %s: inconsistent state cannot KEEP and change modescorrupted symbol table |MODECHG|NAMEFND|INOFND|ONTAPE%s: remove unreferenced name unreferenced with flagsFind unreferenced names. cannot remove, non-emptyunexpected file on tapeunknown file on tape %s: not found on tape %d: bad first Extract new leaves. Extract requested files Add links Add whiteouts incomplete operationsCheck the symbol table. missing inumber %d type should be LEAFWarning: missing name %s TMPDIR/tmp/%s/rstdir%d-XXXXXXopendirfile: %s %s/rstmode%dreclen not multiple of 4 Mangled directory: error reading directory set owner/mode for '.'fopen: %s cannot open mode file %s modefile not defined read: %s no memory directory table addino: out of range %d duplicate inumdeleteino: out of range %d deleteino: %d not found %s is not a directory %s: pathname too long duplicate entry link to non-existent name bad name to addentry %s not marked REMOVEDlink not foundlookupino failedfreeing non-empty directoryfreeing referenced directorycannot move ROOTno space for string table bad name fwrite: %s Check pointing the restore Incremental tape too low Incremental tape too high stat: %s no memory for entry table Initialize symbol table. /dev/ttycannot open %s: %s /dev/nullno header after volume mark! no memory for file dump list Cannot find file dump list maxino = %d bad block size %ld cannot stat .: %s Tape is not a dump tape tape is not dump tape Mount tape volume %ld none Cannot open %s can quickly skip tapes that start with the last volume %s%s%s%s%s%s%sSpecify next volume #: You have read volumes%s%ldWrong volume (%ld) Wrong dump date got: %s wanted: %sactive file into volume 1 Warning: %s %s ioctl MTFSF: %s Dump date: %sthe epoch Dumped from: %sLabel: %s %s: unknown file mode 0%o %s: cannot create fifo: %s extract fifo %s extract file %s unextracted directory %s extract special file %s %s: cannot create file: %s skipped socket %s not at beginning of a file ran off end of tape hole in map End-of-tape encountered Tape read error while trying to set up tape continuation failed: %s restoring %s trying to resynchronize skipping over inode %d mid-media short read error. Tape block size is %ld tape read error: %s 8l4s1q8l2q17l2l4qNote: Doing Byte swapping Dumped inodes map headerFile header, ino %dEnd of tape headerUsed inodes map headerVolume header begins with record %qdunexpected tape header unknown tape header type %d RSTTMP%s%ld%lunot on ino listrename %s to %s newnode: not a nodeMake node %s warning: %s: %s removenode: not a nodeRemove node %s removeleaf: not a leafRemove leaf %s linkit: unknown type %d symbolichardCreate %s link %s->%s Create whiteout %s delwhiteout: not a leafDelete whiteout %s bad entry: %s parent name %s entry type: %s inode number: %lu flags: %s NODEnext hashchain name: %s next link name: %s next entry name: %s sibling name: %s |EXISTED|KEEP|NEW|EXTRACT|TMPNAME|REMOVED%s is not on the tape %s? [yn] abortdump coreon %s: %s%sRMTTCP_NODELAY setsockoptlogin to %s as %s failed. /etc/rmttcpwho are you? shell/tcp: unknown service invalid user name %s O%.226s %d C R%d W%d L%d %d I%d %d ioctl(rmtgets got "%s"). block size must be greater than 0dump number must be greater than 0none of i, R, r, t or x options specifiedVerify the directory structure %c and %c options are mutually exclusiverestore -t [-cdhNuvy] [-b blocksize] [-f file] [-s fileno] [file ...]restore -x [-cdhmNuvy] [-b blocksize] [-f file] [-s fileno] [file ...]restore -R [-cdNuvy] [-b blocksize] [-f file] [-s fileno]restore -r [-cdNuvy] [-b blocksize] [-f file] [-s fileno]restore -i [-cdhmNuvy] [-b blocksize] [-f file] [-s fileno]option requires an argument -- %c%s: unknown command; type ? for help If no `arg' is supplied, the current help or `?' - print this list verbose - toggle verbose flag what - list dump header information quit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%scommand lines cannot be continued canonname: not enough buffer space Warning: undefined file type %d %s: (inode %d) not found on tape deleted hard link %s to directory %s NODE and LEAF links to same inodename/inode conflict, mktempname %s Remove old nodes (directories). expected next file %d, got %d Continue extraction of new leaves Root directory is not on tape %s - cannot create modefile fopen%s - cannot create directory temporary fopenExtract directories from tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s reclen less than DIRSIZ (%d < %d) bad seek pointer to rst_seekdir %ld corrupted directory: bad inum %d corrupted directory: bad reclen %d cannot find directory inode %d error setting directory modes directory mode, owner, and times not set Set directory mode, owner, and times. write error extracting inode %d, name %s Cannot find directory inode %d named %s no memory to extend symbol table cannot find entry in parent listoutput error to file %s writing symbol table cannot create save file %s for symbol table initsymtable called from command %c cannot read symbol table file %s cannot allocate space for symbol table cannot stat symbol table file %s cannot open symbol table file %s Cannot allocate space for magtape buffer Cannot allocate space for tape buffer no memory for active inode map Cannot find file removal list header read failed at %ld blocks Tape is not volume 1 of the dump Verify tape and initialize maps Changing volumes on pipe input? Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Otherwise, begin with volume 1. have no further files to extract.and work towards the first; restoreIf you are extracting just a few files,You have not read any tapes yet. Volume numbers are positive numerics Skipping %ld duplicate record%s. last rec %qd, tape starts with %qd End-of-input encountered while extractingCannot have multiple dumps on pipe input Level %ld dump of %s on %s:%s %s: cannot create special file: %s %s: zero length symbolic link (ignored) Missing address (header) block for %s at %ld blocks write error extracting inode %d, name %s write: %s seek error extracting inode %d, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s partial block read: %d should be %d partial block read: %ld should be %ld is not a multiple of dump block sizeTape block size (%ld) %s (%d) Format of dump tape is too old. Must use a version of restore from before 2002. gethead: unknown inode type %d ; predicted %ld blocks, got %ld blocksFile continuation header, ino %dresync restore, skipped %ld blocks Checksum error %o, inode %d file %s Unknown conversion character: %c mktempname: called with TMPNAMEwarning: cannot rename %s to %s: %s removenode: non-empty directorywarning: cannot create hard link %s->%s: %s warning: cannot create symbolic link %s->%s: %s warning: cannot create whiteout %s: %s warning: cannot delete whiteout %s: %s Lost connection to remote host. Connection to %s established. IP_TOS:IPTOS_THROUGHPUT setsockoptProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. ^ ^ U ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ v ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^  ^ ^  ^ ^ ^  ^ ^   ^ ^ ^ ^ ^ ^  AadlhksUsw%s: %sing %s as swap device removswapoff%s: NSWAPDEV limit reached%s: device already in useusage: %s [-a] [special_file ...] vm.swap_info/dev/%-8s %*lld %*lld Total: %*lld %*lld sysctl()%ld-blocksUsed:Device:%-13s %*s %*s sysctlnametomib()xswdev version mismatch[-lshAU] [-a/-d special_file ...] @(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $FreeBSD: src/sbin/umount/umount.c,v 1.34 2003/04/07 12:56:01 mdodd Exp $...............................................5DEAaF:fh:t:vfstab reading failurenoneudpRPCMNT_UMOUNTRPCPROG_MNT%s: unmount from %s unmount of %s failedcan't get net id for hostcalloc/var/db/mounttab%ld %s %s can't open %scan't remove %swrite mounttab entry %s:%scan't write to %s by hostdelete mounttab entry%s %s:%sbad mounttab %s field '%s'cannot umount %s, %s is mounted there, umount it first%s not found in mount table, unmounted it anywaycannot remove mounttab entry %s:%s umount -a | -A [ -F fstab] [-fv] [-h host] [-t type]usage: umount [-fv] special | node)g(g(g(g(g(g(g(g(g(g(g(g(g(g(g(g(g(g(g(g(g(g(g(g(g(g(g(g(g(g(g(g(g((g(g(g(g(g(g(g(g(g(g(g(g()g($)J)uhvhvhvhvhvhvhvhvuhvuuhvhvuhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvuhvhvhvhvhvhvhvhvuhvuuhvhvuABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/pmymmmmmmmmmmmmmmmmmmmmmmmmmmommmmmmmmmmmmmmmmm"m;mw KMGTP98 9 9 9 9 9 9 9 9 999 9 9 9 9 9 9 9 9 9 9 9 9 98888tenex%s %s [anpqy?]? Interactive mode: off. %s aborted. EOF received; %s aborted usage: %s [ | TYPE %sTYPE %s %s%s: unknown mode. usage: %s usage: %s mode-name usage: %s format usage: %s struct-mode STOUSTORAPPEremote-filelocal-filemputContinue with%s: not foundlocal-filesusage: %s local-files r+RETRlocal: %smregetmgetremote-filesusage: %s remote-files usage: %s localfile Cannot open source file %s and logged inConnected %sto %s. (none)Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Nmap: (in) %s (out) %s Use of PORT cmds: %s. Command line editing: %s. 1.6-beta2lukemftpVersion: %s %s Macros: Nmap: off. Ntrans: off. No proxy connection. Not connected. usage: %s [ on | off ] %s %s. Bell modeEditing modePacket tracingHash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeGlobbingPreserve modification timesDebugging %s (debug=%d). %s: bad debugging value. XCWD %sremote-directoryusage: %s remote-directory usage: %s [local-directory] Local directory now %s getcwd: %sDELE %susage: %s remote-file mdeleteusage: %s [remote-files] usage: %s from-name to-name RNFR %sRNTO %sto-namefrom-nameMLSDnlistNLSTLISTusage: %s [remote-path] output to local-file:pagermoremlsusage: %s [command [args]] Try again laterSHELL-c/bin/shUSER %sLogin failed. ACCT %sPASS %sAccount: Password: usernameXPWDLocal directory %s getcwdXMKD %sdirectory-nameusage: %s directory-name XRMD %scommand line to sendusage: %s line-to-send SITE arguments to SITE commandusage: %s mode remote-file SITE CHMOD %s %sSITE UMASK %sSITE UMASKusage: %s [umask] SITE IDLE %sSITE IDLEusage: %s [seconds] HELP %sHELPQUITusage: %s [password] Account:?Invalid proxy command. ?Invalid command. ?Ambiguous command. usage: %s command Case mappingCarriage Return strippingNtrans off. usage: %s [mapin mapout] mapoutNmap off. nmap: unbalanced brackets. EPSV/EPRT on IPv4Store uniqueReceive uniqueCDUPXCUPusage: %s [restart-point] No restart point defined. restart: Invalid offset `%s' SYSTusage: %s macro_name macro name%s %lld %s %sSTAT %sSTATusage: %s [remote-file] usage: %s local-file usage: %s size sndbuf%s: size must be positive. rcvbufxferbufusage: %s [option value] Setting `%s' to `%s'. No such option `%s'. %-*s %s usage: %s option Unsetting `%s'. FEATMLST %sOPTS %s %sOPTS %susage: %s command [options] accountbyecdupnrdisconnectepsv4featuresfgetformglobhashidlelcdlesslpagelpwdmacdefmlstmodtimemsendnewerntranspassivepdirplspmlsdpreservequoterecvremoptsrhelprstatusruniquesendportsitestructsuniquethrottletraceumaskunsetanonpassftp_proxyhttp_proxyno_proxyrpromptunknown complete type `%c''%s' macro not found. usage: %s macro_name [args] Basicrealm="Username for `%s': auth_url: challenge `%s' http://Unknown port `%s' in %s `%s'ftp://file://Invalid %s `%s'retrievedTrying %s... Connect to address `%s' (GET %s HTTP/1.0 User-Agent: %s/%s Proxy-Authorization: %s Content-Length: Content-Range: bytes Last-Modified: Location: Transfer-Encoding: Proxy-Authenticate: WWW-Authenticate: parsed www-auth as: %s parsed proxy-auth as: %s chunkedusing chunked encoding parsed location as: %s %a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %Yparsed date as: %sparsed range as: %lld-%lld/%lld Improper response from `%s'parsed len as: %lld received `%s' Error retrieving file - `%s'Unknown error retrieving fileReading fileWriting `%s'got chunksize of %lld Can't open `%s'already done Can't run `%s'Redirected to %s Redirected via %s Receiving HTTP replyWriting HTTP request%swith proxy authorization%swith authorizationPragma: no-cache %svia %s:%sGET %s HTTP/1.1 Host: [%s]:%uAccept: */* Connection: close Cache-Control: no-cache Range: bytes=%lld- restarting at %lldHost: %sRequesting %s Can't connect to %sCan't create socketproxy URLMalformed proxy URL `%s'copiedCannot open file `%s'Copying %s (restarting at %lld)Can't lseek to restart `%s'got savefile as `%s' localhost HTTP fetch aborted. Invalid URL `%s'dir `%s', nextpart `%s' *?[]{};type=a;type=i;type=dabout:lukemnetbsdversionVersion: %s %s%s auto_put: target `%s' fdopen failed.Connected to %s. setsockopt TOS (ignored)getsocknameconnect to address %s---> PASS ACCT ACCT XXXXPASS XXXX%s:%c%c%c send receivesentlocal: %s REST %lldnetout%s: not a plain file. received%s: short writenetinPASVLPSV%u,%u,%u,%u,%u,%u,%u,%u,%uEPSV%c%c%c%d%cparse error! Passive mode refused. setsockopt (ignored)PORT %d,%d,%d,%d,%d,%dEPRT |%d|%s|%s|listensetsockopt (reuse address)acceptPORT %slocal: %s remote: %s No primary connection. %cABOR FTPSERVERPORThttpNETRC$NETRC `%s': %sFTPMODEpftpFTPSERVERTERMdumb46AadefginN:o:pP:r:RtT:u:vV-Tbad throttle value: %sHOMEanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERftp> FTPPROMPTFTPRPROMPTRetrying in %d seconds... gate-ftpactivecan't create socketftpgatebad retry value: %sno such option `prompt'no such option `rprompt'sorry, input line too long. ?Invalid %s command `%s' ?Ambiguous %s command `%s' usage: %s [command [...]] Proxy csetupoption()passwordpasswdmachine4K macro buffer exceeded. Unknown .netrc keyword %susage: %s host-name [port] non-printstream MDTM MLST REST STREAM SIZE TVFSfeatures[%d] = %d 215 UNIX Type: L8215 TOPS20Remote system type is %s. Name (%s:%s): Login failed.$initPassword:Name (%s): (%s) sorry, arguments too long. ftpXXXXXXXXXXSIZE %sMDTM %sCan't parse time `%s'. %04d%02d%02d%02d%02d%02d191Converted to `%s' got remotepwd as `%s' %3d%% |%.*s%*s| %5lld %c%c %3lld.%02d %cB/s --:-- ETA%2d:%02d:%02d ETA - stalled -%02d:%02d %lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %cB/s) ETA: %02d:%02d (stalled)emacsftp-complete^Iunable to set rcvbuf size %dunable to set sndbuf size %disipv6addr: got %d for %s Prompting off for duration of %s. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list Using %s mode to transfer files. internal error: unknown type %d.We only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. usage: %s local-file [remote-file] usage: %s remote-file [local-file] Restart is not supported by the remote server. Gate ftp: %s, server %s, port %s. Passive mode: %s; fallback to active mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Get transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. Socket buffer sizes: send %d, receive %d. (disabled for this connection)Use of EPSV/EPRT cmds for IPv4: %s%s. Connected for proxy commands to %s. usage: %s [ on | off | bytecount ] mark: bad bytecount value `%s'. usage: %s [ on | off | gateserver [port] ] Disabling gate-ftp mode - no gate-ftp server defined. usage: %s [ on | off | debuglevel ] CWD command not recognized, trying XCWD. usage: %s [remote-path [local-file]] MLSD is not supported by the remote server. usage: %s remote-files local-file usage: %s username [password [account]] EOF received; login aborted. PWD command not recognized, trying XPWD. MKD command not recognized, trying XMKD. RMD command not recognized, trying XRMD. usage: %s [inchars [outchars]] usage: %s [ on | off | auto ] usage: %s (all|get|put),maximum-bytes[,increment-bytes]] usage: %s (all|get|put) [maximum-bytes [increment-bytes]] CDUP command not recognized, trying XCUP. Restarting at %lld for next get, put or append Macro not defined - 4K buffer exceeded. macdef: end of file encountered. Enter macro line by line, terminating it with a null line. Limit of 16 macros have already been defined. Local file "%s" is newer than remote file "%s". FEAT is not supported by the remote server. MLST is not supported by the remote server. OPTS is not supported by the remote server. Must be logged in to complete. Unsupported WWW Authentication challenge - `%s'parse_url: user `%s' pass `%s' host %s port %s(%d) path `%s' Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'parse_url: invoked with NULL argument!Invalid URL (no file after host) `%s'Invalid URL (no file after directory) `%s'Unsupported transfer encoding - `%s'Bogus transfer encoding - `%s' (fetching anyway)Received unexpected Content-Range headerCan't change modification time to %sUnexpected data following chunkUnexpected data following chunksizeUnexpected EOF reading chunksizeSize of `%s' differs from save file `%s'Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedNo authentication challenge provided by serverAuthorization failed. Retry (y/n)? Scoped address notation `%s' disallowed via web proxyNo support for non local file URL `%s'fetch_ftp: user `%s' pass `%s' host %s port %s path `%s' dir `%s' file `%s' ftp: The `CWD ' command (without a directory), which is required by RFC 1738 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't connect or login to host `%s'Directory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'fetch_ftp: unknown transfer type %dThis version of ftp has been enhanced by Luke Mewburn for the NetBSD project. Execute `man ftp' for more details. Luke Mewburn is the author of most of the enhancements in this ftp client. Please email feedback to . NetBSD is a freely available and redistributable UNIX-like operating system. For more information, see http://www.netbsd.org/index.html `%s' is an interesting topic. auto_put: url `%s' argv[2] `%s' No control connection for command.421 Service not available, user interrupt. Connection closed. 421 Service not available, remote server has closed connection. 421 Service not available, remote server timed out. Connection closed aborted. Waiting for remote to finish abort. abortxfer called with unknown direction `%s'Can't change modification time on %s to %sWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Passive mode address scan failure. Shouldn't happen! wrong server: return code must be 227 Passive mode AF mismatch. Shouldn't happen! %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uwrong server: return code must be 228 wrong server: return code must be 229 disabling epsv4 for this connection LPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%duse of scoped address can be troublesomeproxy server does not support third party transfers. runique: can't find unique file name. remote abort aborted; closing connection. Lost control connection for abort.Neither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpunknown $FTPMODE '%s'; using defaultsunable to get default sndbuf sizeunable to get default rcvbuf size%sommands may be abbreviated. Commands are: getoptionvalue() invoked with NULL namegetoptionvalue() invoked with unknown option `%s'usage: %s [-46AadefginpRtvV] [-N netrc] [-o outfile] [-P port] [-r retry] [-T dir,max[,inc][[user@]host [port]]] [host:path[/]] [file:///file] [ftp://[user[:pass]@]host[:port]/path[/]] [http://[user[:pass]@]host[:port]/path] [...] %s -u url file [...] Error: .netrc file is readable by others.Remove password or make file unreadable by others.Remove account or make file unreadable by others.Macro definition missing null line terminator. Missing macdef name argument. Connecting via pass-through server %s Already connected to %s, use close first. gateserver not defined (shouldn't happen)Remember to set tenex mode when transferring binary files from this machine. ftp_login: user `%s' pass `%s' host `%s' can't find list of remote files, oops.can't find list of remote files, oops. unable to create temporary file %sSIZE is not supported by remote server. MDTM is not supported by remote server. Y2K warning! Incorrect time-val `%s' received from server. ***************************************************************************************************************************************************************************************************************************************crankrate invoked with unknown signal: %dContext sensitive argument completionUnknown port `%s', using port %dUnable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistxstrdup() called with NULL argumentUnable to allocate memory for string copyxsignal_restart called with signal %d.A @ijjjijjjjjjjjjjjjiijjjjijjjjjjj'jjjjjijjjjjjjj4jjCjRjajrjjjjjjjjjjjjjjjjjjjjqqqqqqqqqqqqqqrrrrNNcNc^cccccccccccccccccccccccccccc&++&+++++++++++++++++++&++++++&&&c+++&KrrrrrrrDrrr؉}d^ $X֚֚֚֚֚֚֚֚v"1222222222222222222222222ϴY222z%s sequence challenge /usr/bin/opiekey^?aoSend Telnet Abort outputaytSend Telnet 'Are You There'Send Telnet BreakbreakSend Telnet Erase CharacterSend Telnet Erase LineSend current escape characterSend Telnet Interrupt ProcessintpinterruptintrnopSend Telnet 'No operation'eorSend Telnet 'End of Record'Send Telnet 'Abort Process'Send Telnet 'Suspend Process'getstatusSend request for STATUSDisplay send optionsdontwillwontSENTbuffer, if this might help.)?Need to be connected first.'send ?' for help"value" must be from 0 to 255Valid options are: %-15s %s setsockopt (SO_DEBUG)autoflushautosynchskiprcdon't read ~/.telnetrc fileinbinaryreceiving of binary dataoutbinarysending of binary datacrlfcrmodmap carriage return on outputlocalcharsdebuggingnetdataprettydumpshow option processingtermdata%-15s toggle %s display help informationenabledisable%-15s %s %s WillWon'trloginrlogin escape charactertracefileflushoutputcharacter to cause an EOF lnextreprintworderasecharacter to use for XONcharacter to use for XOFFforw1forw2alternate AYT character%s character is '%s'. %s set to "%s". %s reset to "%s". 'mode ?' for help.Disable LINEMODE optionEnable LINEMODE optionEnable signal trapping+isig-isigDisable signal trappingEnable character editing+edit-editDisable character editingEnable tab expansion+softtabs-softtabsEnable literal character echo+litecho-litechokludgelinePrint help information%-15s [%s] %-15s "%s" won't?Unknown argument '%s'. ?Ambiguous argument '%s'. new escape character: ExeclFork failed fromquitConnection closed.importcheckundefineunexportSend an environment variableonly DISPLAYunix:USERPRINTERLOGNAME%c %-20s %s notmuchLocalRemote%s character echo No%s flow control Escape character is '%s'. Catching signals locally%s line editing %s catching of signals No connection.setsockopt (source route)telnet: socketBad source route option: %s -a(to) ?Already connected to %s logouttoggleslcenvironopie%s> ?Invalid command?Ambiguous command?Invalid help command %s ?Ambiguous help command %s ?Invalid command: %s ?Ambiguous command: %s /.telnetrc[host-name [port]][-r] [-s src_addr] [-u] usage: %s %s%s%s%s rlogSetSockOptUNKNOWN%c%c%c%c%s%c%c%c%c%c%c%ld,%ld%c%clm_will: no command!!!lm_wont: no command!!!lm_do: no command!!!lm_dont: no command!!!remote defaultremoteslc_import: not enough roomSYSTEMTYPEJOBACCTIn SUBOPTION processing, RCVDz close SUSPABORTEORNOPDMARKBRKIPAOAYTGASBWILLWONTDONTIACBINARYRCPSUPPRESS GO AHEADTIMING MARKRCTENAOLNAOPNAOCRDNAOHTSNAOHTDNAOFFDNAOVTSNAOVTDNAOLFDEXTEND ASCIILOGOUTBYTE MACRODATA ENTRY TERMINALSUPDUPSUPDUP OUTPUTSEND LOCATIONTERMINAL TYPEEND OF RECORDTACACS UIDOUTPUT MARKINGTTYLOC3270 REGIMEX.3 PADNAWSTSPEEDLFLOWLINEMODEXDISPLOCOLD-ENVIRONAUTHENTICATIONENCRYPTNEW-ENVIRONTN3270ECHARSETCOM-PORTKERMITSYNCHRPLNEXTFORW1FORW2MCLMCRMCWLMCWRMCBOLMCEOLINSRTOVERECREWREBOLEEOL(standard output)Cannot open %s. %c 0x%x %c%.2x%s %s EXOPL%s %d %d%s IAC %s%s IAC %dresp DO_DONT %s: %d want DO %s resp WILL_WONT %s: %d want WILL %s want WILL %d want WONT %s want WONT %d resp WILL_WONT %d: %d WILL %s WILL %d want DO %d want DONT %s want DONT %d resp DO_DONT %d: %d DO %s DO %d %s IAC SB (terminated by , not IAC SE!) TERMINAL-TYPE IS "%.*s" %d (unknown) ?%d? SEND IS %s %d SE IS %d %d (%d) (empty suboption???)TERMINAL-SPEED IS TOGGLE-FLOW-CONTROL RESTART-XON RESTART-ANY OFF ONLINEMODE SLC|FLUSHOUT|FLUSHIN|ACK %d; DEFAULT VARIABLE NOSUPPORT CANTCHANGE|LIT_ECHO|SOFT_TAB|TRAPSIG|EDIT ?0x%x? (0x%x)(no mode???)DONT Forward Mask %x(no option???)WONT DO WILL X-DISPLAY-LOCATION %s (unknown)NEW-ENVIRON INFO " %03o " USERVAR " ESC " VAR " VALUE SEND (Empty suboption???)%d %02xSend Telnet 'Go Ahead' sequenceSend Telnet End of File CharacterPerform Telnet 'Synch operation'Telnet 'send' error - argument disappeared! There is not enough room in the buffer TO the networkto process your request. Nothing will be done.('send synch' will throw away most data in the networkNeed %d argument%s to 'send %s' command. 'send %s ?' for help. Ambiguous send argument '%s' 'send ?' for help. Unknown send argument '%s' 'send ?' for help. need at least one argument for 'send' commandusage: send %s '%s': bad value ('send %s ?' for help). '%s': unknown argument ('send %s ?' for help). '%s': ambiguous argument ('send %s ?' for help). Will send carriage returns as telnet .Will send carriage returns as telnet .Already in network ascii mode with remote host.Negotiating network ascii mode with remote host.Negotiating binary mode with remote host.Already operating in binary mode with remote host.Already receiving in network ascii mode.Negotiating network ascii mode on input.Already receiving in binary mode.Negotiating binary mode on input.Already transmitting in network ascii mode.Negotiating network ascii mode on output.Already transmitting in binary mode.Negotiating binary mode on output.flushing of output when sending interrupt charactersflush output when sending interrupt charactersautomatic sending of interrupt characters in urgent modesend interrupt characters in urgent modeskip reading of ~/.telnetrc filesending and receiving of binary datasending carriage returns as telnet mapping of received carriage returnslocal recognition of certain control charactersrecognize certain control charactersturn on socket level debuggingprinting of hexadecimal network data (debugging)print hexadecimal representation of network trafficoutput of "netdata" to user readable format (debugging)print user readable output for "netdata"viewing of options processing (debugging)(debugging) toggle printing of hexadecimal terminal dataprint hexadecimal representation of terminal traffic'%s': unknown argument ('toggle ?' for help). '%s': ambiguous argument ('toggle ?' for help). Need an argument to 'toggle' command. 'toggle ?' for help. character to toggle local echoing on/offcharacter to escape back to telnet command modefile to write trace information toThe following need 'localchars' to be toggled truecharacter to cause an Abort Outputcharacter to cause an Interrupt Processcharacter to cause an Abort processThe following are for local editing in linemodecharacter to use to erase a charactercharacter to use to erase a linecharacter to use for literal nextcharacter to cause a Suspend Processcharacter to use for line reprintcharacter to use to erase a wordalternate end of line characterTelnet rlogin escape character is '%s'. Telnet escape character is '%s'. Format is 'set Name Value' 'set ?' for help.'%s': ambiguous argument ('set ?' for help). Format is 'set togglename [on|off]' 'set ?' for help.'%s': unknown argument ('set ?' for help). '%s': ambiguous argument ('unset ?' for help). '%s': unknown argument ('unset ?' for help). Need an argument to 'unset' command. 'unset ?' for help. ?Need to have LINEMODE option enabled first.(or disable obsolete line-by-line mode)(or enable obsolete line-by-line mode)These require the LINEMODE option to be enabledDisable literal character echoformat is: 'mode Mode', where 'Mode' is one of: 'mode' command requires an argumentAmbiguous mode '%s' ('mode ?' for help). Unknown mode '%s' ('mode ?' for help). Deprecated usage - please use 'set escape%s%s' in the future. Deprecated usage - please use 'toggle crmod' in the future.%s map carriage return on output. Use local special character definitionsUse remote special character definitionsVerify remote special character definitionsNeed an argument to 'slc' command. 'slc ?' for help. '%s': ambiguous argument ('slc ?' for help). '%s': unknown argument ('slc ?' for help). Define an environment variableUndefine an environment variableMark an environment variable for automatic exportDon't mark an environment variable for automatic exportList the current environment variablesNeed %s%d argument%s to 'environ %s' command. 'environ ?' for help. '%s': ambiguous argument ('environ ?' for help). '%s': unknown argument ('environ ?' for help). Need an argument to 'environ' command. 'environ ?' for help. Cannot send '%s': Telnet ENVIRON option not enabled Cannot send '%s': variable not defined Operating in single character modeOperating in obsolete linemodeOperating with LINEMODE optionConnection closed by foreign host. Unable to connect to remote hosttelnet: setsockopt (IP_TOS) (ignored)hostname too long for unix domain socket: %susage: %s [-l user] [-a] [-s src_addr] host-name [port] Commands may be abbreviated. Commands are: ?Need to be connected first for %s. [-e char] [-l user] [-n tracefile] [-4] [-6] [-8] [-E] [-L] [-N] [-S tos] [-c] [-d]468EKLNS:X:acde:fFk:l:n:rs:t:uxy%s: Warning: -F ignored, no Kerberos V5 support. %s: Warning: -S ignored, no parsetos() support. %s: Warning: -f ignored, no Kerberos V5 support. %s: Warning: -k ignored, no Kerberos V4 support. %s: Warning: -x ignored, no ENCRYPT support. %s: Warning: -y ignored, no ENCRYPT support. sleep(5) from telnet, after select: %s No room in buffer for terminal type. lm_will: not enough room in bufferlm_do: not enough room in bufferlm_mode: not enough room in bufferSpecial characters are %s values slc_end_reply: not enough roomenv_opt_start: malloc()/realloc() failed!!!env_opt_add: realloc() failed!!!Remote side does not support STATUS option- unknown qualifier %d (0x%x).@(#)cl_bsd.c 8.29 (Berkeley) 7/1/96@(#)cl_funcs.c 10.50 (Berkeley) 9/24/96@(#)cl_main.c 10.36 (Berkeley) 10/14/96@(#)cl_read.c 10.15 (Berkeley) 9/24/967@I@(#)cl_screen.c 10.49 (Berkeley) 9/24/96@(#)cl_term.c 10.22 (Berkeley) 9/15/96m1m nan>n_n(n-n/n;n?nIn?nNn@yTn^nydnunznn(Snnnnnnnnnrnn_hn4~nn>nnSnn~nnh@(#)cut.c 10.10 (Berkeley) 9/15/96 "(.4@(#)delete.c 10.12 (Berkeley) 10/23/96$FreeBSD: src/contrib/nvi/common/exf.c,v 1.5 2001/10/26 08:25:32 jkh Exp $@(#)key.c 10.33 (Berkeley) 9/24/960123456789abcdef01234567;^vv;;vWR!(/RR6=DK@(#)line.c 10.21 (Berkeley) 9/15/96@(#)log.c 10.8 (Berkeley) 3/6/96G&&&i&&&&#'(=(''''\((O)))))*O)f*@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1992, 1993, 1994, 1995, 1996 Keith Bostic. All rights reserved. @(#)main.c 10.48 (Berkeley) 10/11/96-------,,----------,,---------------,- -------------#-E-T----@(#)mark.c 10.13 (Berkeley) 7/19/96@(#)msg.c 10.48 (Berkeley) 9/15/96R99<9<qqqqqq rrrFFGG G,G@(#)options.c 10.51 (Berkeley) 10/14/96(sh2s=sGsQsXsashshns,|vssssRksssssRksRksskʼn9isj{kf^ssTstj tkgnktk t"tjgkEr*k-t4t;tAtHttNtYtkbt ~itst@~ttt@tttk@tm ttttkQtRl t l tl tltu uuu'uB4*u-uq  P ١r-0u3u=u"M%@u&!,x*g0fP2v4Eu:Ju7Mu86>N=6rB<ʍ?Qu?zyIYuN\uI_uKbuL5M@(#)options_f.c 10.25 (Berkeley) 7/12/96@(#)put.c 10.11 (Berkeley) 9/23/96@(#)screen.c 10.15 (Berkeley) 9/15/96@(#)search.c 10.25 (Berkeley) 6/30/96 @(#)seq.c 10.10 (Berkeley) 3/30/96@(#)recover.c 10.21 (Berkeley) 9/15/96@(#)util.c 10.11 (Berkeley) 9/15/96@(#)ex.c 10.57 (Berkeley) 10/10/96ßßßßßßßßßßßßßßßßßßßßßßßßßzz^^ի\٫_pp}}+CPݽ           jt [6@(#)ex_abbrev.c 10.7 (Berkeley) 3/6/96@(#)ex_append.c 10.30 (Berkeley) 10/23/96@(#)ex_args.c 10.16 (Berkeley) 7/13/96@(#)ex_argv.c 10.26 (Berkeley) 9/20/96@(#)ex_at.c 10.12 (Berkeley) 9/15/96@(#)ex_bang.c 10.33 (Berkeley) 9/23/96@(#)ex_cd.c 10.10 (Berkeley) 8/12/96@(#)ex_cmd.c 10.20 (Berkeley) 10/10/96-nz) yzXAaz͋1) xzzAY zvzzM Bx@ {  1{-{N BxA{vS{z1^{q{`{{{{{{p7 {"{{)|||6||<||D" Bwn@S|Z|]| Bxu|WP  @y ||| |||| 8| ||}y7 | }@} Z| }%}G1<}O}j} Bo}t}4  }}{( x@o# B_}  }}X }}} ! ~~~ (~@`gn1) x p' ,~z) x@I~W~ 4\~g~ 4n~(' {~~@0 qv~91 ~~`1 1~uP( ~~~7  & 2| 7<`hT x\9 |ReI } `~LI R ~T T " Bwn| 7` #0E 7Lho p}  4'q @Ȁπj ml $@- `0 4H !; `4 |@]l 8e $Z|u]yX $Z|@ $Z|0 $|  9L `xiZ  @(#)ex_cscope.c 10.13 (Berkeley) 9/15/96Á݁0Q`J!8**@(#)ex_delete.c 10.9 (Berkeley) 10/23/96@(#)ex_display.c 10.12 (Berkeley) 4/10/96@(#)ex_edit.c 10.10 (Berkeley) 4/27/96@(#)ex_equal.c 10.10 (Berkeley) 3/6/96@(#)ex_file.c 10.12 (Berkeley) 7/12/96@(#)ex_filter.c 10.34 (Berkeley) 10/23/96@(#)ex_global.c 10.22 (Berkeley) 10/10/96@(#)ex_init.c 10.26 (Berkeley) 8/12/96@(#)ex_join.c 10.10 (Berkeley) 9/15/96@(#)ex_map.c 10.9 (Berkeley) 3/6/96@(#)ex_mark.c 10.8 (Berkeley) 3/6/96@(#)ex_mkexrc.c 10.11 (Berkeley) 3/6/96@(#)ex_move.c 10.10 (Berkeley) 9/15/96@(#)ex_open.c 10.7 (Berkeley) 3/6/96@(#)ex_preserve.c 10.12 (Berkeley) 4/27/96@(#)ex_print.c 10.18 (Berkeley) 5/12/96@(#)ex_put.c 10.7 (Berkeley) 3/6/96@(#)ex_quit.c 10.7 (Berkeley) 4/27/96@(#)ex_read.c 10.38 (Berkeley) 8/12/96@(#)ex_screen.c 10.11 (Berkeley) 6/29/96@(#)ex_script.c 10.30 (Berkeley) 9/24/96@(#)ex_set.c 10.7 (Berkeley) 3/6/96@(#)ex_shell.c 10.38 (Berkeley) 8/19/961< HR_irąх څ   0@KZdxΆ@(#)ex_shift.c 10.11 (Berkeley) 9/15/96@(#)ex_source.c 10.12 (Berkeley) 8/10/96@(#)ex_stop.c 10.10 (Berkeley) 3/6/96@(#)ex_subst.c 10.37 (Berkeley) 9/15/96[ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ ~j [ [ [ [ [ [ [ [ [ j [ [ j j j j j j j j j j [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ _k [ [ [ k [ [ [ [ k [ [ [ k [ k y { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { @(#)ex_tag.c 10.36 (Berkeley) 9/15/96@(#)ex_txt.c 10.17 (Berkeley) 10/10/96J  =   ڗ     ڗ       m    {        g @(#)ex_undo.c 10.6 (Berkeley) 3/6/96@(#)ex_usage.c 10.13 (Berkeley) 5/3/96@(#)ex_util.c 10.23 (Berkeley) 6/19/96  ǥ ϥ ץ      % @(#)ex_version.c 10.31 (Berkeley) 8/22/96@(#)ex_visual.c 10.13 (Berkeley) 6/28/96@(#)ex_write.c 10.30 (Berkeley) 7/12/96@(#)ex_yank.c 10.7 (Berkeley) 3/6/96@(#)ex_z.c 10.10 (Berkeley) 3/6/96@(#)ex_tcl.c 8.10 (Berkeley) 9/15/96@(#)ex_perl.c 8.10 (Berkeley) 9/15/96@(#)getc.c 10.10 (Berkeley) 3/6/96    L @(#)v_at.c 10.8 (Berkeley) 4/27/96@(#)v_ch.c 10.8 (Berkeley) 3/6/96    ! d v    @(#)v_cmd.c 10.9 (Berkeley) 3/28/96 "@TpQ  z*  @s v  ˉՉ0   D s D&0 FI5 HDZs Ddn D   @  ĊΊ   , $.t BEW cfX  @| <  DC  ,@P  ϋ D "@D3 A (C6 "@D>G "@D]fs HD2  D@ HD "@Ìt  @qRՌ#    Dм  , 6"  ,T "@jx    M  Dč͍ I  D/8<  FR H HEen E~`    L E EMɎC "@R  T   !  6?Uf  FC  ̊F  DQ  ԏ@PU   @D  @D~4#  D@yLK @Dg "B  M  DÐ  Ր|  %I  D9B  FY  Dlu  s D D֑͑<  D  w "@R  5>  S  ]pL    FC  p*F  DՒޒQ  dR  @S @6 "@DOX  Dox "@D|@  @(#)v_delete.c 10.9 (Berkeley) 10/23/96@(#)v_ex.c 10.42 (Berkeley) 6/28/96@(#)v_increment.c 10.12 (Berkeley) 3/19/96r @(#)v_init.c 10.8 (Berkeley) 3/30/96@(#)v_itxt.c 10.16 (Berkeley) 10/23/96@(#)v_left.c 10.7 (Berkeley) 3/6/96@(#)v_mark.c 10.8 (Berkeley) 9/20/96@(#)v_match.c 10.8 (Berkeley) 3/6/96@(#)v_paragraph.c 10.7 (Berkeley) 3/6/96@(#)v_put.c 10.5 (Berkeley) 3/6/96        @(#)v_redraw.c 10.6 (Berkeley) 3/6/96@(#)v_replace.c 10.17 (Berkeley) 6/30/96           @(#)v_right.c 10.7 (Berkeley) 3/6/96@(#)v_screen.c 10.10 (Berkeley) 4/27/96@(#)v_scroll.c 10.9 (Berkeley) 4/27/96@(#)v_search.c 10.18 (Berkeley) 9/19/96@(#)v_section.c 10.7 (Berkeley) 3/6/96@(#)v_sentence.c 10.7 (Berkeley) 3/6/96k                       x b             b                 b                               @(#)v_status.c 10.9 (Berkeley) 5/15/96@(#)v_txt.c 10.87 (Berkeley) 10/13/96   E ! ! ! ! ! ! !  C  ^  ^ ^  ! ^     ^  |  "  @(#)v_ulcase.c 10.7 (Berkeley) 3/6/96@(#)v_undo.c 10.5 (Berkeley) 3/6/96@(#)v_util.c 10.11 (Berkeley) 6/30/96E E E E E E F F @(#)v_word.c 10.5 (Berkeley) 3/6/96@(#)v_xchar.c 10.9 (Berkeley) 10/23/96@(#)v_yank.c 10.9 (Berkeley) 5/19/96@(#)v_z.c 10.10 (Berkeley) 5/16/96@(#)v_zexit.c 10.6 (Berkeley) 4/27/96@(#)vi.c 10.57 (Berkeley) 10/13/96W W vZ 0Z W Z TA  ,*@k  l  l l Bl #l 7l 7l 7l 7l >l Bl $FreeBSD: src/contrib/nvi/vi/vs_line.c,v 1.5 2002/01/31 14:23:49 sheldonh Exp $@(#)vs_msg.c 10.77 (Berkeley) 10/13/96|/-\$FreeBSD: src/contrib/nvi/vi/vs_refresh.c,v 1.3 2001/07/19 11:02:11 dd Exp $ؕ@(#)vs_relative.c 10.11 (Berkeley) 5/13/96@(#)vs_smap.c 10.25 (Berkeley) 7/12/96 i i i    i @(#)vs_split.c 10.31 (Berkeley) 10/13/96smcupxterm]0;%stcgetattrsignal-resetlines=%lucolumns=%luLINEStcsetattr%s: unknown terminal typermsokil1insert linekdch1kcud1keldelete to eolkindscroll downkllgo to eolkendkhomego to solkich1insert at cursorkdl1delete linekcub1knppage downkpppage upkriscroll updelete to end of screenkcuf1kcuu1jahakalakf%dfunction key %dstderrtigetnum: colstigetnum: lines002|Line length overflow/tmp%s/vi.XXXXXXXXXX-c option243|%s: remove242|%s: remove241|%s: close240|%s: remove247|%s exists, not written249|Partial file, not written259|%s: not a regular file260|%s: not owned by you280|Unexpected quit event281|Unexpected repaint event285|Unexpected string event286|Unexpected timeout event316|Unexpected resize event287|Unexpected write event003|unable to delete line %lu006|unable to store line %lu007|unable to get last line009|Log file011|No changes to undo014|No changes to re-do015|%s/%d: log put error267|Log restartedc:eFGlRrSst:vw:window=%snview%s%.*sex/vi: 017|Mark %s: not set, %d: 020|Error: 293|added294|changed295|deleted296|joined297|moved298|shifted299|yanked300|line301|lines023|modified025|UNLOCKED026|readonly028|empty file027|line %lu of %lu [%lu%%]029|line %lu024|unmodified022|name changed021|new file317|%d files to editVI_MESSAGE_CATALOGLC_MESSAGESLANG268|confirm? [ynq]161|Press Enter to continue: 275| cont?altweraseautoindentautoprintautowritebackupbeautifycdpathceditcommentedcompatibleescapetimeerrorbellsextendedfilecflashgtagsmodehardtabsiclowerignorecasekeytimeleftrightlispmagicmatchtimemodelinemsgcatnoprintoctaloptimizeparagraphsrecdirredrawremapreportrulersearchincrsectionssecureshellmetashiftwidthshowmatchshowmodesidescrollslowopensourceanytabstoptaglengthtersetildeoptimeoutttywerasew1200w300w9600warnwindownamewraplenwrapmarginwrapscanwriteanyaibfcolimodelinesnuparaslowsmsmdttytypewawiwlwmCDPATHcdpath=%sdirectory=%sescapetime=6keytime=6matchtime=7/usr/share/vi/catalog/msgcat=%sreport=5/var/tmp/vi.recoverrecdir=%ssections=NHSHH HUnhshshell=%sshellmeta=~{[*?$`'"\shiftwidth=8sidescroll=16tabstop=8tags=%sscroll=%ldwindow=%lu036|set: %s option: %s032|Usage: %s%s="%s"%s=%ldset set %s set no%s set %s=%-3ld 054|Buffer %s is empty075|Pattern not found077|Search wrapped078|Searching...%s/vi.XXXXXX058|Preservation failed: %s060|File backup failed: %s%s/recover.XXXXXXPrecedence: bulkSubject: Nvi saved the file To: Reply-To: rootX-vi-recover-path: X-vi-recover-file: 065|Recovery file -r : on the machine was editing a file named , the user On %.24s: %s vi: no files to recover.recdir: %s/usr/sbin/sendmail071|not sending email: %s%s -t < %sscript170|Interrupted!#&*<=>@~086|Usage: %s083|Count may not be zero1bca1080|Unknown command name095|No mark name supplied096|\ not followed by / or ?$0123456789'\/?.+-^098|The %s command is unknown100|Address value underflow099|Address value overflow273|Entering ex input mode.111|No more files to edit112|No previous files to edit114|No file list to display304|Shell expansion failed119|I/O error: %svforkfdopen118|Error: execl: %s!%s 122|New current directory: %sscroll lines[line [,line]] ! command[line [,line]] # [count] [l]display numbered linesrepeat the last subsitution* [buffer]execute a buffershift lines left[line] = [flags]display line numbershift lines right@ [buffer][line] a[ppend][!]append input to a lineab[brev] [word replace]specify an input abbreviationargsar[gs]display file argument listbg!cachange lines to input!f1ocd[!] [directory]change the current directorychdirchd[ir][!] [directory]cscope!scs[cope] command [args]delete lines from the file[Ee][dit][!] [+cmd] [file]begin editing another file[Ee]x[!] [+cmd] [file]exusage[exu]sage [command]f[ile] [name]fg[Ff]g [file]globalhe[lp]display help statement[line] i[nsert][!]insert input before a linejoin!ca1join lines into a single line[line] k keymark a line position[line [,line]] m[ove] line[line] ma[rk] key!Wmap[!] [keys replace]mkexrc!f1rmkexrc[!] filewrite a .exrc file!fN[line] o[pen] [/RE/] [flags]display linesperlpe[rl] cmdperldoperld[o] cmdpre[serve][Pp]rev[ious][!][line] pu[t] [buffer]q[uit][!]exit ex/vi[line] r[ead] [!cmd | [file]]recover[!] filerecover a saved fileresizec+resize [+-]rowsrewindrew[ind][!]rtag!w1o[Rr]ta[g][!] [string]sc[ript][!] [file]run a shell in a screenwNsh[ell]sourceso[urce] fileread a file of ex commandsst[op][!]suspend the edit sessionsu[spend][!][line [,line]] t line [flags][Tt]a[g][!] [string]tagnexttagn[ext][!]move to the next tagtagpoptagp[op][!] [number | file]tagprevtagpr[ev][!]move to the previous tagtagtoptagt[op][!]discard all tagstcltc[l] cmdu[ndo]undo the most recent changeunabbreviateuna[bbrev] worddelete an abbreviation!w1runm[ap][!] wordvisual2c11[Vv]i[sual][!] [+cmd] [file]viusage[viu]sage [key]write the filewqwrite the file and exitbcacopy lines to a cut buffer3c01Add a new cscope databaseadd file | directoryShow help for cscope commandshelp [command]Kill a cscope connectionkill numberCSCOPE_DIRS :cscope.outcscope.tpath%d%s 278|No matches for querysgdct eficscope: %d lines%1[ ]%s: "%s" cscope commands: %*s: %s Command: %s (%s) %2d %s (process %lu) No cscope connections. buffersconnectionsdefault buffer123|No cut buffers to display (line mode) (character mode)********** %s%s filterparent-writerfilter read/etc/vi.exrcNEXINIT.nexrc.?!132|No input map entries133|No command map entriesabbreviate map map! 138|New exrc file: %s143|File preservedTOOBIG %6lu 147|Reading...emacs:TERMCAPEMACSError: shell: EOFError: timed out151|No command to executescript-shellpqrs0123456789abcdef%s -i; core dumped%.*s%s: received signal: %s%s%.*s%s: exited with status %dAbort trapAlarm clockBus errorChild exitedContinuedEMT trapFloating point exceptionHangupIllegal instructionInformation requestInterruptI/O possibleIOT trapKilledBroken pipeProfiling timer expiredQuitSegmentation faultSuspended (signal)Bad system callTerminatedTrace/BPT trapSuspendedStopped (tty input)Stopped (tty output)Urgent I/O conditionUser defined signal 1User defined signal 2Virtual timer expiredWindow size changesCputime limit exceededFilesize limit exceededUnknown signal: %d169|Confirm change? [n]157|No match found154|Count underflow153|Count overflow[[:>:]][[:<:]]^.[]$*([ ]|/\*([^*]|\*/)*\*/)*\^.[]$*+?()|{}RE error: %s158|No previous tag entered ... %*.*s %*.*s%2d 292|Display too small.165|The tags stack is emptyrxglobal -%s '%s'162|%s: tag not foundmunmap163|%s: corrupted tag in %sTo exit, enter ":q!" The %.*s command is unknown Command: %s Usage: %s Key:%s%s Usage: %s 167|%d more files to edit168|Buffer %s is empty174|Usage: %s%luz%c%lu%luz%c253|Writing...177|Empty file179|%s not found[count]^A[count]^B^B scroll up by screens^C[count]^D[count]^E^E scroll down by lines[count]^F^F scroll down by screens^G^G file status[count]^H^H move left by characters[count]^J^J move down by lines^L^L redraw screen[count]^M[count]^N^N move down by lines[count]^P^P move up by lines^R^R redraw screen^T^T tag pop[count]^U^U half page up (set count)^V^V input a literal character^W^W move to next screen[count]^Y^Y page up by lines^Z^Z suspend editor^[ ^\ ^\ switch to ex mode^]^] tag push cursor word^^^^ switch to previous file[count]' '[count]# +|-|# # number increment/decrement [count]$ $ move to last column % move to match & repeat substitution'['a-z][count]( ( move back sentence[count]) ) move forward sentence[count]+[count],[count]- . repeat the last command/RE[/ offset] / search forward 0 move to first character:command [| command] ... : ex command[count];[count]<[count]motion < shift lines left to motion[count]>[count]motion?RE[? offset] ? search backward@buffer @ execute buffer[count]A A append to the line[count]B B move back bigword[buffer][count]C C change to end-of-line[buffer]D D delete to end-of-line[count]E E move to end of bigword[count]F character[count]G G move to line[count]H[count]I[count]J J join lines[count]L L move to screen bottom M move to screen middle N reverse last search[count]O O insert above line[buffer]P Q switch to ex mode[count]R R replace characters[buffer][count]S S substitute for the line(s)[count]T character U Restore the current line[count]W W move to next bigword[buffer][count]X[buffer][count]Y Y copy lineZZZZ save file and exit[[[[ move back section]] move forward section ^ move to first non-blank _ move to first non-blank`[`a-z] ` move to mark[count]a a append after cursor[count]b b move back word[buffer][count]c[count]motion c change to motion[buffer][count]d[count]motion d delete to motion[count]e e move to end of word[count]f character[count]h h move left by columns[count]i i insert before cursor[count]j j move down by lines[count]k k move up by lines[count]l l move right by columnsm[a-z] m set mark n repeat last search[count]o o append after line[buffer]p[count]r character r replace character[buffer][count]s s substitute character[count]t character u undo last change[count]w w move to next word[buffer][count]x x delete character[buffer][count]y[count]motion z reposition the screen[count]{ { move back paragraph[count]| | move to column[count]} } move forward paragraph[count]~ ~ reverse case180|No previous file to edit307|No ex command to execute%+ld0X%0*lX0x%0*lx%#0*lo181|Cursor not in a numberabcdefABCDEF186|No characters to replaceUnmatched %s197|No cursor movement made209|The file is empty202|Already at end-of-file203|Already at end-of-line204|%s isn't a vi command205|Usage: %s206|No characters to delete236|Interrupted[count]~[count]motion ~ change case to motion208|No command to repeat211|Already in command mode212|Cursor not in a word235|Number larger than %lu%7lu +=+=+=+=+=+=+=+215|Append216|Change217|Command218|Insert219|Replace%lu,%lu227|The screen cannot shrink228|The screen cannot growError: move: l(%u) c(%u) o(%u)usage: ex [-eFRrSsv] [-c command] [-t tag] [-w size] [file ...] usage: vi [-eFlRrSv] [-c command] [-t tag] [-w size] [file ...] %s: %s: unknown terminal type %s: No terminal database found 016|Vi's standard input and output must be a terminal233|This terminal has no %s key046|messages not turned on: %s045|messages not turned off: %s239|%s already locked, session is read-only237|Unable to create temporary file238|Warning: %s is not a regular file244|Read-only file, not written; use ! to override245|Read-only file, not written246|%s exists, not written; use ! to override250|%s: file modified more recently than this copy; use ! to override251|%s: file modified more recently than this copy254|%s: WARNING: FILE TRUNCATED315|%s: appended: %lu lines, %lu characters257|%s: %lu lines, %lu characters256|%s: new file: %lu lines, %lu characters252|%s: write lock was unavailable248|Partial file, not written; use ! to override258|%s expanded into too many file names261|%s: accessible by a user other than the owner262|File modified since last complete write; write or use ! to override263|File modified since last complete write; write or use :edit! to override264|File modified since last complete write; write or use ! to override265|File is a temporary; exit will discard modifications266|File readonly, modifications not auto-written276|Unexpected character event277|Unexpected end-of-file event279|Unexpected interrupt event004|unable to append to line %lu005|unable to insert at line %lu008|Error: unable to retrieve line %lu/usr/src/contrib/nvi/common/log.c010|Logging not being performed, undo not possible012|Logging not being performed, undo not possible013|Logging not being performed, roll-forward not possibleonly one -c command may be specified.only one of -r and -t may be specified.only one tag file may be specified.-s option is only applicable to ex.018|Mark %s: the line was deleted019|Mark %s: cursor position no longer exists030|The file %s is not a message catalog269|Press any key to continue: 270|Press any key to continue [: to enter more ex commands]: 271|Press any key to continue [q to quit]: 031|Unable to set default %s optionparagraphs=IPLPPPQPP LIpplpipbp039|set: %s option isn't a boolean034|set: [no]%s option doesn't take a value313|set: the %s option may never be turned on291|set: the %s option may not be turned off037|set: %s option: %s: value overflow038|set: %s option: %s is an illegal number314|set: the %s option may never be set to 0035|set: %s option isn't a boolean305|No %s edit option specified033|set: no %s option: 'set all' gives all option values041|Screen columns too large, greater than %d040|Screen columns too small, less than %d043|Screen lines too large, greater than %d042|Screen lines too small, less than %d044|The lisp option is not implemented048|The paragraph option must be in two character groups049|The section option must be in two character groups053|The default buffer is empty072|File empty; nothing to search073|Reached end-of-file without finding the pattern074|No previous search pattern076|Reached top-of-file without finding the pattern056|Modifications not recoverable if the session fails055|Files with newlines in the name are unrecoverable059|Modifications not recoverable if the session fails057|Copying file for recovery...061|Copying file for recovery...063|Unable to lock recovery fileFrom: root (Nvi recovery program)%s%s %s%s %s %s %s%s %s%s %s to this file using the -r option to You can recover most, if not all, of the changes , when it was saved for recovery. %s%.24s%s%s%s%s%s%s%s%s%s%s%s%s%s%s 064|Recovery file buffer overrun062|Information on user id %u not found066|%s: malformed recovery file067|%s: malformed recovery file070|There are other files for you to recover069|There are older versions of this file for you to recover068|No files named %s, readable by you, to recover092|Ex command failed: pending commands discarded093|Ex command failed: mapped keys discarded090|@ with range running when the file/screen changed091|Global/v command running when the file/screen changed089|Flag offset past end-of-file088|Flag offset to before line 1084|%s: bad line specification085|Internal syntax table error (%s: %s)082|%s: command not available in ex mode094|The second address is smaller than the first097|Reference to a line number less than 0101|Illegal address combination103|Illegal address: the file is empty102|Illegal address: only %lu lines in the file104|The %s command doesn't permit an address of 0106|Abbreviations must end with a "word" character108|Abbreviations may not mix word/non-word characters, except at the end107|Abbreviations may not contain tabs or spaces105|No abbreviations to display109|"%s" is not an abbreviation113|No previous files to rewind115|No previous command to replace "!"116|No filename to substitute for %%117|No filename to substitute for #289|Shell expansions not supported when the secure edit option is set303|File modified since last write.120|File modified since last complete write; write or use ! to override121|Unable to find home directory locationfilter lines through commands or run commands[line [,line]] & [cgr] [count] [#lp][line [,line]] <[<...] [count] [flags][line [,line]] >[>...] [count] [flags]put a foreground screen into the background[line [,line]] c[hange][!] [count][line [,line]] co[py] line [flags]copy lines elsewhere in the filecreate a set of tags using a cscope command[line [,line]] d[elete][flags] [buffer] [count] [flags]display b[uffers] | c[onnections] | s[creens] | t[ags]display buffers, connections, screens or tagsdisplay ex command usage statementdisplay (and optionally set) file namebring a backgrounded screen into the foreground[line [,line]] g[lobal][!] [;/]RE[;/] [commands]execute a global command on lines matching an RE[line [,line]] j[oin][!] [count] [flags][line [,line]] l[ist] [count] [#]display lines in an unambiguous formmove lines elsewhere in the filemap input or commands to one or more keys[Nn][ext][!] [+cmd] [file ...]edit (and optionally specify) the next file[line [,line]] nu[mber] [count] [l]change display to number linesenter "open" mode (not implemented)[line [,line]] p[rint] [count] [#l]run the perl interpreter with the commandrun the perl interpreter with the command, on each linepreserve an edit session for recoveryedit the previous file in the file argument listappend a cut buffer to the lineappend input from a command or file to the linegrow or shrink the current screenre-edit all the files in the file argument listedit the file containing the tag[line [,line]] s [[/;]RE[/;]repl[/;] [cgr] [count] [#lp]]substitute on lines matching an REse[t] [option[=[value]]...] [nooption ...] [option? ...] [all]set options (use ":set all" to see all options)suspend editing and run a shellreturn to the previous group of tagsrun the tcl interpreter with the commanddelete an input or command map[line [,line]] v [;/]RE[;/] [commands]execute a global command on lines NOT matching an REdisplay the program version information[line] vi[sual] [-|.|+|^] [window_size] [flags]enter visual (vi) mode from ex modeedit another file (from vi mode only)display vi key usage statement[line [,line]] w[rite][!] [ !cmd | [>>] [file]][line [,line]] wn[!] [>>] [file]write the file and switch to the next file[line [,line]] wq[!] [>>] [file][line [,line]] x[it][!] [file][line [,line]] ya[nk] [buffer] [count][line] z [-|.|+|^|=] [count] [flags]display different screens of the file[line [,line]] ~ [cgr] [count] [#lp]replace previous RE with previous replacement string,Query the databases for a patternfind c|d|e|f|g|i|s|t buffer|pattern c: find callers of name d: find all function calls made from name e: find pattern f: find files with name as substring g: find definition of name i: find files #including name s: find all uses of name t: find assignments to nameDiscard all current cscope connections309|Use "cscope help" for helpcd '%s' && exec cscope -dl -f %s310|No cscope connections running311|%s: unknown search type: use one of %s%s doesn't match any cscope command 312|%d: no such cscope session124|The %s command can't be used as part of a global or v command130|%s: not sourced: writeable by a user other than the owner128|%s: not sourced: not owned by you or root129|%s: not sourced: not owned by you127|%s/%s: not sourced: writeable by a user other than the owner125|%s/%s: not sourced: not owned by you or root126|%s/%s: not sourced: not owned by you131|No following lines to join134|The %s character may not be remapped135|"%s" isn't currently mapped136|Mark names must be a single character137|%s exists, not written; use ! to override139|Destination line is inside move range140|The open command requires that the open option be set141|The open command is not yet implemented142|Preservation of this file not possible145|Only regular files and named pipes may be read146|%s: read lock was unavailable148|%s: %lu lines, %lu characters149|No background screens to display150|The script command is only available in vi mode152|shiftwidth option set to 0156|The #, l and p flags may not be combined with the c flag in vi mode155|Regular expression specified; r flag meaningless282|Already at the last tag of this group255|Already at the first tag of this group159|Less than %s entries on the tags stack; use :display t[ags]160|No file %s on the tags stack to return to; use :display t[ags]166|%s: search pattern not found164|%s: the tag's line number is past the end of the fileTo see the list of vi commands, enter ":viusage" To see the list of ex commands, enter ":exusage" For an ex command usage statement enter ":exusage [cmd]" For a vi key usage statement enter ":viusage [key]" The %s key has no current meaning 144|%s: expanded into too many file names283|The %s command requires the ex terminal interface272|That form of %s requires the ex terminal interface173|The %s command requires that a file have already been read in274|Command failed, no file read in yet.171|No previous buffer to execute172|No previous regular expression230|This screen may not be suspended290|The %s command is not supported when the secure edit option is set284|That form of %s is not supported when the secure edit option is setVersion 1.79 (10/23/96) The CSRG, University of California, Berkeley.175|The visual command requires that the open option be set---------------------------------------- 302|Vi was not loaded with a Tcl interpreter306|Vi was not loaded with a Perl interpreter178|No previous F, f, T or t search^A search forward for cursor word^C interrupt an operation (e.g. read, write, search)^D scroll down by half screens (setting count)^M move down by lines (to first non-blank)^[ exit input mode, cancel partial commands move right by columns[count]![count]motion command(s) ! filter through command(s) to motion ' move to mark (to first non-blank) + move down by lines (to first non-blank) , reverse last F, f, T or t search - move up by lines (to first non-blank) ; repeat last F, f, T or t search > shift lines right to motion F character in line backward search H move to count lines from screen top I insert before first nonblank P insert before cursor from buffer T before character in line backward search X delete character before cursor f character in line forward search p insert after cursor from buffer t before character in line forward search y copy text to motion into a cut buffer[line]z[window_size][-|.|+|^|]207|The Q command requires the ex terminal interface183|Resulting number too small182|Resulting number too large184|No match character on this line185|Matching character not found187|No other screen to switch to308|Enter to execute a command, :q to exit188|Characters after search string, line offset and/or z command189|No previous search pattern190|Search wrapped to original position192|Illegal character; quote to enter191|Abbreviation exceeded expansion limit: characters discarded193|Already at the beginning of the insert194|No more characters to erase195|Movement past the end-of-file196|Movement past the end-of-line199|Movement past the beginning of the file198|Already at the beginning of the file200|Already in the first column201|Buffers should be specified before the commandWindow resize interrupted text input mode231|Interrupted: mapped keys discarded110|Vi command failed: mapped keys discarded210|%s may not be used as a motion command234|Only one buffer may be specified214|Windows option value is too large, max is %u%d screens backgrounded; use :display to list them221|Movement past the beginning-of-screen220|Movement past the end-of-screen222|Screen must be larger than %d lines to split223|There are no background screens224|There's no background screen editing a file named %s225|You may not background your only displayed screen226|The screen can only shrink to %d rowsv v v v v v v v v D v v v R v v v  v [ v v v v v v v v v v v v v v v v v v v d v m v v v v v v v v v v v v v } ^   r          HLPRfhv: %ju:%ju -> %ju:%ju: %ju -> %juthe -R%c and -h options may not be specified togetheryou are not a member of group %s chown [-fhv] [-R [-H | -L | -P]] :group file ...usage: chown [-fhv] [-R [-H | -L | -P]] owner[:group] file ...usage: chgrp [-fhv] [-R [-H | -L | -P]] group file ...usage: chroot newroot [command] _HiStOrY_V2_ aP>^td@K   S o } a     (  7 )      unknown errorfirst event not foundlast event not foundempty listno next eventno previous eventcurrent event is invalidcan't read history from filecan't write historyhistory size negativebad parametersrequired parameter(s) not suppliedfunction not allowed with other history-functions-set the default    + + + + +     T n    6  F X        e 6 /.editrc d    @    0  h  p \ @ ,      `    $        d P     \  H h     @ D  |   T~ ~ { | }  ~  ~  ~ | 0   { h{ z (z x @z z X   ܃ } \}  | } } P Є   ́ ` DF RG` `I sJD E8 9 @ O .P>TS gTz:?6` 7 <> &U 5X=QY^r;` Z = B A RQM %N;C@HHUVeWuK@L'&@5,-%@) 04%#@5.C1Of(w3/2@$* *+=LDa{   ` #0 =@NWi"/>Q`v!   `(<L\z `%-15s-> %s 1 ' ""   !,-5/"""""""""""""""""""""""""""""""$""""""""""""""""""""""""#&"0"""""."""""4"%""""""""#&"0""""".""""""4"%"""""""B=   !A;""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" "" """   !"A""""/""" """ """"""L"RZK"""Q"7I: UH""@""NG"PTWY"D"""" ""6J9<>C"? "M"F"OSVX"E"""""8""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""    F        T      ,    8  f y   c d " u C% C% C% C% C% C% C% C% % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % $ $ % % 6% "% % % % % % % % % % % % ,% % % % % , , , - ], -, , , I, y, fwdbck?  @ ?  @ ?  @  @  @  @  @  @  @  @  @  @  @  @  @  @  @  @  @  @  @  @  @  @  @  @  @  @  @  @  @  @  @  @  @ ? ?  36)C^S'h|,P}-g.&58JM_buxx~x ۿ (&w<Qg|KRN0u-u )? [1~[4~OAOBOCODOHOF%s %d i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i i V]@dkrV@]@dk raV@]dkr = =,A"'B" """"y @  @ @")4?yFMSY`g@n@v ~ (s9o! @+s @{u?*?_-.[]~=telltcsettcechotcsettyedit: Bad value `%s'. ^Dvi-paste-nextvi-paste-prevvi-prev-space-wordvi-prev-wordVi move to the previous wordvi-next-space-wordvi-next-wordVi move to the next wordvi-change-casevi-change-metaVi change prefix commandvi-insert-at-bolvi-replace-charvi-replace-modeVi enter replace modevi-substitute-charvi-substitute-lineVi substitute entire linevi-change-to-eolVi change to end of linevi-insertVi enter insert modevi-addvi-add-at-eolvi-delete-metaVi delete prefix commandvi-end-wordvi-to-end-wordvi-undoVi undo last changevi-undo-lineVi undo all changesvi-command-modevi-zerovi-delete-prev-charvi-list-or-eofvi-kill-line-prevvi-search-prevVi search history previousvi-search-nextVi search history nextvi-repeat-search-nextvi-repeat-search-prevvi-next-charvi-prev-charvi-to-next-charvi-to-prev-charvi-repeat-next-charvi-repeat-prev-charem-delete-or-listem-delete-next-wordem-yankem-kill-lineem-kill-regionem-copy-regionem-gosmacs-trasposeem-next-wordem-upper-caseem-capitol-caseem-lower-caseem-set-markSet the mark at cursorem-exchange-markExchange the cursor and markem-universal-argumentem-meta-nextem-toggle-overwriteem-copy-prev-wordCopy current word to cursorem-inc-search-nextEmacs incremental next searchem-inc-search-preved-end-of-fileIndicate end of fileAdd character to the lineed-delete-prev-worded-delete-next-charDelete character under cursored-kill-lineCut to the end of lineed-move-to-ended-move-to-beged-transpose-charsed-next-chared-prev-worded-prev-chared-quoted-inserted-digited-argument-digitDigit that starts argumented-unassignedIndicates unbound charactered-tty-sigintTty interrupt charactered-tty-dsuspTty delayed suspend charactered-tty-flush-outputTty flush output charactersed-tty-sigquitTty quit charactered-tty-sigtstpTty suspend charactered-tty-stop-outputed-tty-start-outputTty allow output charactersed-newlineExecute commanded-delete-prev-chared-clear-screened-redisplayRedisplay everythinged-start-overed-sequence-lead-ined-prev-historyed-next-historyMove to the next history lineed-search-prev-historyed-search-next-historyed-prev-lineMove up one lineed-next-lineMove down one lineed-commandEditline extended command%d %sUnbound extended key "%s" "%s..." ""[]no input%s -> %s %-15s-> is undefined %-4s to %-7s-> %s %-15s-> %s Standard key bindings Alternative key bindings Multi-character bindings Arrow key bindings %s: Invalid switch `%c'. %s: Invalid command `%s'. *[]?add new blank lineblaudible bellclear to bottomclear to end of linecursor to horiz posclear screendelete a characterdelete a linestart delete modeend delete modeeiend insert modecursor from status linehome cursorinsert characterstart insert modeinsert paddingkdsends cursor downklsends cursor leftkrsends cursor rightkusends cursor upbegin boldend attributesnon destructive spaceend standoutbegin standoutcursor to status linecursor up onebegin underlineend underlinevbvisible belldelete multiple charscursor down multipleinsert multiple charscursor left multipleRIcursor right multiplecursor up multiplekhsend cursor home@7send cursor endhas automatic marginshas physical tabsNumber of linesNumber of columnskmHas meta keyTab chars destructivexnOut of termcap string space. Your terminal has the following characteristics: It has %s meta key not It can%suse tabs hasdoes not have It %s automatic margins It %s magic margins (empty) %25s (%s) == %s settc: Bad value `%s'. baudechotc: Bad value `%s'. iflag:oflag:cflag:lflag:chars:ignbrkbrkintignparparmrkinpckistripinlcrigncricrnlixonixanyixoffimaxbelopostonlcrocrnlonocronoeotonlretxtabscignorecstopbcreadparenbparoddhupclclocalccts_oflowcrts_iflowmdmbuficanonechoeechokechonlnoflshtostopechoctlechoprtechokeflushopendiniextennokerninfoextproceol2erase2discardmin%s: Unknown switch `%c'. %*s%c%s %s: Invalid argument `%s'. Vi paste previous deletion to the right of the cursorVi paste previous deletion to the left of the cursorVi move to the previous space delimited wordVi move to the next space delimited wordVi change case of character under the cursor and advance one characterVi enter insert mode at the beginning of lineVi replace character under the cursor with the next character typedVi replace character under the cursor and enter insert modeVi enter insert mode after the cursorVi enter insert mode at end of lineVi move to the end of the current space delimited wordVi move to the end of the current wordVi enter command mode (use alternative key bindings)Vi move to the beginning of lineVi move to previous character (backspace)Vi list choices for completion or indicate end of file if empty lineVi cut from beginning of line to cursorVi repeat current search in the same search directionVi repeat current search in the opposite search directionVi move to the character specified nextVi move to the character specified previousVi move up to the character specified nextVi move up to the character specified previousVi repeat current character search in the same search directionVi repeat current character search in the opposite search directionDelete character under cursor or list completions if at end of lineCut from cursor to end of current wordPaste cut buffer at cursor positionCut the entire line and save in cut bufferCut area between mark and cursor and save in cut bufferCopy area between mark and cursor to cut bufferExchange the two characters before the cursorMove next to end of current wordUppercase the characters from cursor to end of current wordCapitalize the characters from cursor to end of current wordLowercase the characters from cursor to end of current wordUniversal argument (argument times 4)Add 8th bit to next character typedSwitch from insert to overwrite mode or vice versaEmacs incremental reverse searchDelete from beginning of current word to cursorMove cursor to the end of lineMove cursor to the beginning of lineExchange the character to the left of the cursor with the one under itMove to the right one characterMove to the beginning of the current wordMove to the left one characterAdd the next character typed verbatimAdds to argument or enters a digitTty disallow output charactersDelete the character to the left of the cursorClear screen leaving current line at the topErase current line and start from scratchFirst character in a bound sequenceMove to the previous history lineSearch previous in history for a line matching the currentSearch next in history for a line matching the currentkey_add: Null extended-key not allowed. key_add: sequence-lead-in command not allowed key_delete: Null extended-key not allowed. Some extended keys too long for internal print buffer%s: Invalid \ or ^ in instring. %s: Invalid \ or ^ in outstring. newline ignored at right marginCannot read termcap database; No entry for terminal type "%s"; using dumb terminal settings. It has %d columns and %d lines echotc: Termcap parameter `%s' not found. echotc: Warning: unknown termcap %% `%c'. echotc: Warning: Extra argument `%s'. echotc: Warning: Too many required arguments (%d). echotc: Bad value `%s' for cols. echotc: Warning: Missing argument. echotc: Bad value `%s' for rows. T 3 , Ȉ D 3 T , Ȉ  3   Ȉ  3 3 P @ t   , Ȉ  3 3 ,   create geomdestroy geomattachdetachcreate providerdestroy providerinsert geomeliminate geomconfig geom*INVALID*Dump of gctl request at NULL error: "%s" error: NULL param: "%s" [%s%s%d] = "%s"%d] = 0] = %pCould not allocate memoryInvalid requestNULL request pointer/dev/geom.ctlDump of gctl %s request at %p: can't allocate %u bytes: %sexec file name too longbad flags arg/dev/mem/dev/kmeminvalid address (%x)kvm_readshort readkvm_write%s: not physical memory devicekvm_write not implemented for dead kernelscannot allocate vmkernbasebad namelistcannot read IdlePTDcannot read PTDvatop called in live kernel!_kvm_vatop: lseek_kvm_vatop: readڜ                                     ]         "                      ؝                                     {         m %03d(R((?YE(*tE(u((y (((S(((1((((((((,v-,NO-uy0uѢV65(())){m ) )))))))")%)()+).)1)4)7):)=)16;qF3Dne^)'@)gAqPC)$- F) I)q!x~L),O)R)U)ۿvqX)xP 4}[)^)i,-g.a)nd)g)j)m)5p)s)v)y)|))))))))))))J)))_)))u/O)wnn))))))))) (,w)D|)K))))pv|qH9v \u?)[))))))))+)*** * *******!*$*'***-*0*3*6*9*<*?*B*E*H*K*N*Q*T*W*Z*]*`*c*f*i*l*o*r*u*x*{*~************.****y**********************jM**=**p+MT**++.+ +++++++ +#+&+)+,+/+2+5+8+;+>+A+D+G+J+M+ P+S+V+Y+XM\+_+b+e+h+k+n+nq+t+w+z+}++++++++++++d++++++++++++++++++++++++++++++++,,, , ,,,,,,,",%,(,+,.,1,14,7,auy}G+:,=,@,C,F,I,L,O,0,($R,U,X,[,^,a,d,g,j,m,p,s,]"@TY^chmrw|v,bwxbxshcdamimshzxonxHCNRNPhlYAYBYCYDYEYFYGNllhlwMWCoNCYaYbYcYdYeYfYgYhYiYjYkYlYmYnBTYoYpCCCMvshdtimhmkmraei1i3kbkCktkDkLkMkEkSk0k1k;k2k3k4k5k6k7k8k9kIkAkHkNkPkFkRkTl0l3l4l5l6l7l8l9monwSFSRpkpxpfpouciPK1K3K2K4K5pOrPkBSXRXSARAXNXFeALOLF@1@2@3@4@5@6@8@9@0%1%2%3%4%5%6%7%8%9%0&1&2&3&4&5&6&7&8&9&0*1*2*3*4*5*6*7*8*9*0#1#2#3#4%a%b%e%f%g%h%j!1!2!3RFF1F3F4F5F6F7F8F9FAFBFCFEFGFHFIFJFKFMFNFPFQFUFVFWFXFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFrcbMCMLMRLfDKCWWGHUQDTOPUfhPAWAu0u2u3u4u5u6u7u8u9IcIpSfSbZAZBZCZDZFZGZHZIZJZKZLZMZNZOZPZQZRZSZTZUZVZWZXZYZaZbZcZdZeZfZgZhZiZjZkZlZmZnZoZpZqZrZsZtZuZvZwZxZyKmMiRQGmdvciXyZzYvYwYxYyYzYZS5S6S7S8XhXlXoXrXtXvsAsLbxNCURSES_NO_PADDINGCOLORFGBG[3%p1%dm[3%?%p1%{8}%>%t9%e%p1%d%;m[4%p1%dm[4%?%p1%{8}%>%t9%e%p1%d%;m.& 3% M% y% % %  Ax2d2d2dJ2d<2d,2d2d  7 8 8 8 8 7 7 8 8 7 7 8 7 8 7 8 8 8 8 8 8 8 8 8 8 8 8 7 7 7 8 8 7 8 8 8 8 8 8 8 8 8 8 8 8 8 7 7 8 8 8 8 8 8 8 7 8 8 8 8 8 7 8 8 8 8 7 7 8 8 7 8 7 8 8 7 7 8 7 7 8 8 7 8 8 8 8 7 8 8 7 7 8 7 ZB C C C K9 ? H< C C = < C O= C  > C C C C C C C C C C C C A A A C C ? C C C C C C C C C C C C C Q? h; C C C C C C C 9 C C C C C @ C C C C 9 9 C C  < C B C C 9 > C 9 ; C C \: C C C C 9 C C < N@ C B E D D E D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D Out of memoryNCURSES_NO_SETBUF'%s': unknown terminal type. TERM environment variable not set. TERM environment must be <= %d characters. Not enough memory to create terminal structure. terminals database is inaccessible '%s': I need something more specific. '%s': I can't handle hardcopy terminals. @(#)termcap.c 8.1 (Berkeley) 6/4/93TERMPATH/usr/share/misc/termcap|:.termcap /usr/share/misc/termcapName collision between %sresolution of use=%s failedmeta_on but no meta_offmeta_off but no meta_onprtr_off but no prtr_onprtr_on but no prtr_offlabel_off but no label_onterminal names must start with letter or digitexit_standout_mode but no enter_standout_modeenter_standout_mode but no exit_standout_modeexit_underline_mode but no enter_underline_modeenter_underline_mode but no exit_underline_mode``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~exit_alt_charset_mode but no enter_alt_charset_modeenter_alt_charset_mode but no exit_alt_charset_modeenter_alt_charset_mode but no acs_charsexit_alt_charset_mode but no acs_charsenter_blink_mode but no exit_attribute_modeenter_bold_mode but no exit_attribute_modeenter_ca_mode but no exit_ca_modeexit_ca_mode but no enter_ca_modeexit_delete_mode but no enter_delete_modeenter_delete_mode but no exit_delete_modeenter_dim_mode but no exit_attribute_modeexit_insert_mode but no enter_insert_modeenter_insert_mode but no exit_insert_modeenter_secure_mode but no exit_attribute_modeenter_protected_mode but no exit_attribute_modeenter_reverse_mode but no exit_attribute_modeto_status_line but no from_status_linefrom_status_line but no to_status_linerestore_cursor but no save_cursorsave_cursor but no restore_cursorexit_xon_mode but no enter_xon_modeenter_xon_mode but no exit_xon_modeexit_am_mode but no enter_am_modeenter_am_mode but no exit_am_moderemove_clock but no display_clockdisplay_clock but no remove_clockset_color_pair but no initialize_pair/usr/share/misc/terminfoTERMINFO%c/%.*sTERMINFO_DIRSmqFoF)r^ntFe nunAqnyFNn-^nFnn]F F? n  Entry does not start with terminal names in column one%s (%s termcap extension) aliased to %s%s (%s terminfo extension) aliased to %swrong type used for %s capability '%s'%s (%s termcap extension) ignored%s (%s terminfo extension) ignoredhardware tabs with a width other than 8: %dhardware tabs with a non-^I tab string %sunknown capability `%.*s' in ko stringko translation table is invalid, I give up%s (%s) already has an explicit value %s, ignoring koacsc string synthesized from XENIX capabilitiesacsc string synthesized from AIX capabilitiesprimary namealias%s `%.*s' may be too longextended capability '%s'unknown capability '%s'numericbooleanunknown token typekcbtkclrkrmirkICkentkhts%s$<%d>no value for ko capability %s%s/.terminfo@%&*!# K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K K A K K K K K K K K K K K K K F K K K K K K K K K K  K K K K K K K K K K K K K K K K K K K K K K 7 K < K K  # K K  - K K K K K  K  K K K  ( 2 premature EOFempty longname field$[]!*?no value given for `%s'Missing separatorIllegal character - %sIllegal ^ character - %sAllow ^? as synonym for \177Premature EOFIllegal character (expected alphanumeric or %s) - %swhitespace in name or alias fieldslashes aren't allowed in names or aliasesdubious character `%c' in name or alias fieldSeparator inconsistent with syntaxMissing separator after `%s', have %sNon-octal digit `%c' in \ sequenceIllegal character %s in \ sequenceVery long string found. Missing separator?Can't backspace off beginning of line(R48<YE(*t E ( u {F AyF (hLQV[aekosw| !"#$oyʼnѢ6( )    G.œȜΜҜ؜ܜ DpFNDP  2 In   nnn# nvn)I)-3m9>BG M!7"ٿ#R$W%[&a'0(f)zF*m+k,s-4.p/t0x1;|2Li,3_n4m5g.678tF9b: n;un<n=yF>n?r@ABCDEFG=HIJKNnL^nMmNnO;nPnQnRnS(nT7nUiFVnWQXYƝZʝ[Ν\ӝ]ם^!۝_ߝ`abc^defghYijklmonopqrs3tuvw x`y$z({,|~qH}~vPBW!r0)[4:>BFJNSW\oF`flqv{6InFFÞȞ͞ҞLמܞP e"'+/49>CHM FRHW\afkpuz+ğɟΟӟ ؟!ݟ"#$%&()* +,-./#0(-22374<5A6F7K8P9U:Z_<d=i>n?s@xA}BCD F G H I OLŠˠ%Р֠AڠbLWn+n q+!t+"w+#z+$}+%+&+'+()*+,-.E/0 1 2345 6&7+8/95::;@<NE=K>Q?U@[A`BdCjDpoEuF{GHIJK5LM/NOPQRSTšUˡVѡWסXܡYZ[X\]^|_`a b[cy=defW#g)h/i4j9k>lCmHnmMoRpXq^rdsjtouwv}wxytz{|}R~Ǣ͢Ԣڢ!%& '"#  %(*)/$4%9&>CH*M+RW\afkpuz<yaW,a,XU`Q0TOp_h^\L\Ss)?v)@y)A|)B)C)D)E)F)G)H)I)J)KL)M)NJO)P)Q)R_S)T)U)VuW/XOY)Zwn[n\#])^)_)`)a)b)c)d)efx)g h(i,jwkl)mDno|po)qKr)st)uv)w)xypzv{||qH}~9v \u?)[))))))))%+)*u** * **~*****!*$*'***-*0*3*t6*9*a<*m?*B*E*dH* K*N*vQ*`T*W*WZ*]*`*c*f*i*l*o*r*u*x*{*~************.****y**z****.*'***X*(***/***5*6*7*8*9*:jM;*<*==>*?*@p+AMBTD*E*++.+ +++++++ +^#+&+)+,+/+2+5+ 8+ ;+ >+ A+ D+G+J+M+ P+S+V+Y+XM\+_+b+e+h+k+n+n q+!t+"w+#z+$}+%+&+'+()*+++,-+.+/+0+1+2+3d4+50+6+7+8+9+:+;+<+=+>+?+@+A+B+C+Dg+E+Fh+G+HI+J+K+L+M+N+O+P+Q+R+S+T+U,V,W,X ,Y ,Z,[,\,],^,_,`",a%,b(,c+,d.,e1,fgh1i4,j7,kalumCyn}oG+pUq:,r=,s@,tC,uF,vI,wL,xO,y0z,{(|$}eR,~fU,gX,h[,i^,a,d,g,j,m,p,s,!,%&v-'"#]"(,)1$6%;&@{N*O+TY^chmrw|v,~t|̇,TxxvDvwĆ}d8yx{s{0Lx8z{$văPdv8vtxhL8|ttss{́4tT܆Ѐ|d}Ds${@}Xz@$u,|P|sywPv,hvx~~ xwxv0 x}\І4}@p~| XwvԈ؇`yȂsvdw}|w spDypz{<ЉzDtyzЃpt|z,y`tvz܉s{0u؁@t`<Ȉ܀xPsxptԂtD0$xr }8lxt~{~| {<X}}@hL~y@z|,l|}s8s(| Py|DLy u vyPyz |X܃\x|{lss4 Ltlĉx|twwPz~|h|0{{yHp}D(|~|tHxstu}tX~ yl{|8{$8x(y|vr}v4,\y{wsXz4w,vw}},sTx4z\y{\|wvtrrzd(}}p(tHL}Āy<{hXtx(x\vH{ \l~~v $ԅyhvXPy4dr5UaU)P$-O)**jM*R)O) X)qP$-m)))ģ)b+)-*KuǣʣͣУУӣ֣٣ܣߣ6*EO))****+*+ >CHM"oF(/xsbxhpxenlmsgresloknxonmc5ichtsnrrmcnpcndscrcccbcehlsxhpacrxmdaisyxvpasamcpixlpixxmcwslnlabwnumncvbufszspinvspinhmaddrmjumpmcsnpinsorcorlorhiorvicpswidcsbtnsbitwinbitypecsrcmdchcivismrcupcnormcvvisdslsmacsblinksmdcdimsmirinvisprotsmulechrmacssgr0rmdcrmulfslis1is2is3kbsktbckctabkf0kf1kf10kf2kf3kf4kf5kf6kf7kf8kf9rmkxsmkxlf0lf1lf10lf2lf3lf4lf5lf6lf7lf8lf9rmmsmmpadindnrinpfkeypflocpfxmc0mc4mc5rs1rs2rs3tsliprogka1ka3kb2kc1kc3mc5prmpacscplnsmxonrmxonsmamrmamxoncxoffcenacssmlnrmlnkbegkcankclokcmdkcpykcrtkextkfndkhlpkmrkkmsgkmovknxtkopnkprvkprtkrdokrefkrfrkrplkrstkresksavkspdkundkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkFNDkHLPkHOMkLFTkMSGkMOVkNXTkOPTkPRVkPRTkRDOkRPLkRITkRESkSAVkSPDkUNDrfikf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63el1mgcsmglsmgrflnsclkdclkrmclkcwinwingohupqdialpulsewaitinitcinitpscpsetfsetbcpilpichrcvrdefcswidmsdrfqsitmslmsmicmsnlqsnrmqsshmssubmssupmsumrwidmritmrlmrmicmrshmrsubmrsupmrummhpamcud1mcub1mcuf1mvpamcuu1pordermcudmcubmcufmcuuscssmgbsmgbpsmglpsmgrpsmgtsmgtpsbimscsdrbimrcsdsubcssupcsdocrzeromcsnmkmousreqmpgetmsetafsetabpfxldevtcsins0dss1dss2dss3dssmglrsmgtbbirepbinelbicrcolornmdefbiendbisetcolorslinesdispcsmpchrmpchsmscrmscpctrmscescscesaehhlmelhlmelohlmerhlmethlmevhlmsgr1slengthOTi2OTrsOTugOTbsOTnsOTncOTdCOTdNOTnlOTbcOTMTOTNLOTdBOTdTOTknOTkoOTmaOTptOTxrOTG2OTG3OTG1OTG4OTGROTGLOTGUOTGDOTGHOTGVOTGCmemlmemubox1BOAT&TCICVXSEEXENIXGSCFCOHMLDPNPSG6G7G8GrGuGdGhGvGcGGkqIBMIRISKATekKBKCKDKEKFBCfont0font1font2font3kbtabksel      u           S            S                                t  :  i   F     #        F  F  F F F F F F F F F F F F F                                                                 x                string too complex to convertI'm confused%'%{string may not be optimal%Pa%ga%{96}%^%{127}%^saw %%r twice in %ssaw %%m twice in %ssaw %%n twice in %s%{10}%/%{16}%*%{10}%m%+%{2}%*%-%?%>%t%+%;%/%+%c%-%c%2d%3d%\$</>\%03o%>%%?%%{%d}%%>%%t%%{%d}%%+%%;%%?%%{%d}%%>%%t%%'%c'%%+%%;%%?%%'%c'%%>%%t%%{%d}%%+%%;%%?%%'%c'%%>%%t%%'%c'%%+%%;%B%%{%d}%%+%%c%%'%c'%%+%%c%D%ndoxX.%.%runknown %% code %s (%#x) in %sw҉W-Fakˊ +Bc|s͋3AE֕uqR;vIaC\ Mc_E.bM1Aa`̊>cw +5 v@y|mv}d/xP(y4_iOR C4 pzya]9Vpʇx  !$'*-0369<?BEHKNQTWZ\^`bdfhjlnprtvxz|~­ĭƭȭʭ̭έЭҭԭ֭حڭܭޭ  ^@^K^O^Q^S^X^[^_`~@~A~B~C~D~E~F~G~H~I~J~K~L~M~N~O~P~Q~R~S~T~U~V~W~X~Y~Z~[~\~]~^~_\%03lo(null)(cancelled), line %d, col %d, terminal '%s'2Kn,X   `  %K(R48<YE(*tE(u{FAyF (hLQV[aekosw| %*HMܾ!2?KIYlyɿ޿(6BYdu /GXl~oyʼnѢ6()GœȜΜҜ؜ܜ/49ʼn (8CM\l}'2AI]lpFNDP 2nnnn# nvn)I)-3m9>BGM7ٿRW[a0fzFmks4ptx|i,_nmg.tF nunnyFnrNn^nmn;nnnn(nnFnƝʝΝӝם۝ߝYo `$(,qHvPBW!r0)[4:>BFJNSW\oF`flqv{InFÞȞ͞ҞLמܞ "'+/49>CHMFRW\afkpuzğɟΟӟ؟ݟ #(-27<AFKPUZ_dinsx}ŠˠР֠AڠbLWn+nq+t+w+z+}++++   &+/5:@EKQU[`djou{šˡѡסܡ y=#)/49>CHMRX^djow}Ǣ͢Ԣڢ >CRW\afkpuz>~'9HT`q}b)9GYhz 1BUiv $,4<CJRY`gnu| #*18?FM44d9T]n54 '5CN ]ixt !+4CQ_lz(5#,5ANXao{!+5?IQ[hr|&.6>FNV^fnv~&.6>FNV^fnv~)0;bFQ]gmsy+;KWm&8M_r .>N_m}&8Mds(5CQbt !5HXhy"0CWo} auto_left_marginno_esc_ctlcceol_standout_glitcheat_newline_glitcherase_overstrikegeneric_typehard_copyhas_status_lineinsert_null_glitchmemory_abovememory_belowmove_insert_modemove_standout_modeover_strikestatus_line_esc_okdest_tabs_magic_smsotilde_glitchtransparent_underlineneeds_xon_xoffprtr_silenthard_cursornon_rev_rmcupno_pad_charnon_dest_scroll_regioncan_changeback_color_erasehue_lightness_saturationcol_addr_glitchcr_cancels_micro_modehas_print_wheelrow_addr_glitchsemi_auto_right_margincpi_changes_reslpi_changes_resbackspaces_with_bscrt_no_scrollingno_correctly_working_crgnu_has_meta_keylinefeed_is_newlinehas_hardware_tabsreturn_does_clr_eolinit_tabslines_of_memorymagic_cookie_glitchpadding_baud_ratevirtual_terminalwidth_status_linenum_labelslabel_heightlabel_widthmax_attributesmaximum_windowsmax_colorsmax_pairsno_color_videobuffer_capacitydot_vert_spacingdot_horz_spacingmax_micro_addressmax_micro_jumpmicro_col_sizemicro_line_sizenumber_of_pinsoutput_res_charoutput_res_lineoutput_res_horz_inchoutput_res_vert_inchprint_ratewide_char_sizebuttonsbit_image_entwiningbit_image_typemagic_cookie_glitch_ulcarriage_return_delaynew_line_delaybackspace_delayhorizontal_tab_delaynumber_of_function_keysback_tabchange_scroll_regionclear_all_tabsclear_screenclr_eoscommand_charactercursor_addresscursor_downcursor_homecursor_invisiblecursor_leftcursor_mem_addresscursor_normalcursor_rightcursor_to_llcursor_upcursor_visibledelete_characterdis_status_linedown_half_lineenter_alt_charset_modeenter_blink_modeenter_bold_modeenter_ca_modeenter_delete_modeenter_dim_modeenter_insert_modeenter_secure_modeenter_protected_modeenter_reverse_modeenter_standout_modeenter_underline_modeerase_charsexit_alt_charset_modeexit_attribute_modeexit_ca_modeexit_delete_modeexit_insert_modeexit_standout_modeexit_underline_modeflash_screenform_feedfrom_status_lineinit_1stringinit_2stringinit_3stringinit_fileinsert_characterinsert_paddingkey_backspacekey_catabkey_clearkey_ctabkey_dckey_dlkey_downkey_eickey_eolkey_eoskey_f0key_f1key_f10key_f2key_f3key_f4key_f5key_f6key_f7key_f8key_f9key_homekey_ickey_ilkey_leftkey_llkey_npagekey_ppagekey_rightkey_sfkey_srkey_stabkey_upkeypad_localkeypad_xmitlab_f0lab_f1lab_f10lab_f2lab_f3lab_f4lab_f5lab_f6lab_f7lab_f8lab_f9parm_dchparm_delete_lineparm_down_cursorparm_ichparm_indexparm_insert_lineparm_left_cursorparm_right_cursorparm_rindexparm_up_cursorpkey_keypkey_localpkey_xmitprint_screenrepeat_charreset_1stringreset_2stringreset_3stringreset_filerestore_cursorsave_cursorscroll_forwardscroll_reverseset_attributesset_tabset_windowto_status_lineunderline_charup_half_lineinit_progkey_a1key_a3key_b2key_c1key_c3prtr_nonchar_paddingacs_charsplab_normkey_btabenter_xon_modeexit_xon_modeenter_am_modeexit_am_modexon_characterxoff_characterena_acslabel_offkey_begkey_cancelkey_closekey_commandkey_copykey_createkey_endkey_enterkey_exitkey_findkey_helpkey_markkey_messagekey_movekey_nextkey_openkey_optionskey_previouskey_printkey_redokey_referencekey_refreshkey_replacekey_restartkey_resumekey_savekey_suspendkey_undokey_sbegkey_scancelkey_scommandkey_scopykey_screatekey_sdckey_sdlkey_selectkey_sendkey_seolkey_sexitkey_sfindkey_shelpkey_shomekey_sickey_sleftkey_smessagekey_smovekey_snextkey_soptionskey_spreviouskey_sprintkey_sredokey_sreplacekey_srightkey_srsumekey_ssavekey_ssuspendkey_sundoreq_for_inputkey_f11key_f12key_f13key_f14key_f15key_f16key_f17key_f18key_f19key_f20key_f21key_f22key_f23key_f24key_f25key_f26key_f27key_f28key_f29key_f30key_f31key_f32key_f33key_f34key_f35key_f36key_f37key_f38key_f39key_f40key_f41key_f42key_f43key_f44key_f45key_f46key_f47key_f48key_f49key_f50key_f51key_f52key_f53key_f54key_f55key_f56key_f57key_f58key_f59key_f60key_f61key_f62key_f63clr_bolclear_marginsset_left_marginset_right_marginlabel_formatset_clockdisplay_clockremove_clockcreate_windowgoto_windowhangupdial_phonequick_dialflash_hookfixed_pausewait_toneuser0user1user2user3user4user5user6user7user8user9orig_pairorig_colorsinitialize_colorinitialize_pairset_color_pairset_foregroundset_backgroundchange_char_pitchchange_line_pitchchange_res_horzchange_res_vertdefine_charenter_doublewide_modeenter_draft_qualityenter_italics_modeenter_leftward_modeenter_micro_modeenter_near_letter_qualityenter_normal_qualityenter_shadow_modeenter_subscript_modeenter_superscript_modeenter_upward_modeexit_doublewide_modeexit_italics_modeexit_leftward_modeexit_micro_modeexit_shadow_modeexit_subscript_modeexit_superscript_modeexit_upward_modemicro_column_addressmicro_downmicro_leftmicro_rightmicro_row_addressmicro_uporder_of_pinsparm_down_microparm_left_microparm_right_microparm_up_microselect_char_setset_bottom_marginset_bottom_margin_parmset_left_margin_parmset_right_margin_parmset_top_marginset_top_margin_parmstart_bit_imagestart_char_set_defstop_bit_imagestop_char_set_defsubscript_characterssuperscript_charactersthese_cause_crzero_motionchar_set_nameskey_mousemouse_inforeq_mouse_posget_mouseset_a_foregroundset_a_backgroundpkey_plabdevice_typecode_set_initset0_des_seqset1_des_seqset2_des_seqset3_des_seqset_lr_marginset_tb_marginbit_image_repeatbit_image_newlinebit_image_carriage_returncolor_namesdefine_bit_image_regionend_bit_image_regionset_color_bandset_page_lengthdisplay_pc_charenter_pc_charset_modeexit_pc_charset_modeenter_scancode_modeexit_scancode_modepc_term_optionsscancode_escapealt_scancode_escenter_horizontal_hl_modeenter_left_hl_modeenter_low_hl_modeenter_right_hl_modeenter_top_hl_modeenter_vertical_hl_modeset_a_attributesset_pglen_inchtermcap_init2termcap_resetlinefeed_if_not_lfbackspace_if_not_bsother_non_function_keysarrow_key_mapacs_ulcorneracs_llcorneracs_urcorneracs_lrcorneracs_lteeacs_rteeacs_bteeacs_tteeacs_hlineacs_vlineacs_plusmemory_lockmemory_unlockbox_chars_1invalid hostname/var/log/wtmp\\#0123456789%s: illegal option -- %c %s: option requires an argument -- %c 9                                     9      S                       f g ) 9 v         X      |  |           f  Q Q   f     :   0   S       %m/%d/%y%Y-%m-%d%H:%M%H:%M:%Sshut up gccREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEtrailing backslash (\)REG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTREG_EMPTYempty (sub)expressionREG_ASSERTREG_INVARGREG_0x%xrepetition-operator operand invalid"can't happen" -- you found a buginvalid argument to regex routine*** unknown regexp error code ***Z [ [ [ 3Z [ [ [ [ [ ([ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ Q[ \[ [ Z [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ z[ [ j :k k k Tl l m bm m n |n n s s s s |t |t |t |t |t t s t |t |t |t |t |t |t Ct Zt alnumcntrlpunctupperxdigitNULSOHSTXETXEOTENQBELalertBSHTVTvertical-tabform-feedcarriage-returnSODC1DC2DC3DC4NAKSYNETBEMSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfivesixsevenninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL/etc/mac.confdefault_file_labels# default_ifnet_labelsdefault_process_labels.=security.mac..enabledsecurity.macRSHrcmd: getaddrinfo: %s rcmd: socket: %s connect to address %s: rcmd: too many files rcmd: accept: %s rcmd: %s: %s /etc/hosts.equiv/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts ownerrcmd: socket: All ports in use rcmd: write (setting up stderr): %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup socket: protocol failure in circuit setup. .rhosts writeable by other than owner ] m }           Ȣ Ȣ Ȣ Ȣ Ȣ Ȣ Ȣ Ӣ Ӣ Ӣ Ӣ Ӣ Ӣ Ӣ Ӣ Ӣ Ӣ Ӣ Ӣ ޢ ޢ ޢ ޢ ޢ ޢ ޢ ޢ ޢ ޢ ޢ ޢ          ' 4 A  ISO_EUCja_JPeucJPko_KReucKRzh_CNeucCNPOSIXUS-ASCII         ̦   ئ                     0%X 0 ڪ   % S ~ ʪ                          ʪ            a a a a a a a a              ª        t               Y                           /var/run/dev.dbnosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenosunlnknosunlinknosnapshotnouappndnouappendnouchgnouchangenouimmutablenodumpnoopaquenouunlnknouunlink ,D֠G9UMRV!Z^cmg[kpuzz=DK1irڅH 0<@Z_RdxąΆ Signal 0abrtemtfpebussegvsysurgcontchldttinttouioxcpuxfszvtalrmprofwinchusr1usr2@               T        T      T  4 L BLOCKSIZE%s: unknown blocksizemaximum blocksize is %ldGminimum blocksize is 512%ld%s-blocks/boot/kernel/kernel/etc/fstabPATH_FSTABfstab: /etc/disktabremovablesimulateddtsukern.devname#%c:%d:0x%x#%c:%d:0x%d_COMPAT_FreeBSD_4/etc/compat-FreeBSD-4-util@(#)strftime.c 7.38< < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < <  < < < < < < < < < < < < < < < < < < < < < =T`gt< < < < $< < Cm`)J< < < < < < v>< `v< < < Vq%04d%e-%b-%Y/usr/bin/rshrcmdsh: unknown user: %s rcmdsh: getaddrinfo: %s rcmdsh: socketpairrcmdsh: fork failedrcmdsh: dup2 failedrcmdsh: setuid(%u): %s rcmdsh: execlp %s failed: %s rcmdsh: fork to lose parent failedP+-+&+B+;+4+I+LC_ALLLC_MONETARYLC_NUMERICLC_TIMEPATH_LOCALE/usr/share/localecs^[yY]^[nN]o????~????????y??????t??????????????o????~????????y??????t?%s.db5E5EpE5E5E5E5EED5E5E5EE5E5E5E5E5E5E5EpE5E5E5E5E5EE5E5E5E5E5E5E5E5E5E5E5E5E5E5E5E5E5E5E5E5E5E5E5E5E5E5E5E5E5E5E5E5E5E5E5EpEpE/usr/bin:/binexecvp: : path too long  &08AJNRVZ^bfmt|L &08Ax~JanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturday%a %b %e %H:%M:%S %YPM%a %b %e %H:%M:%S %Z %Y%I:%M:%S %p/LC_CTYPENONEUTF2UTF-8BIG5MSKanjiRuneMagiImSm]mdmkmrmymmmmmmmmmmmInternal ypbind errorDomain not boundUnknown ypbind error: #%d /var/yp/binding%s/%s.%dclnttcp_createclntudp_createfcntl: F_SETFDyp_match: clnt_callyp_first: clnt_callyp_next: clnt_callclnttcp_create failedyp_all: clnt_callyp_order: clnt_callyp_master: clnt_callyp_maplist: clnt_callRequest arguments badRPC failureNo such key in mapYP server errorCan't communicate with ypbindCan't communicate with ypservLocal domain name not setServer data base is badAccess violationDatabase is busyYP unknown error %d System resource allocation failureYP: server for domain %s not responding, retrying Can't bind to server which serves this domainNo such map in server's domainLocal resource allocation failureNo more records in map databaseCan't communicate with portmapperYP server version mismatch - server can't supply service.clnt_sperrorqqqiqiqqqqqqqqqqqqqqclnt_perror,CRl `clnt_spcreateerrorssssssssssssssTssssclnt_pcreateerrorRd~rpch != NULL; errno = %s; why = ; s1 = %u, s2 = %uRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Unknown protocolRPC: (unknown error code) - Authentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)/usr/src/lib/libc/rpc/clnt_perror.c(unknown authentication error - %d); low version = %u, high version = %uRPC: Incompatible versions of RPCRPC: Server can't decode argumentsRPC: Failed (unspecified error)?yOD0?yOD0?yOD0?yOxt?ܝyOxt?ܝyOxt?ܝt0Ddnsnissetpwentendpwentgetpwent_rgetpwnam_rgetpwuid_r/etc/spwd.db/etc/pwd.dbVERSIONpasswd-%ldmaster.passwd.by%spasswd.adjunct.byname##passwd_compatUnsupported password database version %dgetpwent memory allocation failure/etc/netgroup%s.%s%s.**.%s*.*netgroup.byusernetgroup.byhost, ?yOt`?,yOt`?,yOt`?,yOt?PyOt?PyOt?Pt`setgrentendgrentgetgrent_rgetgrnam_rgetgrgid_r/etc/groupgroup-%ldgroup.bygidgroup.bynamegroup_compatgetgrent memory allocation failurePW_SCAN_BIG_IDSno uid for user %s%s > max uid value (%lu)%s uid is incorrectroot uid should be 0no gid for user %s%s > max gid value (%lu)%s gid is incorrectwarning, unknown root shellcorrupted entry%s > recommended max uid value (%u)%s > recommended max gid value (%u)'pyO/bin/csh/etc/shellsshells-XXXXXshells-%dinitshellsHESIOD_CONFIG/etc/hesiod.confHES_DOMAINrhs-extensionlhsrhsclassesstringlist: %m^ppppppppppppppppppppppppppppppppppppppppppppp||||||||||pppppppppFpppppApppppppppppppppppppMMpp|^p #ppp2YxMMMfMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM                                             ؗҜ<3#I9=D2[%Cod(@?A5?55?5?/LC_COLLATE1.0 1.1 __collate_substitute__collate_strdupCould not get %s transportloopbacksvc%s_create: could not open connection<pmap_getportaddress != NULL/usr/src/lib/libc/rpc/pmap_getport.cnetpathclnt_raw_callclntraw_create - Fatal header serialization error./usr/src/lib/libc/rpc/clnt_raw.cinetcould not close() fd %d; mem & fd leakclnt_dg_create: out of memoryGhFFFFFGGGG[GeGzGGGG+GGGGGsunrpcff02::202datagram_nclnt_bcast: cannot sendbroadcast packetclnt_bcast: Cannot send broadcast packetclnt_bcast: Cannot receive reply to broadcastauthunix_marshalauthunix_validateauthunix_refreshauthunix_destroymarshal_new_authauthunix_create: out of memory/usr/src/lib/libc/rpc/auth_unix.cauth_none.c - Fatal marshalling problemauth != NULLxdrs != NULLverf != NULLxdr_callmsgcmsg != NULL/usr/src/lib/libc/rpc/rpc_callmsg.cpmap_rmtcallxdr_rmtcall_argsxdr_rmtcallresaddr != NULLport_ptr != NULLcap != NULLcrp != NULL/usr/src/lib/libc/rpc/pmap_rmt.cxdr_pmapregs != NULL/usr/src/lib/libc/rpc/pmap_prot.c%s : %sclnt_vc_createread_vcout of memoryclnt_vc_createclnt_vc_callclnt_vc_geterrclnt_vc_freeresclnt_vc_control@zlyyy@z@zyy@z@zyyyzz,z@zclnt_vc_destroyvc_cv == (cond_t *) NULLvc_cv != (cond_t *) NULLcl != NULLerrp != NULL/usr/src/lib/libc/rpc/clnt_vc.cxdr_authunix_parms/usr/src/lib/libc/rpc/authunix_prot.cauthnone_marshal/usr/src/lib/libc/rpc/auth_none.cxdr_reference: out of memorypDĆ@dxdrrec_create: out of memoryDxHЏ<HЏ(<xdr_array: out of memory i uuЕ``N\xecircuit_vdatagram_vcircuit_nudp6tcp6inet6unix%s.%u.%urpc: failed to open /etc/netconfigxdr_opaque_authxdr_des_blockxdr_accepted_replyKWxdr_rejected_replyĠxdr_replymsgxdr_callhdraccepted0 (rejected_seterr_replyuuuuuuVauiuuuuuuuublkp != NULLar != NULLrr != NULLrmsg != NULLerror != NULL/usr/src/lib/libc/rpc/rpc_prot.cxdr_bytes: out of memoryxdr_string: out of memoryNETPATH ); Netconfig database not foundNot enough memoryNot initialized/etc/netconfigin /etc/netconfig. or run mergemaster(8). Continuing in 10 seconds tpi_cots_ordtpi_cotstpi_cltstpi_rawNetconfig database has invalid formatNetid not found in netconfig databaseThe local transport is called "unix" Please change this to "local" manually See UPDATING entry 20021216 for details. This warning will be removed 20030301 Unknown network selection errorres_send: %s ([%s].%s): %s res_send: %s: %s ;; res_send() kqueuesocket(vc)connect/vcwrite failedread failed;; response truncated read(vc);; old answer (unexpected): socket(dg)connect(dg)sendtos out-of-boundskevent;; timeout recvfrom;; undersized: %d ;; old answer: ;; not our server: ;; wrong query name: server rejected query: ;; truncated answer ;; got answer: ;; Querying server (# %d) address = %s yOyO\$yO8# 0123456789abcdefghbynameghbyaddr/etc/hostsip6.arpaip6.int;; res_query(%s, %d, %d) ;; res_query: mkquery failed;; res_query: send error;; rcode = %d, ancount=%d HOSTALIASES;; res_querydomain(%s, %s, %d, %d) ;; res_mkquery(%d, %s, %d, %d) /&LOCALDOMAIN/etc/resolv.confdomainnameserversortlistRES_OPTIONSenvndots:;; ndots=%d ;; debuginsecure1insecure2no_tld_queryedns0;; res_setoptions("%s", "%s")... ;; res_setoptions("%s", "%s").. uuuyOyO1p-3gethostby*.getanswer: asked for "%s", got "%s""7.77 7.7.7Invalid value for ai_flagsai_family not supportedMemory allocation failureai_socktype not supportedInvalid value for hintsResolved protocol is unknownUnknown errorgetaddrinfoGAIhosts.bynameipnodes.byname;; rcode = %u, ancount=%u ;; res_querydomain(%s, %s) Address family for hostname not supportedTemporary failure in name resolutionNon-recoverable failure in name resolutionNo address associated with hostnamehostname nor servname provided, or not knownservname not supported for ai_socktypeSystem error returned in errnogethostby*.getanswer: asked for "%s %s %s", got type "%s"%d/%sservices.byportservices.byname/etc/services,/)E) .&)-)7)B)G)T)7)I[)g))))))))))) J+)  ), ** **=+*?*B*Q*U*4Z*m*s**********0 **}***,**+b,+- +@-!++".+3+O+T+n+`+s+`-y++#++ +WWWWWWWWWWWWWWLWWWWLWWWWWWWWWWWWWWWWWWWWWWWWWWWWLWWWWLWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW;; res options:;; ns_parserr: %s ;; %s SECTION: ;; %s, type = %s, class = %s ;; ns_sprintrr: %s ;; ns_initparse: %s ; flags: qr aa tc rd ra ?? ad cd; %s: %d, %s: %dCHAOSHESIODANSWERAUTHORITYADDITIONALZONEPREREQUISITEUPDATEname servermail destination (deprecated)MFmail forwarder (deprecated)CNAMEcanonical nameSOAstart of authorityMBmailboxMGmail group membermail renameWKSdomain name pointerHINFOhost informationmailbox informationMXmail exchangerTXTtextresponsible personAFSDBDCE or AFS serverX25X25 addressISDNISDN addressrouterNSAPnsap addressNSAP_PTRsignatureKEYPXmapping informationGPOSAAAAIPv6 addresslocationEIDNIMLOCSRVserver selectionATMAATM address (unimplemented)IXFRincremental zone transferAXFRMAILBMAILAmail agent (deprecated)NAPTRURN Naming Authority"any"defnamusevcaaonly(unimpl)igntcprimry(unimpl)recursdnsrchstyopnnoaliasesno-tld-query?0x%lx?%ld.%.2ld;; ->>HEADER<<- opcode: %s, status: %s, id: %d well-known service (deprecated)geographical position (withdrawn)next valid name (unimplemented)endpoint identifier (unimplemented)NIMROD locator (unimplemented)mailbox-related data (deprecated); error: unknown LOC RR version%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %smIQUERYCQUERYMCQUERYUNOTIFYZONEINITZONEREFNOERRORFORMERRSERVFAILNXDOMAINNOTIMPREFUSEDYXDOMAINYXRRSETNXRRSETNOTAUTHZONEERRNOCHANGEPREREQUISITESdsaldsdslbllldsllb3lhi3lhhbhidso-n`hdsiirdsdskds+jaddlen@ ( ; serial ; refresh ; retry ; expiry ); minimum %u %u %u %u ( 0x%04x %u %u %s %d %lu unknown RR typeRR format error\#( ; %s%02x ; "\len <= *buflen/usr/src/lib/libc/net/ns_print.cABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=Assertion failed: (%s), file %s, line %d. Assertion failed: (%s), function %s, file %s, line %d. HHHHHHHHHHHHHHHنyOvector_appendnss_load_modulenss_method_lookup/etc/nsswitch.confnss_%s.so.%dnss_module_registerNSSWITCH(%s): %s, %sNSSWITCH(%s): memory allocation failureNSSWITCH(%s): %s, registration failedNSSWITCH(%s): %s, %s, %s, not foundhosts.byaddr           !#$%&'()*+,-./0123456789:;<=>?@ACDEFGHJKMOQSS    DEAE216+-.99+&%/ /E!()*!!# E:::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::;<;53210/-,+*)('&%$#"!  ::::::::::::::::::::::::?IS]gq{KXvNSSWITCH(nslexer): memory allocation failurefatal flex scanner internal error--no action foundfatal flex scanner internal error--end of buffer missedinput buffer overflow, can't enlarge buffer because scanner uses REJECTout of dynamic memory in yy_create_buffer()out of dynamic memory in yy_scan_buffer()out of dynamic memory in yy_scan_bytes()NSSWITCH(nslexer): %s line %d: %s at '%s'input in flex scanner failedbad buffer in yy_scan_bytes() ( ((((((((( (((((((((((( (((( ((((((((((((((((((((((((((( 01234567890123456789abcdef0123456789ABCDEF[inet_ntoa error]syslog: unknown facility/priority: %x%.15s [%d]/dev/console/var/run/log/dev/logUnknown error: GMTmn/etc/localtime/usr/share/zoneinfoposixrulesTZSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec%.3s %.3s%3d %02d:%02d:%02d %d %u.%u.%u.%uDHHHHIHHIIIIIIIIIIIIIIunionfsTlT\|dlt||||||||/usr/bin:/bin:/usr/sbin:/sbin:%$sniglet^&%s/bt.XXXXXXXXXX0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz/dev/urandomLLL{LhLULBL/LLOMBM5M(MM ML0123456789abcdef0123456789ABCDEFLlhh^lhhhmhhglmhwmmho"o"o"o"o"o"o"o"o"ohhhhhhhhh.pqcssshhhhohhxhhh~{h|hh~hhhhhhhhhh5pqcsssoqohohSwx{ph{p|hhhpčĎĎĎĎĎĎĎĎĎ^nnrb%nr=FrrRrkkrrnanNANinfINFdTdTddT8d8 66$ +InfinityNaN?aCoc?`(?yPD?@@0$0000 0000000h}-<2ZGUD?mpool_new: page allocation overflow. 7yACnF?O8M20HwZNUNgN{NNNNNNNN O`SO-Os!; "D "NQSTYW_Xkme`r\   8(9P<q<<   qq@Bʚ;Ƥ~@P.dv@Xy@MDMIMQMVM[MaMgMmMtM{MMMMMcMMMMMMMMMMMXyMMfNMMMcMcMcMcM/tmp/EdDk.XXXXXXXXXXunknown  k^M`M M!M"M#M````` da @d )a>aCaCa@YaPcaQcaRfaVaaac`ddaeaua@a@JqWqdqlqrqyq@q qqKq q@qqq qqqh2qqVrRrCsMsxq4rfqnqtqq{qq@Xsq q@qqq=s@r>sr@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. CsMsxq4rfqnqtqq{qq@Xsq q@qqqrvvvvvCsMsxq4rfqnqtqq{qq@Xsq q@qqqr>sr yy!y##.|-E-EԹ Ssend account command to remote serverappend to a fileset ascii transfer typebeep when command completedset binary transfer typetoggle mget upper/lower case id mappingchange remote working directorychange remote working directory to parent directorychange file permissions of remote fileconnect to remote ftp servertoggle carriage return stripping on ascii getstoggle/set debugging modedelete remote fileterminate ftp sessionexecute macrotoggle command line editingtoggle use of EPSV/EPRT on IPv4 ftpshow FEATures supported by remote systemset file transfer formattoggle gate-ftp; specify host[:port] to change proxytoggle metacharacter expansion of local file namestoggle printing `#' marks; specify number to set sizeprint local help informationget (set) idle timer on remote sidechange local working directoryview a local file through your pagerprint local working directorylist contents of remote pathdefine a macrodelete multiple filesget multiple filesget multiple files restarting at end of local fileget files using a localfile as a source of namesmake directory on the remote machinelist contents of multiple remote directorieslist contents of remote directory in a machine parsable formlist remote path in a machine parsable formset file transfer modeshow last modification time of remote filesend multiple filesget file if remote file is newer than local file set templates for default file name mappingset translation table for default file name mappingshow or set options for remote commandsview a remote file through your pagerenter passive transfer modelist contents of remote path through your pagerlist contents of remote directory in a machine parsable form through your pagertoggle use of PORT/LPRT cmd for each data connectiontoggle preservation of modification time of retrieved filestoggle transfer progress meterforce interactive prompting on multiple commandsissue command on alternate connectionprint working directory on remote machineterminate ftp session and exitsend arbitrary ftp commandset transfer rate limit (in bytes/second)receive fileget file restarting at end of local fileget help from remote serverrename fileclear queued command repliesrestart file transfer at bytecountremove directory on the remote machineshow status of remote machinetoggle store unique for local filessend one fileset or display optionsescape to the shellsend site specific command to remote server Try "rhelp site" or "site help" for more informationshow size of remote fileshow current statusset file transfer structuretoggle store unique on remote machineshow remote system typeset tenex file transfer typetoggle packet tracingset file transfer typeget (set) umask on remote sideunset an optionshow command usagesend new user informationtoggle verbose modeset socket send/receive buffer sizeihKxvjTU4-|-,>ψ>E+S V)`OC`Ro|"TD WOSBiDq,G|"Ty>T^Sj_8), `@) 3B>@R+_D g_ fŌN,Gb>;E0BI-%6&kOBI#@,Gk,d gк }.&@6 }. e,Gn`X W   gFR],G,G",G(`4B'PU@@}dTDU4-@dN9S1P``Ah7 3'2<k)EqF*QSaD)WS/PJ~eR ^ݿDU4-Z 6@R /icQN5d`Ah9h,o@^dOf;bԹ~J,w`> S)R j|"LQ<@`AhMc& |vqa6=H g.Trw@   Mc!??Aq=6=;=@>@@EC@ )@BLlAc@hn@?\s? `@.  `McAA`a%,TDU@ss N`w9Zss o`!u {`"J2YHuJ'HyaHxH~HyHHHHHH#H"H+@HI4GMc?I !`!!NMc?N"MR"R#,S@#ESݿ ^S{#SOMc?Oconnect to a siteclose current connectionforcibly logout remote user and close the connectionexit telnetprint status informationprint help informationtransmit special characters ('send ?' for more)set operating parameters ('set ?' for more)unset operating parameters ('unset ?' for more)toggle operating parameters ('toggle ?' for more)change state of special charaters ('slc ?' for more)display operating parameterssuspend telnetcompute response to OPIE challengeinvoke a subshellchange environment variables ('environ ?' for more)try to enter line or character mode ('mode ?' for more)oNqNWuI@VI:V :V9Nݿ@; D;FgTxB@$O9LMOMcc(9deprecated command -- use 'toggle crmod' insteaddeprecated command -- use 'set escape' insteadcaKhILx""""kpvL z~NMw  !(3GN\jx'qR.vpkNM۔47=CIMQV[agmrvz(standard output)/etc/gettytab\^:   }) 0/dev/ptyXX#@(#)history.c 8.1 (Berkeley) 6/4/93? :@(#)tokenizer.c 8.1 (Berkeley) 6/4/93 ,9@GWht  $FreeBSD: src/lib/msun/src/s_ilogb.c,v 1.7 2002/05/28 17:51:46 alfred Exp $ 8S \]^7ba_`c8V9Mdefg:U;J<H=>LhW?O@NiAB CD  !"#$%E &'()*+,-./F 0123456789G :;<=>?@ABCH D E F GIJKjkLMKNIOP[lmcnoQRpqRSrZstuvwxSyz{|}~TPUQVTW f=%%p%c%%{10}%%/%%{16}%%*%%p%c%%{10}%%m%%+@(#) Copyright (c) 1994 Powerdog Industries. All rights reserved.@(#)strptime.c 0.1 (Powerdog) 94/03/27 0;S_v   /: R[ ]hr@Nacs    t * d     s  SM #M'+=/@a 3!D"S#_$k%x&'()*+,--..|//x012345678 9:;<*=6>H?V@d[x\\]^^__`{{|}}1~7/dev/x  #  Xy@MDMIMQMVM[MaMgMmMtM{MMMMMcMMMMMMMMMMMXyMMfNMMMcMcMcMcM8 8 8 8 8 8 8 8 8 8 D D 8 8 8 8 \ \ 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 P P 8 8 8 8 a rCCCCCCC DЈ8Ċ  545! " `"  "" #!`#/!G!d! d'@Bʚ;Mc.-...T);vIaCO?[.&...6.>.G.P.W._.h.p.x..?[.B).T)7)x   @ PH0123456789@(#)localtime.c 7.57WILDABBR@(#)asctime.c 7.7RuneMagiNONEBBBBB@(((((((((((((((          (((((((    ((((((    ((((  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~L 0000000000000000@ÿ?}@ pp  KKK L<@(#)rec_seq.c 8.3 (Berkeley) 7/14/94_hashXXXXXXoo.shstrtab.init.text.fini.rodata.data.eh_frame.ctors.dtors.jcr.bss.note.ABI-tag  ښYT %pj +Z5Z<ZCZH[  M[[ ...! . .." fixit_crunch" cat"chmod" cp" dd" df"echo"expr"kill" ln" ls"mkdir" mv" rm"rmdir"sleep"sync"bsdlabel%"clri"dmesg"fdisk"mknod"mount" mount_cd9660" mount_msdosfs"reboot"restore"swapon"umount" disklabel%"rrestore%" ftp"telnet" vi"view" ex"chown"chroot"chgrp# . ..$group9%spwd.db& protocolsx'servicesx# $FreeBSD: src/etc/group,v 1.28 2003/04/27 05:49:53 imp Exp $ # wheel:*:0:root daemon:*:1: kmem:*:2: sys:*:3: tty:*:4: operator:*:5:root mail:*:6: bin:*:7: news:*:8: man:*:9: games:*:13: staff:*:20: sshd:*:22: smmsp:*:25: mailnull:*:26: guest:*:31: bind:*:53: uucp:*:66: dialer:*:68: network:*:69: www:*:80: nogroup:*:65533: nobody:*:65534: ( . ..)share) .( ..*misc* .) ..+ scsi_modes    ( 0 8 PX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx ip 0 IP icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ipencap 4 IP-ENCAP st2 5 ST2 tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc 10 BBN-RCC-MON nvp 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP sep 33 SEP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPV6 sdrp 42 SDRP ipv6-route 43 IPV6-ROUTE ipv6-frag 44 IPV6-FRAG idrp 45 IDRP rsvp 46 RSVP gre 47 GRE mhrp 48 MHRP bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPV6-ICMP ipv6-nonxt 59 IPV6-NONXT ipv6-opts 60 IPV6-OPTS cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospf 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP st 118 ST srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC divert 258 DIVERT 08@\>@ <   \>2VJ@  [> [>\>@ @@@<@TU \>  S,0\>A[>[>\>  'rA\>\>\>  %m'd]s>s>\>h p x 8 *XA[>\>\> 0)V[>[>\> t~[>[>\>   ( 0 8 @ H P PQ|}[>[>\> ,0#[>[>\>  #IA[>\>\>  A[>\>\> qgmA[>\>\> T0$[>[>\>X ` *G"}# # Network services, Internet style # # Stripped-down version. # # $FreeBSD: src/release/fixit.services,v 1.4 1999/08/28 01:33:10 peter Exp $ # # WELL KNOWN PORT NUMBERS # echo 7/tcp echo 7/udp discard 9/tcp sink null discard 9/udp sink null systat 11/tcp users #Active Users systat 11/udp users #Active Users daytime 13/tcp daytime 13/udp chargen 19/tcp ttytst source #Character Generator chargen 19/udp ttytst source #Character Generator ftp-data 20/tcp #File Transfer [Default Data] ftp-data 20/udp #File Transfer [Default Data] ftp 21/tcp #File Transfer [Control] ftp 21/udp #File Transfer [Control] ssh 22/tcp #Secure Shell Login ssh 22/udp #Secure Shell Login telnet 23/tcp telnet 23/udp # 24/tcp any private mail system # 24/udp any private mail system smtp 25/tcp mail #Simple Mail Transfer smtp 25/udp mail #Simple Mail Transfer time 37/tcp timserver time 37/udp timserver domain 53/tcp #Domain Name Server domain 53/udp #Domain Name Server bootps 67/tcp dhcps #Bootstrap Protocol Server bootps 67/udp dhcps #Bootstrap Protocol Server bootpc 68/tcp dhcpc #Bootstrap Protocol Client bootpc 68/udp dhcpc #Bootstrap Protocol Client tftp 69/tcp #Trivial File Transfer tftp 69/udp #Trivial File Transfer gopher 70/tcp gopher 70/udp finger 79/tcp finger 79/udp http 80/tcp www www-http #World Wide Web HTTP http 80/udp www www-http #World Wide Web HTTP sunrpc 111/tcp rpcbind #SUN Remote Procedure Call sunrpc 111/udp rpcbind #SUN Remote Procedure Call auth 113/tcp ident tap #Authentication Service auth 113/udp ident tap #Authentication Service nntp 119/tcp usenet #Network News Transfer Protocol nntp 119/udp usenet #Network News Transfer Protocol rmt 411/tcp #Remote MT Protocol rmt 411/udp #Remote MT Protocol https 443/tcp https 443/udp # # Berkeley-specific services # exec 512/tcp #remote process execution; # authentication performed using # passwords and UNIX loppgin names biff 512/udp comsat #used by mail system to notify users # of new mail received; currently # receives messages only from # processes on the same machine login 513/tcp #remote login a la telnet; # automatic authentication performed # based on priviledged port numbers # and distributed data bases which # identify "authentication domains" who 513/udp whod #maintains data bases showing who's # logged in to machines on a local # net and the load average of the # machine cmd 514/tcp shell #like exec, but automatic # authentication is performed as for # login server syslog 514/udp printer 515/tcp spooler printer 515/udp spooler talk 517/tcp #like tenex link, but across # machine - unfortunately, doesn't # use link protocol (this is actually # just a rendezvous port from which a # tcp connection is established) talk 517/udp #like tenex link, but across # machine - unfortunately, doesn't # use link protocol (this is actually # just a rendezvous port from which a # tcp connection is established) ntalk 518/tcp ntalk 518/udp utime 519/tcp unixtime utime 519/udp unixtime efs 520/tcp #extended file name server router 520/udp route routed #local routing process (on site); # uses variant of Xerox NS routing # information protocol uucp 540/tcp uucpd uucp 540/udp uucpd uucp-rlogin 541/tcp uucp-rlogin 541/udp klogin 543/tcp # Kerberos (v4/v5) klogin 543/udp # Kerberos (v4/v5) kshell 544/tcp krcmd # Kerberos (v4/v5) kshell 544/udp krcmd # Kerberos (v4/v5) a  kn}JE RM | w , ' nobody*Unprivileged user/nonexistent/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologinCpop*DPost Office Owner/nonexistent/sbin/nologin1poppop*DPost Office Owner/nonexistent/sbin/nologinApopbind*55Bind Sandbox//sbin/nologin35bind*55Bind Sandbox//sbin/nologin2bind*55Bind Sandbox//sbin/nologinC5bind*55Bind Sandbox//sbin/nologinBkmem*KMem Sandbox//sbin/nologin3kmem*KMem Sandbox//sbin/nologinCtty*Tty Sandbox//sbin/nologin2tty*Tty Sandbox//sbin/nologinB61$ b < b uucp*BBUUCP pseudo-user/var/spool/uucppublic/usr/libexec/uucp/uucico2uucp*BBUUCP pseudo-user/var/spool/uucppublic/usr/libexec/uucp/uucicoBsmmsp*Sendmail Submission User/var/spool/clientmqueue/sbin/nologin1smmspsmmsp*Sendmail Submission User/var/spool/clientmqueue/sbin/nologinAsmmspsshd*Secure Shell Daemon/var/empty/sbin/nologin3sshd*Secure Shell Daemon/var/empty/sbin/nologinCkmem*KMem Sandbox//sbin/nologin2kmem*KMem Sandbox//sbin/nologinBhd-)XS  q l $ $ pop*DPost Office Owner/nonexistent/sbin/nologin2pop*DPost Office Owner/nonexistent/sbin/nologinBgames* Games pseudo-user/usr/games/sbin/nologin3games* Games pseudo-user/usr/games/sbin/nologin2games* Games pseudo-user/usr/games/sbin/nologinCgames* Games pseudo-user/usr/games/sbin/nologinBtty*Tty Sandbox//sbin/nologin1ttytty*Tty Sandbox//sbin/nologinAttybin*Binaries Commands and Source//sbin/nologin1binbin*Binaries Commands and Source//sbin/nologinAbin UP`[  R M  d _   ~ www*PPWorld Wide Web Owner/nonexistent/sbin/nologin3Pwww*PPWorld Wide Web Owner/nonexistent/sbin/nologin2www*PPWorld Wide Web Owner/nonexistent/sbin/nologinCPwww*PPWorld Wide Web Owner/nonexistent/sbin/nologinBsshd*Secure Shell Daemon/var/empty/sbin/nologin1sshdsshd*Secure Shell Daemon/var/empty/sbin/nologinAsshdnews*News Subsystem//sbin/nologin3news*News Subsystem//sbin/nologin2 news*News Subsystem//sbin/nologinCnews*News Subsystem//sbin/nologinB kmem*KMem Sandbox//sbin/nologin1kmemkmem*KMem Sandbox//sbin/nologinAkmemrootCharlie &/root/bin/csh3rootCharlie &/root/bin/csh2rootCharlie &/root/bin/cshCrootCharlie &/root/bin/cshB},':5 = 8 : 3 Z nobody*Unprivileged user/nonexistent/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin1nobodynobody*Unprivileged user/nonexistent/sbin/nologinBnobody*Unprivileged user/nonexistent/sbin/nologinAnobodysmmsp*Sendmail Submission User/var/spool/clientmqueue/sbin/nologin3smmsp*Sendmail Submission User/var/spool/clientmqueue/sbin/nologinCman* Mister Man Pages/usr/share/man/sbin/nologin3 man* Mister Man Pages/usr/share/man/sbin/nologin2 man* Mister Man Pages/usr/share/man/sbin/nologinC man* Mister Man Pages/usr/share/man/sbin/nologinB daemon*Owner of many system processes/root/sbin/nologin3daemon*Owner of many system processes/root/sbin/nologinCtoor*Bourne-again Superuser/root2toor*Bourne-again Superuser/rootB*FAYR i d + " ^ Z  u p   ^ Y uucp*BBUUCP pseudo-user/var/spool/uucppublic/usr/libexec/uucp/uucico3Buucp*BBUUCP pseudo-user/var/spool/uucppublic/usr/libexec/uucp/uucicoCBmailnull*Sendmail Default User/var/spool/mqueue/sbin/nologin3mailnull*Sendmail Default User/var/spool/mqueue/sbin/nologinCsshd*Secure Shell Daemon/var/empty/sbin/nologin2 sshd*Secure Shell Daemon/var/empty/sbin/nologinB man* Mister Man Pages/usr/share/man/sbin/nologin1manman* Mister Man Pages/usr/share/man/sbin/nologinAmanoperator*System &//sbin/nologin3operator*System &//sbin/nologin1operatoroperator*System &//sbin/nologinCoperator*System &//sbin/nologinAoperatordaemon*Owner of many system processes/root/sbin/nologin2daemon*Owner of many system processes/root/sbin/nologin1daemondaemon*Owner of many system processes/root/sbin/nologinBdaemon*Owner of many system processes/root/sbin/nologinAdaemontoor*Bourne-again Superuser/root1toortoor*Bourne-again Superuser/rootAtoorrootCharlie &/root/bin/csh1rootrootCharlie &/root/bin/cshArootVERSION 72NI  m h  / *  { 0 0 www*PPWorld Wide Web Owner/nonexistent/sbin/nologin1wwwwww*PPWorld Wide Web Owner/nonexistent/sbin/nologinAwwwuucp*BBUUCP pseudo-user/var/spool/uucppublic/usr/libexec/uucp/uucico1uucpuucp*BBUUCP pseudo-user/var/spool/uucppublic/usr/libexec/uucp/uucicoAuucpbind*55Bind Sandbox//sbin/nologin1bindbind*55Bind Sandbox//sbin/nologinAbindsmmsp*Sendmail Submission User/var/spool/clientmqueue/sbin/nologin2 smmsp*Sendmail Submission User/var/spool/clientmqueue/sbin/nologinB news*News Subsystem//sbin/nologin1newsnews*News Subsystem//sbin/nologinAnewsgames* Games pseudo-user/usr/games/sbin/nologin1gamesgames* Games pseudo-user/usr/games/sbin/nologinAgamesbin*Binaries Commands and Source//sbin/nologin3bin*Binaries Commands and Source//sbin/nologinCoperator*System &//sbin/nologin2operator*System &//sbin/nologinBfa*%4+ z u - ( pop*DPost Office Owner/nonexistent/sbin/nologin3Dpop*DPost Office Owner/nonexistent/sbin/nologinCDmailnull*Sendmail Default User/var/spool/mqueue/sbin/nologin2 mailnull*Sendmail Default User/var/spool/mqueue/sbin/nologin1mailnullmailnull*Sendmail Default User/var/spool/mqueue/sbin/nologinB mailnull*Sendmail Default User/var/spool/mqueue/sbin/nologinAmailnulltty*Tty Sandbox//sbin/nologin3tty*Tty Sandbox//sbin/nologinCbin*Binaries Commands and Source//sbin/nologin2bin*Binaries Commands and Source//sbin/nologinB 0x0a "Control Mode Page" { {Reserved} *t7 {RLEC} t1 {Queue Algorithm Modifier} t4 {Reserved} *t2 {QErr} t1 {DQue} t1 {EECA} t1 {Reserved} *t4 {RAENP} t1 {UAAENP} t1 {EAENP} t1 {Reserved} *i1 {Ready AEN Holdoff Period} i2 } 0x02 "Disconnect-Reconnect Page" { {Buffer Full Ratio} i1 {Buffer Empty Ratio} i1 {Bus Inactivity Limit} i2 {Disconnect Time Limit} i2 {Connect Time Limit} i2 {Maximum Burst Size} i2 {Reserved} *t6 {DTDC} t2 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 } 0x09 "Peripheral Device Page" { {Interface Identifier} i2 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 } 0x1a "Power Control" { {Reserved} *i1 {Reserved} *t6 {Idle} t1 {Standby} t1 {Idle Condition Timer} i4 {Standby Condition Timer} i4 } 0x08 "Caching Page" { {IC} t1 {ABPF} t1 {CAP} t1 {DISC} t1 {SIZE} t1 {WCE} t1 {MF} t1 {RCD} t1 {Demand Retention Priority} t4 {Write Retention Priority} t4 {Disable Pre-fetch Transfer Length} i2 {Minimum Pre-fetch} i2 {Maximum Pre-fetch} i2 {Maximum Pre-fetch Ceiling} i2 } 0x05 "Flexible Disk Page" { {Transfer rate} i2 {Number of heads} i1 {Sectors per track} i1 {Data bytes per sector} i2 {Number of cylinders} i2 {Starting cylinder-write precompensation} i2 {Starting cylinder-reduced write current} i2 {Drive step rate} i2 {Drive step pulse width} i1 {Head settle delay} i2 {Motor on delay} i1 {Motor off delay} i1 {TRDY} t1 {SSN} t1 {MO} t1 {Reserved} *t5 {Reserved} *t4 {SPC} t4 {Write Compensation} i1 {Head load delay} i1 {Head unload delay} i1 {Pin 34} t4 {Pin 2} t4 {Pin 4} t4 {Pin 1} t4 {Medium rotation rate} i2 {Reserved} *i1 {Reserved} *i1 } 0x03 "Format Device Page" { {Tracks per Zone} i2 {Alternate Sectors per Zone} i2 {Alternate Tracks per Zone} i2 {Alternate Tracks per Logical Unit} i2 {Sectors per Track} i2 {Data Bytes per Physical Sector} i2 {Interleave} i2 {Track Skew Factor} i2 {Cylinder Skew Factor} i2 {SSEC} t1 {HSEC} t1 {RMB} t1 {SURF} t1 {Reserved} *t4 } 0x0b "Medium Types Supported Page" { {Reserved} *i1 {Reserved} *i1 {Medium type one supported} i1 {Medium type two supported} i1 {Medium type three supported} i1 {Medium type four supported} i1 } 0x0c "Notch and Partition Page"; 0x01 "Read-Write Error Recovery Page" { {AWRE (Auto Write Reallocation Enbld)} t1 {ARRE (Auto Read Reallocation Enbld)} t1 {TB (Transfer Block)} t1 {RC (Read Continuous)} t1 {EER (Enable Early Recovery)} t1 {PER (Post Error)} t1 {DTE (Disable Transfer on Error)} t1 {DCR (Disable Correction)} t1 {Read Retry Count} i1 {Correction Span} i1 {Head Offset Count} i1 {Data Strobe Offset Count} i1 {Reserved} *i1 {Write Retry Count} i1 {Reserved} *i1 {Recovery Time Limit} i2 } 0x04 "Rigid Disk Drive Geometry Page" { {Number of Cylinders} i3 {Number of Heads} i1 {Starting Cylinder-Write Precompensation} i3 {Starting Cylinder-Reduced Write Current} i3 {Drive Step Rate} i2 {Landing Zone Cylinder} i3 {Reserved} *t6 {RPL} t2 {Rotational Offset} i1 {Reserved} *i1 {Medium Rotation Rate} i2 {Reserved} *i1 {Reserved} *i1 } 0x07 "Verify Error Recovery Page" { {Reserved} *t4 {EER} t1 {PER} t1 {DTE} t1 {DCR} t1 {Verify Retry Count} i1 {Verify Correction Span} i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Verify Recovery Time Limit} i2 } 0x0E "CD-ROM Audio Control Parameters Page" { {Reserved} *t5 {Immed} t1 {SOTC} t1 {Reserved} *t1 {Reserved} *i2 {APRVal} t1 {Reserved} *t3 {Format of LBAs / sec.} t4 {Logical Blocks per Second of Audio Playback} i2 {Reserved} *t4 {Output Port 0 Channel Selection} t4 {Output Port 0 Volume} i1 {Reserved} *t4 {Output Port 1 Channel Selection} t4 {Output Port 1 Volume} i1 {Reserved} *t4 {Output Port 2 Channel Selection} t4 {Output Port 2 Volume} i1 {Reserved} *t4 {Output Port 3 Channel Selection} t4 {Output Port 3 Volume} i1 } 0x10 "Device Configuration Page" { {Reserved} *t1 {Change Active Partition} t1 {Change Active Format} t1 {Active Format} t5 {Active Partition} i1 {Write Buffer Full Ratio} i1 {Write Buffer Empty Ratio} i1 {Write Delay Time} i2 {Data Buffer Recovery} t1 {Block Identifiers Support} t1 {Report Setmarks} t1 {Automatic Velocity Control} t1 {Stop on Consecutive Filemarks} t2 {Recover Buffer Order} t1 {Report Early-Warning} t1 {Gap Size} i1 {EOD Defined} t3 {Enable EOD Generation} t1 {Synchronize at Early-Warning} t1 {Reserved} *t3 {Buffer Size at Early-Warning} i3 {Select Data Compression Algorithm} i1 {Reserved} *t5 {SCSI-3 Associated Write Protect} t1 {SCSI-3 Persistent Write Protect} t1 {SCSI-3 Permanent Write Protect} t1 } 0x0f "Data Compression Page" { {Data Compression Enabled} t1 {Date Compression Capable} t1 {Reserved} *t6 {Data Decompression Capable} t1 {Data Decompression Report on Exception} t2 {Reserved} *t5 {Compression Algorithm} i4 {Decompression Algorithm} i4 {Reserved} *i4 } 0x2a "CD capabilities and mechanical status page" { {Reserved} *t4 {Method 2} t1 {CD-RW Read} t1 {CD-R Read} t1 {Reserved} *t4 {Test Write} t1 {CD-RW Write} t1 {CD-R Write} t1 {Reserved} *t1 {Multi Session} t1 {Mode 2 Form 2} t1 {Mode 2 Form 1} t1 {Digital Port (2)} t1 {Digital Port (1)} t1 {Composite} t1 {Audio Play} t1 {Read Bar Code} t1 {UPC} t1 {ISRC} t1 {C2 Pointers are supported} t1 {R-W De-interleaved & corrected} t1 {R-W Supported} t1 {CD-DA Stream is Accurate} t1 {CD-DA Commands Supported} t1 {Loading Mechanism Type} t3 {Reserved} *t1 {Eject} t1 {Prevent Jumper} t1 {Lock State} t1 {Lock} t1 {Reserved} *t4 {S/W Slot Selection} t1 {Changer Supports Disc Present reporting} t1 {Separate Channel Mute Supported} t1 {Separate volume levels per channel} t1 {Maximum Read Speed Supported (kBps)} i2 {Number of Volume Leves Supported} i2 {Buffer Size supported by Drive (KB)} i2 {Current Read Speed Selected (kBps)} i2 {Reserved} *i1 {Reserved} *t2 {Length} t2 {LSBF} t1 {RCK} t1 {BCK} t1 {Reserved} *t1 {Maximum Write Speed Supported (kBps)} i2 {Current Write Speed Supported (kBps)} i2 }; 0x00 "Vendor-Specific"; ELF 4\[4 ( ppj yFreeBSD.UWVS э}_t5\~(}t"Ep€8t:/uBpB:ut Q+  h VWSP" U=uAptpСput h~~ÉUthhO~=tt h-~UWVS} t8uj/7>% [^Xu= p pu7>tuWuVe[^_Shh5i 6Sz ZYt>uUVSj/]S$ ^Ztp= p pu 1e[^3V0 ZYt ;u߸UWVSu] }~N}] u[^_UWVSVhh5i = pE ptJ1>ˋE؃OE~5j h Y][6huz5h >u5j Qh j UUVShju] a XZhLSVߊ bw?$84 08< $uj53 a TH=4u-=0u$=8u=<u=$u = t&jSKY[5L ZthTjO- j5(蠔 U5j!jh9f j肔 UWVSWWEEEteu1,[xv} t]u;5Y}tEU}҉Uu}te[^_Ã}uhSc PvSm S^tS賎 uh. _X(녋EjP,蚎 Y^S18-Aju)XZ.UWVSWW};= EEW轑 ÃXt} [ 1 = tHÀt"4D4%4D4%u]Sך@ZtuWe Yu5e Z\e[^_5,h, W(1 j^y@Yt?t؃@PSv ^qjMP@Ytj-E@Zq:Sv ^!=$?j^@ZAjI*=0j$@Y =<t tSE=8=4t tEuha5Od 5d I}EWϚ^5[hTj) UWVS`5c =`qXts55`qu% 1 ~*`qSPW x)uhTjl) xe[^_5,h+ X(ZڍEPW耆 [^u/E=sPĂ `qYUh5,hj( UWVSp1}ju jjj͇ ]xPjhuEPEf gv覇?e[^_ÃPSWr x0x t!HtjWu @ZYuht XjW葊 [ĐUUWVSXu} EfEEEEEEEhWVn tbA9w;$EEEEEE-E뛋HT:-H)N<}}t h jT( }t}t}EuE0<* jEPSSp =Ev "څ8t Shj& EЀ88EfEEjVWW EEuZ DžXuG4H w?$}ujWu<^ w8 $whG( E}G<@Pu( [^ƋWB9!zCH Shj% uS uË U5j6jh`\] j襋 UUWVSu1Dž,Dž0hT u V葀 H.$1Dž0Dž,1Dž,룻@x|w|xT|/D tHU )ƍU =DDž(t<=@th!0u ,ut h!j# Dž(=@#0t(,t((hLjR NE hShqg` =v Sh_ 1qсqq qqJ/tqv /0qqU EPhq2 YXEf%f=@t;N~ xjB1҃t@t$u Cthqhq j" hqh (Ru  PĈ =Du=@tX,u 0tF4PE 0~ XfeEPhqp hqhc! XEZUh#h`#h?5:M j@sz U UVSudut& tuut "u=0u;4RPhjaӋ9ډ|9RPhjTaӋ$9ډ Y|9Oe[^hx,Qh,JtJ!t7t u4;Mu46h.j 4h, X5`$ Yj=P YZCxtuhjjj h#EEP tCu#A u% QuSQZr uh/j uh,5h,56h@/hjh/j UE E EEIp USuhӃZww]jhh,jC USu"[w=w 0]jhh,j UuYx) u(,ã(,h-j UuY uutjjh/j UuSt]ua[w=w jhh'-jF UEUuSt]u [w=w jhhE-j UEUuy $UuaU}uhEPb? hޣjjh$EEP\ t;u#AuA Qut8}uuh/j8 uh-UE E EEm UWVS ]ljEPScEUl 8=E9؉E]Ub11w$%1 t[EEUEU]߉ً]ލ W]VU؉EԋERPEU$X;U;EE@EExtxt`*@PƋEE׋EUU]߉ً]ލ W]VU؉EԋERPEUW;UuM;EuHEUe[^_þ@ 5hj| j") $5hGjp 5h-j^ UWVS ]AkjEPS;dEU$k 8E9؉EEEUbw$%EEE EtuE]މы}ً]ߍ Eԉ]؋U؋EԅUE'}9fuuuuZ9J9BE@EExtxC*2@PEuUE]މы}ً]ߍ Eԉ]؋EԋU؅EUXx~W1҃}~:9uuuuY99EUe[^_Ã}x}w1붃v뢃}x }1x 1E@mEaEUEI5hj j" $5hGj 5h-j US8t# )JtJAu;s]jw XݡUtUWVSQQ=tZ ɉtC< t It C< uue[^_ÍAD1)Å509v¡8E^19;C tEAF9;C u)ȃ 09so)P8 tP RVLm 0;s(=5Cj ZΡt; t`dtC< tBtC< uuZHOH ;0R)P5- >19s;C AF9s;C uU҉uÃ`Rd)P5F- 0)P8 tH QRk 0U 8VSt#5)KtKFu095rQ2H9rx 9s} @;sR0)9Уsue[^áR)P5=, j[)YSV5,  ]I9T9 tFU=Su]5h-+  A[9[r y t=9s )ЍXSR5+  H9r€8 t뷐Uhjy u |h"jx5 h<jl5 hH& uu uBut)uuuBuu@u@ujk UWVSb[hquuYwv B=Th#uX-09ЉsP] ^0Pk] [ѡ $  u%h=`utJ!1۩td8wJ44Cv8jEPa x1MExe[^_R5 Y빡8w44CvRb Z1۩t 44Cvh44CvH 1ҋ UE}5$ы]ލ ]uEu5g @5h-j o5 Ph.j HPf[ _t h.uHhusP5c  @t=Q5hbuHhu"P5c   밸ܸjjPfc  @5h 0j USdEP]s^ @ZYEf%f=f= tAf=`t;_jjjs~f Bt K]@u_8uKEPhzf@s` @t>UtKEf%f= uuK tKڃK dshj UWS,( t3 H @LD9r9ut= 1555b \u}5h XZu+@DuuMt0thlHP55] 4j[j1RP5pd у 85h _X!9%utHLe[_5j 5b V5hj 4U=W==;t|ut2t) 9su>)=1=uuu tj9Y})Qj 53b zpfUWVSQ}E:=1u t19sM<@9rO}E15uuؙ]pt9X\9tQu3t =t)a5h`0 XZ5h0j4 )=9ue[^_áR)P5 " ;=tX\뗃PT뇅t#Z8u15hj 5h#.Iuu tP}tuuj5u5u5a BtP}u5uuVu5l] à Iju5R] @u5h0j?1=UWSjxP7Y x1ڍ|څx%xXɞݝpZݝp5\5X5T5P5L5H5D5@h1jd]S謍 1у,IQSj{\ lhȃ tIЃ Ȼe^tS5l5hh5.jd]SN 1IQSj \ $ d` tIЃ Ȼe^tS5d5`hM.jd]S 1IQSj[ $tRpP,$xP]Eܵp$tpRPh@1]jdS蓌 1у$IQSjb[ e[_-1vUSWW[U1}P5T UWVSҡ- ‹=Eue[^_W55Z ~!t )u = u뾅u,uuw uuu}u5h EXZV1ҋUE}5ы]ލ j]uEu5_] B@aV8h_.hj.jQ h}.jE 5hj# UWVS  [$ҡ <119|=9s9555KY ~#$9ס |9rǍe[^_@ZEPhm5fEEV @/$9ӡ |9s555X ;u($9ӡ |]9rT5h.j EEPhm5fEV @}h.hj.T1ҋ UE}5$ы]ލ j]uEu5G[ B@IT85hj* UUWVSDžlh2Džhhl2u uxQ ?5$1Hvuhz2PYh2vxih2븃hu P hh3;h2); hu dlh 4j HU )EjpPU N Ít1XZ~$1ߋpPtPYOXuU :DždEPU 2P ZYEf%f= tE 8SWP ZYxP}t)tPSXZE U :ude[^_1tStPnY^Wh Džd묋E 0DžXqU h2 ÅXS" ^hjPlS t-E 0h* DždWNP SHM "VWO ZYu tPVƅ^XjWS 빋U 2h DždSh2 SDždL h2 _DždE 0DžXZU 2hSpPËdt 9}z1ߋpPtPXOZu~RDž`1߃=Hvu pD02utP`pPv[X`Ouj]X UWVSPjEP_ 1[9X}&1ۋEuPP ZYtF9|1e[^_]CLUWVS}EEEE 9EE}b]E]uCY ^֙UVS]CK u $&CV $$CK]e[^UPPEEP]+EɉXٞtE4ٞv2P$h2 2Puuh2zh2 XUWVSEELv@LvH] EP3h3z Uz +rJM =MEPs 9ʉMbȉљEE}Qs MQ*9‰EљE}QsMQ9‰EљE}Qsh3 }EV<$ #$h3 =tfUB+rtOP$4$<$ #$MqsVsh!38 ELE Ete[^_ #hE X#fЙ=(Й=Й=EMVRCXZ 9sЃ=53531IK KKC9sS 9ЉKsЉC h<3PhB3Q5shG33hR3' $=t>S9sЋK9ʉCsʉShm3Rh~3Phs3 h3 Y>hhV S^9_sЉC2UWVS=Pvu JE1эA9sЋNUɉZ=Pv9NjF P 9Ys؋NUɉBzPv9E^ +^ؙS9ZsNUɉBZ tf=Pv9}\NjFP9_s؋UB F+FZPz9Ys؋MYAvb9Zs؋UBe[^_Éș=PvF뢉ȋ^ +^=PvWș=PvF hPvEP [_UMVS1ۅ~Ⱥ ֙C[^مɻU5jRjh`4" j@'Q UWVSjj]Sjh3c uCC ^hjjSPh3Ec ;U$1EPC E[1;uE}]GF$;u|}u+}~ h3 XuC uC 1e[^_ËEUDPB EZtEn@o1Ã;u|CuC uC Ej U4Sk& E<1э\ ,U4F`C C;u|뫍GP` E{Y$h3 5h3 .h3 h3 h3 UVS] 1ۋut;u1=e[^3VG ZYt ;uաUWVS]1tW;ntk1;t 8,tZ@8uP3A Yt2ؿj,P# [Zt @Ge[^_h3 1G룀{ouUUWVS] 34;t>1у{Au v€z\tNP3j%I ;u&;u…t e[^1_jhjH jhsjH ǀzcuA1rUUVSj ]u ? ZtXpe[^h>j* UVSPj u? ÅXtLV CYt>=t'j EPV/ E 8@e[^j EPV/ h>j UUHvËBEw@ UWVS}1҅ɸtU11҃tLoD=t@j jw\/ ÉKD 8"t;w@ _w1ҍe[^_j jwp. Ɖ jj UVSuHwe[^j> ÅXtvvh -S# ^h>j UE8UWS(1t5B(1tQtSEDe[_À{=u<t< !uո>Ph>Ɩ ZYtUVS];uC Ce[^ËC18u S?Y tSC uUVSu] hjW h>F tRC( <8u&pph>p <Ee[^CpJ [h]7 ZuhxSV? teuۡH(z5jjh> j>J Uh>j UVS]Su YtSe[^VUVSu] VYu S}Zt'VS[^EE e[^Se[^UWVSuV} [u W~YtEV&W wv\( [Z1RPVGWAe[^_VMWGV_O1ڋF1ȉ UWVSSSuYu u ZtSuu E puv' ^_1RPuu e[^_uu EEEu XV9ӋHF|9wEEuuUWVSSSu=Yu u 0ZtQuu E puv' ^_1RPWuu e[^_uu EEEu XV9ӋHF|9rEEuuUWVSSSuzYu u mZtSuu E puvA& ^_1RPu*u "e[^_u,u $EEEu XV9ӋHF|9sEEuuUWVSSSuYu u ZtSuNu FE puv|% ^_1RPueu ]e[^_ugu _EEEu XV9ӋHF|9vEEuuUWVSuV} Zu W[tEVWwv$ ZY1RPVWe[^_VWV_O1ڋF1ȉ UU WVSEM]u}x~=x~.~x1[^_Åyyxwݸ܃v˃vUWVSuV} [tWY tr=tUGFWVRP/ppwwvvA uVWe[^_hyjM GFRPYXh>UVSVVEMU EȉU5U uE^Z[^ڃىUMY[[^UWVSuV} 8 [tW+Y tr=tUF+GVWRPGppwwvv\ uVWe[^_hyje F+GRPXZh>UWVSVVM Uȋ]u1 Љ]u]utQRVSE+;Ute[^_1;EuUWVSuI [u 6Y =UBRUEM Yq}] ]uEu!ppU rrMqq uuu e[^_hyj5 U BMARP_Xh>UE 5 EUMuAt1BuUWVS}Wu ; [V*Y VF tq=tSRPww)RP2vvwwluWVe[^_hyjV G~RPXZh?h>UWVS}Wu [tkVuY t^VF tF=t1RPww&RPXZWVe[^_ËG~Йh?j h>UWVS0}Wu jE puV}jEPjwV{uc]ȋMĉ uW}x:WEEGP^Wku cEPuH e[^_ËE)ȋURPXZȃ}ujjhhSVP{Shj UVS85,)t}PRC4 YZtQH8ҍp,tCPR4 ZYt#H$8DX 1ҍe[^ÍP1 Y뽍P1 Z냃''J'@UWV=8S0L68H,$1f65l=L6 6t"Lx:9@66t"Lx:9==~%=LtLYe[^_, 6tx f:t;8vB-$,; s5,6Bfr$,B$DBth#?UYIh>EX065)$4Cw$`>4<?,)‹ $2), $@5ut{?6tx :9tM?6 9,s*,Bfr$,B$4t6뱍B,A$=L4fBAx=La1CLyLҋB42r^4X2r2rI2r2r2r62r2r2r2re2rIy2rGj2r[2rmL 9,sR,6Bfr$,B$DBL!HtVLL(UUWVS}] Eƺ7?EM׉M}~}t5jJ=wluj EP3 E :E8}~E쀋EHvR7_E4@| 1랺:?u׉M}EƸqRuEZM}~=?3uM}u1}t;j EP3/  :tE8t Rh@?P XZMuV8 uQ2 @Y_u3h5 3+X^ERh? n^ E8-7x--@MQv|R Y%t3=wUqj EP3C E :tE8t RhW?j }R41뵡4D4ZUVSjhzuV菳 uV4@蛲 ZYt C~e[^Uuh? 5j7 UVSuV4@M YXttVj C XZ~׍e[^Vj Uh @h`@hq?h@h?5 j7 UUWVS`j/] 36 Y_FOuPhSu+ @tH)E}txdjs3 PEhASu+ tf?7wK$@T``T\hP넡H)Ehud-u=}X}}E=\ttEPVw+ _Zu Ef%f=tQEPV+ ZYt Vhj Ef%f=@t1193tjV3A ǃ 93uW?5 ,벃}kjh~3&UWVS`=h}u }<]SV* ZYuEf%f=@=\EPV* Z=TYt=`tuLVWdZYu,=Pu 1e[^_WXPVhA Vh 5  VhA5 < tt < t@uytYt5j jhA V. [HSV) Y[Ef%f=@j/W [Zt;@PVhEhS_ =+?WEPWP) [ZuEf%f=@L*UhAhBh@Bh?5 j3 UUE @@E E@@E UE@@U E B@E UE H jF ^hhE`vP- Z 8P7a `vX+ u |hFWV& 1Gm$B|fMjhhpE. 4,! x}n_PtAg oe6HhpE)ƍ=vt.(FEP $SjP]S 5S ]û5FЋMv9~!9}=vtBF룻LF뜃=vtVF댻aFj vX\j9Ǟ8dZv4U=Ut @t1j/o%=t8=w=t=@tσItj*j|=t =uj%j=j@UVS Efx2u}p@hhPC hSVi thlFƄ([ Se[^=0 $VhqF5> p@@phEhPB xUSSS=]E Ut}RP,$EP]{EɉٞYt=24Puuv1PCPh~F蘔 ]øzh3ShFu RPShEc USSS]ٞzIuG11Ƀw+ńvR vŀvP,$x]E;ȋ]-1$謖Z Y1UWVS] f{2}s@hhP#A CFXGuÍe[^_Ã=tj\XÃUw4$Dj\[jajbjtjnjvjfjrj"Ո0P0P؃0P j\0P0Pz؃0Pl%R ZU5j6jh G j' UUWVS ]u EEhlGVS t?pu Eރp~vu ?tmudE뭡H4>u}t)uYhP蝬S >E}tXP6YZt1ۅuE>u}tP6g @Y[u6hN XEZP6 YZx=t6v Xj8t`8t6h XZn6 $uhj9 u UWVS|E ufEfEDžx>/GDž|1${u|PV YZxF=u4u/Ct|utxe[^_EPE [Vh~ X\8t R8u,EPV YZxEf%f=@tt''VhƩ XZDžxsEP YE0j fE%?P XDž|ZEPu h:HA vv u hH&  EPu hI ff u;h3Ǣ P YsuUWVSS jEPR @EtPhTHh@Is e[^_tJjEPR賒 @t,Euu1Ph\Hh\HhI h\HhdHjuh=?hpHh,h\H / h\Hh jhTHhTHju u=h=?t)tHPh,hTH. hTHh蒠 $문zHUhIhIh?5 j@ UUWVSj/] 3 _XZF 1(hJSu tP&w^$ J($  닾 z kH)E}=t e[^1_~ S ;Ytj ZtSTX5, ShSu @t$ H)E}t S봋3UWV1=St=u= u=t1=$t jPuI UVÅX&C4H $JsB $shGj茝 =us~츀j5XÅXZxI5whS ;wt"5XhN辋 SLe[^S:X1j chUajhMPd5Tjh~Ssd$hNjhNS^dwPhhNSCd SVe^tPh SfgSe=(Yfj $chUajhMPc5Tjh~Sc$hNjhNSchh hNSc SdZlSehSn j5UWVSj5X_XKjjjS} h hS= .Sjwh`P}tj bhUajhMPb5Tjh~Sb$hNjhNSbh8jhNS2c Sc^t$S8<^de[^_1RP5<581ۃ9ӣ8< u9uf1ft581҃t)AÃ9|5XjE 5XhNj3 5XhNj1 UWVSQ} u5XhNV =,fGfH4vhIV GPjhOV GPjhOV Vjjh(衿 GXGXGXVj , w(hOVz w,h/OVl w0hCOV[ w8hYOVM w4hpOV? $w?Q޹pc޹ OQ޹ x\Q޹+`Q޹ kQ޹ uQ޹ ;Q޹ Q޹B<{‹M a9sTPu O~u "1[e[^_SB`PhT5起 ,Sh@T5萷 j j藐 U BT j jt U BPj jW =wU fBNShQ:j j =wʋU fBLNj jޏ H =wU fBJj j謏 H =bU fBHj jv 0U BH@wMQ UB tvlt1:tW&j jS肊 MAtԅt Wj jWa M1qA uhT5 utnWj jS UBjtWj jS M1qA tWqj jWщ UfB!1Ҹ@M q(U9sBB fBMAA fA@=wSu0w EP SuhU5 1҃j jS) ƒ 1SP ZY28uh@USuhU}UWVS(}E=,Ex(Uz,oMy0DEx4UfzHMy8u A0A,A8Ex<u U@4B8Bm jUhZh[h@[h[h[h\h@\h\hRh\h]h@]hRhRh]5L @j UVS]SC C u ‰KQA A C ‰VKQA A C ‰VC F C F SC fF[^UWVSQ]SC C  ‹} WEVt e[^_ÍQA A  WEVu ;Ef19ÉEsQ Ѓ1;Mrf^SC fGSC fGjGPCPu jGPCPu K(QA A C( ‰W(K,QA A C, ‰W,K0QA A C0 ‰W0K4QA A C4 ‰W4K8QA A C8 ‰W8K<QA A C< ‰W<SAC@ fG@SCCBKD fGBQA A CD ‰WDSICH fGHSKCJ fGJSMCL fGLSOCN fGNKPQA A CP ‰WPKTQA A CT ‰WTKXQA A CX ‰WXK\QA A C\K` ‰W\QA A C` ‰W`KdQA A Cd ‰WdKhQA A Ch ‰WhKlQA A Cl ‰WlKpQA A Cp ‰WpKtQA A Ct ‰WtKxQA A CxK| ‰WxQA A C| ‰W|QA A  ‰ f fQA A  ‰QA A  ‰SVPXOZy1US] UBBBCBJAAACBJAAAC B C B fCBfB[UWVSQU ]CCCfBCfCfBCfCjCPЃPq jCPE Pp M A(C(S(BBBA,C,S,BBBA0C0S0BBBA4C4S4BBBA8C8S8BBBAhwP%?@ZY=wutPhz^/jEP5wS?tSN9$h^j?] jEPuS?uԁ}b0t h^Mu詵 _5uPuSQ?;EuS=E؋U9‰EYr1ҍ2҉]uEEEEE9}tg tR>t.BЃ w kE DЉEC;]uǃ}uj Xj Et}tEEEE랃}t h73haha> 1ۃ Ft.PV F)Ћ @PRCPh b> C ~25hd_> X=xZt(= xtjX=xm =xH t 5 X5xh$b= hd- h e- WXX=xu =xtWX_=xt=xu=xu =xtO=xuh`ey= h=bg- [^j=xYuhe Zthe6- Xj膾 SCX~Q_EP3V^Zt 8t3h"NhhEK =h[jW 5hWbjV Uh fh`fh5袐 j۽ US]h em, Yu$Shq_< SC ~]É]]UWVS(EEEԉƸ  uEkbe[^_+ UBR )@ExẺNjEeU}Ћ]ME]ЋEUU؍UMUU؉M܋MP $}PPhtbq; UBPuuuB PhfJ; Mԃ(A PA PAPAPA PA Phf; EԃPhb ; e[^_UfUUVS5]hKhJhL)VSBChOhNhPfLV+fHJSFKG[e[^UWVSuEh@gU: u =xue[^_hb^t= xt1}0S EC)ЍpPEPhb tECPEPhb tECEPhb{} ZYuEPh tEEVEPhN tuh`g_ C s VEEPhb{W tuuEPhb< tEEWEPhb  t}CEC CEfs fsCsC VEEPhc{  tuuEPhc tEEWEPh#c t}C EfsC u$1c^4C PCPC PVufC fCCCC CC PC PCPEV+P(juW裏 Jjhg' j Uhh' 5555h@h7 hhz' 5 5 5 5 h@h`7 USPhh[tLSEPhOcd t]Cw+hiZtЉɀL]h i& YUh`iUZuUSP hi4[u]5 ]Sh`c tE 5 Shzc tE 5 Shc tE    hiYtjUWVSQQ]ۋ}uu} uEfXZ[^_É15  )É15 EU E)ËEfUVS`EP5 ެ@ZY9Ef% f=xu=xu1ۃ}tS5蚱 Z@Y= tB= t,@t e[^5hiQ 5hc8uuj5% [@^t1pV5hchS jS @Zan81G5hjP [^?8t5hc*UWVSSE} uE jRP5  x=EEE Ee[^_HUWVSVEE u} tE MEe[^_ѭ jRP5 _ x=EEE Ee[^_鲯UVS ]Shd@5 f E Shd@5 = E S hd@5   u}uEExEPhd@5 蹬 uD1REPuV]S蚛 1ER PVSw e[^ $ ??Uhjj @tf=Uth@jdN 1hjU= t j&1hjj @uhj3M UWVuhcx1 5虍 5jdh` 8 t{1`Ɓ^=`tX`ct9`ct&`]t`u e^_1j" UWVSu1Vuhk0 5ڌ 5jdh`L7 1`Ɓ^`1҄tsЅҹ`  t|AtBЃ wk \Au t3 t.th`h@k0 _X@E e[^_t t uAtӃ t t1At t tej UWVS`] 3uhk/ 5jdV16 1Ɓ^`1tj…t  t{"tX3t t tFt t u1;эQ  B~@e[^_F3tÃ"tFt"uFy t tjUVSu1۹@x9tC|Xy[^ËAUWV0Phu@Y^jhkVb uajPj}WVu8+@P谡 ZtA)4>e^_PhljH PhchdjG h[jH UMS] ACACACACACQA fCACA C Q A  fC A C A C QA fC1ҊD DBv[US] UCBCBCBCBCBfCBfBCBC B fC B fB C B C B fCBfB1ɊD DAv[ÐUU5j4jh@m jڭ UVSPupj EPVY W 8uE8ue[^Vhj-F u Vh nj-G US];t"SJ Zt@]hSyZYhmjF US];t"S Zt@]hS?Y[hmjF UWVSEu vFu諙8tj 1҃=yyt>1)ʃ>uR Y=yyt%6S詅 X~Zt h%FS薅 _X>uSuhr; xh5z; H hrHYH[,hxH^H_hrHHXZ;u q޻sah3j: UWVS]CUWVSVjEP}dYN[x:EWP YZt(EWLP YZtNy1e[^_ËEUWV} S]tE 8u ؍e[^_Åt;uu J XtS讒 X1Љ߃΋} ֍4VJ DžXtu ShsVW h3j8 UWVSPPE EEhEP1h ZEYt\Ut<-t(u쿻qtȋE sUCC봋Mj=R C^E_tE@U֋M e[^_UWVS}] ^hSkhsS`uEEEEhEPjg ZEYtB}t+s}tuuM^E_uSu# u uEu[^hEPf ZEY1}уQ蟏 ÅXfnoCuS2 SuvS诐 sƋ}8tuuEoEPu/_Xub Ee[^_haH h3jg6 UWVSQE} tV8tQtM?tHÉEhEPf ƅXZt*VW YZt݀;,tFCuK,Ȁ>tCe[^_Uh th`thth?5n j UWVSV]s0P{sPZYUVStu] EhHh_sSVߎ t,?totjEPhz5dH)ƃtUE1EE[PRShh2EDx 1e[^ǐt.tuh^3 XZSuhbs34 Et SuhuSuh@uU5j+jh`ukj j贘 UWVSE EEEEEu-D E^uhVOƅXZ>nEj=V Y[t@];u8;t({ tME;Ct C!1랋C M=p{uk1эyWRV u t<=t;u둀~ofE^EEe[^_/ jj>0 Vh}sjA1 UUSM :t:/t$BA:u)H~y/t[Az/uB:/uЀz/tUS`] SuZYt/EPSZYuEf%f=@u]Shsj@0 薎0?B $ShGj@0 UVS] 1ۋut;u1=$ e[^3V ZYt ;uա$ UWVS]1tW;ntk1;t 8,tZ@8uP览 Yt2ؿj,P [Zt @Ge[^_h3X1 1G룀{ou$ UUWVSt1u] DžhDžpDžlEhvSVɊ ?7wk$upЃpǃp뾃p뵍pPlPh|5d 뒃p5d _Eukh`H)ƃtt;Ps%WWlp}DžxtDž|Et,tPltPhk蘎xKj~ WnE[thtPhw  XZ뭃ht h w YEthj, U5jGjh`we j@ UVS,juY^Phc@S賌 @)ƍFdtfPhcSƅƅ[ @t8SWZx u Hye[^ÅxSڐUWVSE EEEEEu> E^uhV}ƅXZ>nEj=V' Y[t@];u8;t({ tME;Ct C!1랋C M=}uk1эyWRV u t<=t;u둀~ofE^EEe[^_鯅 jj* Vh}sj+ UUSM :t:/t$BA:u)H~y/t[Az/uB:/uЀz/tUS`] SutZYt/EPS蘇ZYuEf%f=@u]Shsj@'+ 0< $ShGj@ + UUWVSd1]u DžDžDžDžDžh)yVS 9<$x̃5ddP@ _X5ddP5dDžXj^5d#fDžЍPPh}5d>5dDž덋HB9tPtiSS1dDžlhtt u\PWl@ZYt}u u u f%fdPPhxxj ShjG' Wh9yUS]S+ Yt@]Éيt#=w"tCۄu Q Z1QhAyjC7( US]SZt@]Éيt#=w"tCۄu Q蔽 [1QhVyjC' UVSQu01ۃ<vt3x/E8u'e[^jEP5do ƒ Vhj@}' Uhyhzh?5p` j@詍 UWVSE DžP8/ PhjyhTS蘹 EhS ^L_11tWȀ YjjPPjL#lljr4D4%@tC܀;tEPEPEPEPEPEPEPURhySPU (1ɍDA]fS~FJ1DW jjPPjLjklj4D4%@tC܀;tEPEPEPEPEPEPEPURhyST (2D1Ɂ„DAB~FDG]1HWJ jjPPjLjlj4D4%@tC܀;tEPEPEPEPEPEPEPURhySS (uEH1ɁDAB~FHKW~ L莊 e[^_PVh`zjA$ RMo ZXPVhzPVhzR%o YlPVh {PVh`{Rn ZPVh{돉 ShjB # UVS] SjuZYtg1ۉځʀwL44ځʀw 44C~e[^RQ ZR- YShjN|" UWVSE EEEEEuU5 E^uhVwtƅXZ>nEj=V Y[t@];u8;t({ tME;Ct C!1랋C M= uk1эyWRV u t<=t;u둀~ofE^EEe[^_W| jjf! Vh}sji" UUSM :t:/t$BA:u)H~y/t[Az/uB:/uЀz/tUS`] SuyZYt/EPS@~ZYuEf%f=@u]Shsj@! 0g3 $ShGj@! UUWVSh|j/] 3趇ZY@P1 ^_4 E1EEEh|Su| tVF2w5${MСdEE븃ME뤁M@E뒋E%=L̀t~j}t uQ~thh$hh|ρ ~Jjh|Ṕjh|S迁}1IQuS訁$jh)S蘁Sj}u:Lm=4 Gj"jh|/ Sh|j* hh|hx3c }uMjj0@_ZjjO jj@jx 1^R}uj\ 99YtC~׻j j~@_Ztf P+ C^5j'jh`}3W u|[}00 $jj{~@ZY|tRhj |8u|8:h}j h}j"jh. Sh%}~PrY4}zsE#h}jn U=4 t|Ph}5UW j莄 UPPjjEPEPh8}E,uEhD} 1UUVSj?|}X h? ÅXE PEP#^Xhiu uy :B+$~j P5d@e ;‹ 8uh5dh|\oH`dUTFX7j P5d&e h‹ 8uh@s5dhj `LddPH)EE =du hj8 hjK HZY.hjK HZY 5KSIBY}[uU BEE BdR&$xCj&j>XZh>S)h` $j517%jh6<VfC=;=Lt5jjh3S hf>j%X=LZt5jjhۅR h jh(. hS#j~0$Y=H[t4=Lt5jjhR hYjh8( jh@;=Lt5jjhRR j=j!%^=LXt5jjh "R h jh', Bj$j6=^XEHE@hVE 0E  VjthԭPVf' EHE@uAjs$j<EHYE@[tThVE 0E Vjt=XtVbZhGSV& EHE@u!j.=HXt"j3jjhH ^XjjXH ^X'PRhj Uh hhh h`h05Q j(3UWVSE U0NM9-Pp ËE X }1Qp EE_EU:tKMЃftxfbtj}uE-@EEUMAMEE8u}tUM uE +CUe[^_Ë>tG1уQ p Yt>-MB6BP>a XZvsGPh ejj UWVS@ hPhuEEE@EE؍ELE E  h`MZt}plEPhPPPH?9wj$p1I~9u:WSgÅXM=XuhGSW#0W^^捅Ph5N hKh h`h_hhhh h`hhhvhh@hhhƆh`5|N L1I~߆9J=Hu"5jjhM HI5jjhL H؍1I~)9WeYP.HZtWP^ ZYWh 1I~9gS'0^tf@fthTrS'Sh!;1I~=9zmj)=H[ulꍵ1I~91I~9rPP61I~9-tPh(5jjhEJ 1I~99e[^_Í1I ~ H9j8(X1I~Q9^=Lu5jjhY.J L5jjhjJ L1I~|9D1I~EPEE9XUWVSu~] ~JuF+FV4uN EUDFH Fte[^_ÍFP9Y=p5j jhI 5#R 5;hh@  K=@  t1@ I>  >   @Sh@ ^4Z8Yph@ 5p8[_p=@ /tuh@ uhEhS誢 uuSv FPjj@u+xFFv4h5H uuh@  룣pcuuunL EUDaH t tquitC@UVS]< < < u t+< t't#\tg't#"tCF< t< tue[^C8ttȀCF8tuCuPh5G K Ct5j"jhF C< t< tMUWVSS]޿t޿-E 1ҋ} Ή߃эL;M#Su X E EZ8YtUB8tƸtuƄ(Q=>RPS^S hPPh5C Xu 5j WC pd e[^_h}j U _Xt ;s5j B d s *;^shʇ\Y5jjhA TMQu1Dža} ʋ}щE Ӄ 9 u1*EP)ljEIfMY[UVSu ]FP~)C8Zt#=Lu@8uf+C=HfCt~ I;ucC ^FЃw$XPh 5A C e[^6,"ZuC /C #C @C =C %uk$Ytf@ftC *C y?;UWVS M k E]9EEEEs69sC9E}E{ tE{ tE ;]rʃ}tE}tE=Lt/E~ әE܅EU܍DEQE}uTЙ19ƉEE9}}uukE ]Ã=L}5sn? X}Zu_kE ;EsB[;]}U)ډ5j EE YKXu]E]9}|F;uue[^_5j ? XZ5C PD fCYX5C PD fCYXX3uh5? EfC@fC%UVSuVIÅXte=Lu;t=Hu I;tt/@CGC@PCPhHI+ @e[^1UVSuu YtV=HuI;t2=Lu;t$3%ZtfF1e[^fF@UE @E E@E4d U=dithVZtÃ=Htjh` jUVu NS1ۃ=Tá;t;=Lt}5 tP= XZuVh5= e[^UWVSt1M =TIʉE;u}u*=Hu Ee[^_Vh'5v= ߃} =Xuu h<]SA tNu ÅXtS $Vb ZYtWu V! t fKlPtNYu SU=dis=Lf6UM S1ۃ=TI;u؋]u\…XtfBzfBtR!XUWV=LS'j_tU=LCPJ;у{t;tSPSX![^u;5;re[^_VYtON;u4=HuD{t0SKsC [XZuF;5;rS!NS S $hA5P; 5jjhM': 5jjh_ : UWVS M IEEE;tEuDžXt"wMwƅX9tEu YƅXt^Mt9[uEnEtE9F;E,M}E$fN=Hu Ee[^_VFQ$uut$h|59 u uh`59 uu u }tfK=HtSPK^fFftm~tJMuu u~fH =H@SP$uu$hFVE$uhDuV$"JuVKfN}VfVЃfDfV8=Hu Euu&$h58 у}t%}tfO=H]WcfOWKWEPu uY}t fKPIYuu$hQ }t W9H_4WJWSXZ!uuW$hЈfVЃf~tD ft3vF uu u5ƃfN[VGXu 3_t(~t hVIMY[VJVvXZuuu u=PHhVMXZEG;E9}t9=HuWGY1eiWv$h 56 W^IW[_lj%h yOXUS]|NILuXu=u"u ]h"htG XZh+haG YXh4hNG XZh<h;G YXUWV=LS ;=;rz5t^t {t[uv ue[^_f{u7=HuSHHSXZS2$hD5u5 hbSSKY_WYtMxtGO;t,^t%f{u=Hu#SGSmXZ[uG;=;rS$hD54 5jjhz3 UWV=LSu`1۾t{t3s uu܋thSeJ[ ^_ue[^_ËC SkFSXGZ5j jh`,3 UWV=dRS{=LR5luXZjxIX;9;=lre[^_VTI;;[;9tHPVh53 2l9tPuT2Y=l[;9;rV6ÅXtKfCft0fCfuS$.fcXSEfcXhSIXZhʼnLYVYt6S$hۉ52 fcV^H;;rVhKXZ5jjh1 =L5j"jhx1 yUWVSQQ=Ljf;)%X1jGE;HPGǃ ulEGWEG9}XZd;9v;;s =l&;;PXG;5;XvE9lE9l;5;r[;5;m9eVUÅXt-S2$S,Efc9lY5h0+h =J^VÅXt6S$hۉ5.1 fcVF;;rbh IX0a0;5;E9ltujf;#/Xve[^_5jjh/ UWVSj5_t$=LfFfvu=L;;Džre[^_YtXtfCfu[u;;rV$W@ X~ZtjSa$WB fcj5j jh/|. GV($Cff[5jjh:G. U=LVSue;5;re[^VYt!fSЃ{fCt(f{u[uF;5;rhISDXZ߃fS5jjh_- UWVSSuV} ExYtZW\9ZtEt 9t:@uWhx\G_X{t Ee[^_Ã}thS@D[^uVh57. 1ȐUVS=LchV [t8u5;VhNJh2 d h hzyPQX Z!Y} DžƅƅfDž/fDž f;f;f;tLf%f=@uB5!h; hhZ,P!+CC 5!Y hE [!^t5!u#hDZte[^h EXPjY YzQ0# $hۊ5|, 5;Vhh 1 d1huP ZYt!8tPV.^X1t3ύe[^É@x/tUWVSuu 1҅[tQpp5!1эY 5!Yt&@9uSVGP uԉe[^_1UWVS1;u ]=?%fS)ljЃfu9C 9=LfCft =Lu_C S9s =Lu-=Lu;u he[^_5j ' XZPRh`5F' 5jjh& 5jjh& Wփ;tS_Sh6Y_US]fC fC=0CPS;P SУ]5!hjf+h;f;T% U5!j5h;f+f;% 5!f" !UWS] 1߹BUCj{RW) 1IKfɃ fKe[_UWVS}W] u9Zt+)xG%0jRP7KQ %Gue[^_hG P7MG Sh5=% UWVSQExEH;H]ˍS UfRftu)9gUB{ usu18t2U;;r"=HtPh5$ hMe[^_Ã=Hu1Ph 5k$ @)h PU2LU B=Ht5jjh' # UVSu/<^u 1e[^PJ[thLvvP!US]3KX]]}D USjj]j3mO +CC]USjuKYX1th B Zt@]SK1UWVS@=LhL Yt8udrR=#xhh DžXZWY^Wj4jEP WYuyƠdUWVS}=*}t@h`%=P_5; ^5;cCY=ll;@&P_=H5jjh= l=d=LVh5 hIh@+D/X=D/Zu&=LoVh5R VjVh@+x H5;5;V#PV#EPVm#EPVc# 7Utt7ttUhhf;UWVS77=7Dž=7Tt hȐMX=h1; 8}v=0+u $8 (P Ⱦ9^C; 8|h7HYu(x~x=7S=HuA~ PPUXZh7 e[^_5*5;h@5@ 랃{돃x :C; 86=0+u $8t Pv^C; 8| ~!PPUDž_Xx wʋ -빃~2xn~Y PPUXDžZx~Ph&U hv߁w -h+k_uhXLU=\tu u54+% @u"0, $5;5;h5y UE jRP54+*) Bt@u2"0 $5;5;h5( jUD/E =UD/U E@+3 PRh@+5;h5 jYU5;h@5 j9US] Su58+ 8+]UhkE 8+UUWVSQEE&;&W;~ &1҉DKu=&u&=; 1=&WP*XZ=u(;9&}~=H;&t us~"; 9t)ޅtub=L=u&l@Pl&XuW2hh&5&VJ h5&&u* *e[^_á; PVh 5jjh =5jjh ;H5jjh6V =Pt; 1=&=t;jSZY0 $hM5 jjRS5% Љу hL[n5;hf5 E%5jjht 5;ht =Lu؉י&PSh5E Ӊ5jjh J&WP5m!à  &hPB&;US~&1҉DIu=& P5&[X~du:ȉә=L;&u]Ph‘5N hhQh@5. j0 $hڑ5 P5&5U  XUx=u PXUS]SAC=TY=l=k"P<=TZtGC=lt==kt 1҉Ћ]5j)jh`E 5j'jh1 ʃ=?u=L?S1҅Yt=?BB0+$H CC(K,~D0+=HCTu S;X19}@9|벁{luC|ss s0CXS\s8C`Kd*CRhXZ ShPh_xPh5jjhg I5j)jh`K 5j'jh7 UWVS}?=t_&w$`5jjh *H&9tPRh5 5j k [^71҃t&19}0+u tB@9|G&*5&e[^_5h65Z Y5h@5jjhJ05jjh]5jjht у u5j `RPh5 UWVSu;f;f;;>G$t1;}ukC;|V[t>;;ZYt҃t~Ph5 e[^_ÍPwXh Y57h XZfF f;;;;FH;FX;F4;F`;F<;FP;FL;F(V,;F;;;ϒ*@#*u;j[;UWV1=?S]u>;NuIt'5;5;Wh5 1e[^_ø3ZǃNXuUE Pu5]o US] KMxAQKy[US] KUx BJBJJBKy[US] KUx4 BJBJJBJBBJBJJBKỷ[UVSu1Ҁ>] t$0Gwh$k TF>u܍e[^ÅuF1uRS/XZuRSGuRSPh5V jUEPh_MEÐUWVSj/}Wh [^t8t >/tF>ue[^_WYt fK/jWZ0WPPUWVSufF fuXfN VS$Sv 6'V@$1INV$Sue[^_h@V?_XUVS]s1Yt89t @Ft,9ut$sVhhh`/ e[`/^hSXZU=\VSu] t'=Lue[^SVh5 SVZYy0/ $SVh`5 UVSu~t h%VYXZV =\Xt&=Lue[^Sh956 hSZYyɃ=`ufN@0 $ShG5 US]{t hXSYX{uqfCfCSf=\Xt$=Lu]Sho5 SNYy`0 $ShG5a hSBXZUS]{t hS&XZfCfCS=\Yt$=Lu]Sh5 PZy0o $ShG5 UWVS`=`u} t =\}}tuhi1e[^_Ã=\t6=Lt&V}WtȓPh͓5D WV3YXyEPV]YZu}u*y0 $VWh5 hjV{YZuWVuVc뱃=\IWVZY800 $VWhWv[U=\S]t)=Lu ]Sh5P jhS y0 $Sh@5 1US]{t hSXZfCfCS=\Yt$=Lu]Sh5 P Zy02 $Sh5 US];;r؋]S,Ytxt f@fuC;;rUS]w؋]SZtxt f@fuKwUS]u h$5 S$h5 s$h35 C$CCuxC uS{tFPhC5 shS5n SY]E Ef7qP$hv51 P$h5 gP$h5 ?P$h5 U`3|NILSd3]`3fCffC ffCfugfCfuHfCfu)fC@fu a3]hʔh`3} [XhӔh`3j XZhٔh`3W YXhޔh`3D XZhh`31 YXdhh`3 XZ>UVSuV谾1ۅYttK;uVh5 e[^UVSuVh5l 5} 5; à t5; Zt1ue[^Ãytnu1UE Pu5d =PthhHZuh ZHYtjZ Uu蝿 Z1҅d7uhj `7XYUShY| Huكڸ |tPjj|PCPDžtDžx tPh|P5U ~2({ Ƅ(|t'P|P5d7h*j UVS =ćj@5d7^ Y^|5d7VZCd7h63 ÅX>hhSVȇ0ć@Phd7 `75d7h5 ; =E~EE}~+jEPhh5`7S y mjEPhh5`7( jEPjj5`7E (x7jEPjj5`7Exe[^h:Ml[h @l^V5d7hQn̻lȇ0huh~3 Yć[t% P{ȇZ,hyhj UWV}S?t5Àu7w>4D4%u _t-uF>u˸e[^_Wh1S ZUVSu uVhhS}< SVe[^U=thŕhoUWVS u hȕj]S < Shx19| e[^_É)PEP5`7  ~9|jYUWVS u Vh͕j]S; 1IQS5`7| Vu5`7m (h{e[^_UWS uh͕j]SU; 1IQS5`7# e[_Uu u5`7 UhUSPu uhҕjP]S: ShQ]UWV=St 1e[^_hA h^[1@@XGeFKv@@USU x%RuhڕhSl: Sh]UWVSPP} E1ۉE}؉IQR5`7 ‹}I 9tjX}}e[^_UWS j]SEZu [;Eu3ZYtE;uTucPhjƜ u8EhAEX h 4j膜 UWVS40ԇsut^CEƸqt$uxtu/ru"EPs@^_tus ZYtu1e[^_Ë{1Qx ƅXtMsV u.uV=1ۃutVy 릃=ԇthj舜 h3jl UWVSPRPuDžDžDž {n1}эA~U€z/,RPRuO EP购 u n [u ZYt e[^_jVjjjVjjPP- _jVjS t ZYu$S IVSh Q jVjr%j@ ÅXZth{{T1}эA~U€z/UDPRPuUviu Suut8+u hju"h`% b 1P ^PPPScHBU€z/tW ƃ1I_tq+SCP# :V V IHBU€z/tEh j耗 UWVS1}Թ8EEEEEEuA1uuRYu e[^_5Au W_Z/=A }tAu}u1hjhu  e@ EEGuujhpSh"jW t%hWTY[PuhG ;u u) P PRGWP V5ASu^ 5A; t Suh蓘 hV^tu uh{ u h1m Xu訨 ÅXtpj:S]֊ _Xt'EEEPEPju }t,^jEPjju0%EhFؗ [h j) UWV=؇S}]=܇r1҃w8$ij؇Kx&}t}tc}t}tKy1ҍe[^_áAuLPw ZYuҡ܇<tDžt A<5A봡AuP3 ZYu܇<st A<5AVLl؇K]܇<tKy?Au LP ZYu5AuP Y^u܇=AWL1;؇1܇<tC;؇rAu LPF YZu5AuP) ^Zu܇낋؇1Kx*AuP ZYuGKyۋ؇Kx5AuP ZYu <u"OKyOASL5A 5܇ 5~ ؇j@P Y܇^t>؇j@P ^ZXhA&Z1҅؇{*h`j. UWVSMU A:Bt [^_t,uB9Aqzu։9(ǍqzU=AVSut =Їu e[^Åt)ЇtsvbYZtՋ[uvu1UWVSjuVjj]S}3U t e[^_jVjjStE USjjj 1~1S AYtjSPAEȋ]hEj͐ UWVSQQ]E1j |PS t @|8hV Yt]thWCPԲ ƃhVP軲 ƃxǃxhEj p 1e[^_Sh?1[^VhqWh[p 8thghj趗 UWVSVVhzyhgw YE[5AEta~tQt!CPFPR _ZuߍW^S6hxut }uLE싶uu" }_t e[^_hg$@^uhghj 1WSh蓍 룍PP ZYYuZhghUWVSPPEu Eu蟝 AE_tju{WY ZYuNtVPB ZYu7}t$PWҴtPh۴ {1󪋛uEEe[^_ AU҉t!ARA AXuUE tPuhj试 ø琐USUVS=]u t =t e[^VShڹ5d 5d 5hPv 44?2w$`Sh5d! dSSh5d V1H5djjh 5|h5d Rߓ ZV5|h5d 5rrUEVSu t~r6h+5dK =su%5djjh e[^3Ph5d ;7uH=us;tVC t8u7sh;JY^uj 3h  C, wPshC vhN5dh B3v ZYy;ulh h5d- UVS]ۋE 5<u;,tV=uu <=t ;Xt8u8tNt)ph;EZYt 5<e[^É,=thphC Ɖ] E e[^ U}E u0ha5dD dEE `EU}E u0ha5d d|-E `EaU}E u0ha5d贿 dԹE `EU}t!E 0hl5dl h`h`U}t!E 0h5d6 hhU}t!E 0h5d hhUWV1}SEtH}}~'E 0h 5d裾 e[^_ËE pÅXt܋E Ptڋ8ath=tXt=u;=@u'E 1;XtQRSV*S ;PuR+_R[*X뺾릾hE PEP (hźE PEP U BEBUWVS4EAHE hI5j|* jh|EUu=TQjju ;=С=tSE 0"ZYt===@19tvPR=St^P裎=\=\OhкhպY^t렃=u|R*_hRx(XMS&X