IPL1 1fffQRfB@f  1Ҵfff0fff%f&$ZfYˁtu1ɠ$<0t6<t%< t< t & G 1҉)׉։>6f[fXRead error No bootable partition PUWEVfd1440?-?@ WEVN @ @  f)Ȏ؎ffg:g<gJgLgBgDff gfZf)( RUVSu1] tPOC~jjR p5uD1 t3Ë` uuA9| 5hhh>=Jt3hhhhWY[t ghunPaP54`PuRuR55hh!%0th -u j hh -=8t)5hXZUWVS$Ej PMэv; t3t+=t=t= t=t h EЁ tt f=  u1҉ы}W5aP54`Ph h=uhTuW XuZtFuh_uV uuhjhut )؉jEVP5ujSht+uVN ]jSu jVSEЃPjhEЃuV   á á ÍuУ5T)BAuBIBAuhh'h)?hhh'WVhhS PWe[^_UVS] uE0uVSI D3e[^ UVSu U< t< uB<-usB< t< t> FreeBSD BOOT @ 0x%x: %d/%d k of memory, %s%s console Boot default: %d:%s(%d,%c)%s %s boot: Can't find %s Invalid format! Booting %d:%s(%d,%c)%s @ 0x%x Start address too low text=0x%x data=0x%x bss=0x%x symbols=[+0x%x+0x%x+0x%x+0x%x+0x%x] total=0x%x entry point=0x%x No keyboard found Keyboard found bad disklabel Error: D:0x%x C:%d H:%d S:%d %s Unknown device @O7/258;25|/-\ 08@hC@ <   hC7 i@  #'/mnt::: #'hC@ @@@<@T 08@hC@ <   hC7 i@  [> [>hC@ @@@<@TU hC  PS,8hCAhChChCHWVAhChChCPAhChChCAu$aAhChChCBC>hChChCC|hChChC P}/yhChChCI*khChChC w@AhChChCN0mRAhChChCO?IAhChChCD͍lAhChChCEjm1AhChChCF.G<AhChChCGHchChChCQ^Q   ... . ..groupXspwd.db protocolsX servicesX# $FreeBSD: src/etc/group,v 1.32 2005/06/06 20:19:56 brooks Exp $ # wheel:*:0:root daemon:*:1: kmem:*:2: sys:*:3: tty:*:4: operator:*:5:root mail:*:6: bin:*:7: news:*:8: man:*:9: games:*:13: staff:*:20: sshd:*:22: smmsp:*:25: mailnull:*:26: guest:*:31: bind:*:53: proxy:*:62: authpf:*:63: _pflogd:*:64: _dhcp:*:65: uucp:*:66: dialer:*:68: network:*:69: www:*:80: nogroup:*:65533: nobody:*:65534: ... ... ... . ..%share . ...snap dev!stand bin#sbin etc mnt$mnt1 mnt2 mnt3 mnt4 tmp usr0.profileX ip 0 IP icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ipencap 4 IP-ENCAP st2 5 ST2 tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc 10 BBN-RCC-MON nvp 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP sep 33 SEP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPV6 sdrp 42 SDRP ipv6-route 43 IPV6-ROUTE ipv6-frag 44 IPV6-FRAG idrp 45 IDRP rsvp 46 RSVP gre 47 GRE mhrp 48 MHRP bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPV6-ICMP icmp6 ipv6-nonxt 59 IPV6-NONXT ipv6-opts 60 IPV6-OPTS cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospf 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP carp 112 CARP vrrp pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP st 118 ST srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC pfsync 240 PFSYNC divert 258 DIVERT ... ... ...: # $FreeBSD: src/release/fixit.profile,v 1.10 2004/09/02 13:40:34 keramida Exp $ export BLOCKSIZE=K export PS1="Fixit# " export EDITOR="/mnt2/stand/vi" export PAGER="/mnt2/stand/more" export SCSI_MODES="/mnt2/usr/share/misc/scsi_modes" # the root MFS doesn't have /dev/nrsa0, pick a better default for mt(1) export TAPE=/mnt2/dev/nrsa0 alias ls="ls -F" alias ll="ls -l" alias m="more -e" echo '+---------------------------------------------------------------+' echo '| You are now running from FreeBSD "fixit" media. |' echo '| ------------------------------------------------------------- |' echo "| When you're finished with this shell, please type exit. |" echo '| The fixit media is mounted as /mnt2. |' echo '| |' echo '| You might want to symlink /mnt/etc/*pwd.db and /mnt/etc/group |' echo '| to /etc after mounting a root filesystem from your disk. |' echo '| tar(1) will not restore all permissions correctly otherwise! |' echo '| |' echo '| Note: you can use the arrow keys to browse through the |' echo '| command history of this shell. |' echo '+---------------------------------------------------------------+' echo echo 'Good Luck!' echo # Make the arrow keys work; everybody will love this. set -o emacs 2>/dev/null cd / @=@t;Xt88u] E>e[^M u =thph > ph>އYZul5|e[^U}E u0h?>5耎 س$GuE EU}E u0h?>58 س$E E{U}E u0h?>5 س$<E E3U}t E 0hJ> hh_>5蜍 سU}t E 0h> h@h>5f سU}t E 0h> hh>50 سUWVS} `\}1ۀ?tJH9sC`Ёv R3 Z D4%t1C<t\븋`tv1ۀ8to`[ҁv Rر _ D4%t-[v R^ ^ 4`C`<돋`}t~1=``tF`tv;tN1Ҁ=t;8u"9s2`Aʋ\+`H9rBtvŊAC`}1DžT1DŽd@~?=ƒ$St \u;F8|9t DŽd`=DžTƒ[t,$m\AAA<$ucA=wbtXA<0u?t1BF:XσdT;TtBFDžTt{u<]tu\uA]$uPA=wIt?A<0u?t5BF:XσdtT;TtBFtAF<,u9DžTITAt*<]t9\uA<A9uq,]tYIA=wEt;A<0u?t0BF:XσdtT;Tt BFFA9`8u5h>x Y[Ǎe[^_UWVS1}uU BEBfEtAHuh?E PEP t%}h?E PEP t}~E 0h%?5 E pYuسE Ptڋ8aI?t=N?uS?1Ʌt =tQ1Ʌt =tQjRf‹E 1;Xu;PtQRSV趝 Szwe[^_U=VStW=tN|X?(5(t(5(5[^UWVS4EtHu=hf?E PEP! u$E 0hr?5裆 سE h>j|jh|t=B?t =u=E 555W19u =(uPR=WN?uS?P =u@=t7?X?((d(jju o I=<==E 55E j4‹E 1;u =(uQE R=4N?uS?P ==?X?((W(K1 SjhE 4Ju uE 4h?B S; ==E 55j7z19u =(uPR=7N?uS?P趙 =u@=t7?X?((#(t &P:[F;uje[^_UWVSh1}DžuU BEBfEtAHuh?E PEP t%}h?E PEP t}~E 0h?5K E Pp[u سo1҅t =tR1҅t =tR1҅t =tRV}=u5h?臀 1PS|Z}Yu/ySh?? [_04,u(jE pcZYt[9| DžGWE 1;Hu;XtRuSh?*04Vqe[^_U40S ù?uQju u]Uh?ju uUj&=Yt0j=$h+u @ 5J6 ZP7 jh| UWVShEtHu=h@E PEP u$E 0h@5 سEE |h'@004Dž ZYu(=Džu5h?a~ h>jjh|{q;t =uT=Gh`S^_uSh.@5  E ڋ 555St9PVyZYu04 Vh< _X19ju =(u4Pס0 ǹ?uQSVh?b=04u@=t7S@X?(((j5u rje[^_UWVSQ}u t 6hX@hv} DžXZu%vhm@5g} سe[^_Ë40 *@E?u(E;t^ujVj?S(m[jh+jjWulj}e[^_& U}uU}VSu$E 0h?>5| سt)@5@tRh@5u| 5h@4{ [^=uFjr=Yt5h@5.| 5h@z XZj4^5|8u@P5̆$h@5{ 5$5,$h A5{ $hh@h@hhPA5{ 5$5($5{$5|m$h~A5@{ 05L$5>$hA5{ 5D $hA5z 5$5$hA5z ,=th`hhB5z 5h3B`y Y[=thhhAB5gz 5hYB&y XZ5X_$55̥K$heB5z 555!$hB5y (5t55$hB5y 5L5hC5y $5($hCC5y =pZCuP5x$hzC5Xy 5g$hC5:y (=h~A5hC1w [;5hX}%ShU85Fx  ;5h|hChChC5x سe[^UEWVSu] }u 1>Ru6hsH ZYu2hsH ZYu3hC5Rx $t6\$WhD5.x e[^_Uh Dhu uGسUhDhu u(سUh Dh0u uسUES] u1=̥̥{t 3h/DGhsG YZtPhsG YZu ̥;ssZshSD5;w س|̥5̥/$htD5w =̥t5hD5v 5hNu [X̥t Xس]UhDh|u uسUhDh(u uسUhDhXu u=Xسt ̥UhDh(u uaسUES] t~!3hD5u س 1=̆̆u>hsF ZYu ̆[hsE ZYŭ<usXhsh ML | M̆ =̆t,|t8u5h Es Y[̆75|8u@P5̆$h@5t ̆س]UhDEhu uسUhMEhDu uسUES] t~ 3hiEUujhsD YZu Х\hsD YZu Х=sTZy+shE5t سd1=ХХ=Хt5Х5Х$hE5s 1=Хس]UEt!Hu:hEE PEP u!E 0hE5gs سdE phFqlZYu9=سuA=|t5hEq YXE phF3lYZuMUSEU سu @Bt2h!F5r vriÅXtgS r@Yu Sh>F0 B =`t$h`hEF5pr س5h^F%q XZ]][b]UEt!Hu:h?E PEP| u!E 0hF5q س!E phFkZYu USQEtHu=h@E PEP u$E 0hF5q سE h>j|ojEh|;u ~=tuE ڋteShF0j[Zu =u@=t7FX?(((jju Xuj]UEtAHuhFE PEP t%}hFE PEP t}~!E 0hF5p س8E phF(iZYu!E phFiZYu UWVSE EEEEE;pu(juEUhUPPު YZu+=|EuE EGe[^_)n t]}E0Gu%Uh5GP苪 [ZE;GtE@G~ E@E~Uz E Et:~5}u}t U2hEG E0h^G5n }tNhG训Yt8uG1ӍCP&|SVǍ@P[ EPh(jW踩 ^Zt??|t:U|W[t¸GEu س1jjhuWu$}tt}e[^_^e[^_UVSEt;Hh@E PEP t}0h?E PEP uE 0hG5m VUE LDh(jQMM|诨 ^Zt5E8|t-PE[t¸GuسE hG0e ZYh>jEjEh|{t}=tQjjPE 4}u@Gu;GP諐=u@=t7E X?((E(F=t EH9^uj-M[9M^t u\Ye[^UWVS}u$E 0hG5k سRjjɽkÅXZSCYkX~jj螽hGd uGj/S. Y^u@hPP9 =ХtJ5Sj X=$Zu$BHBy Rj 蕂  5j Y^O~j58hGPS" jPS" ShM( jس蕘 ~PO9ZuVj覼^C_uhG( Yس سe[^_UWSPE1ۅt#Hh HE PEP EvE 0hH5#j E ph;H4cZY}hCHU BE_E phNHbZY}5hVHh 5 5jO]SHj u?5h`HUh [=$_u f` 5Yسs1D)E X EE p hHNb_Zt5hHg +u}uE p hHbY[e[_U}E سt0h?>5h N=u#=uE EHVg hhH5mh س U}E سt0h?>56h N=`u#=`uE E^Ff h`hH5g س UEt!Hu:hHE PEP" u!E 0hH5g س_E ph;I`YZu9=سu<=|t5hI0f XZE ph:Ip`ZYu UEt!Hu:hHE PEPu u!E 0hH5f س_E phmI`ZYu9=سu<=|t5hBIe YXE phlI_YZu UWVShuP} F{ 9}7hE4Vl{ G 9}hhVR{ CōPhM9_^_Hu jX[e[^_UEtHu:htIE PEP5 u!E 0hI5e سu uhIUEtHu:hIE PEP u!E 0hI5^e سu uhUEtAHuhE PEP t%}h?E PEPd t}~!E 0hI5d سE pphI]UESU |u2hI5d س/H|u hJ]Yrh J]XZ|]UUBSM |v1hJ5/d س/J|u h/J2]Yqh9J"]XZ|]UESU |u2h?>5c س/H|u hFJ\YrhKJ\XZ|]U}E u"t0h?>5gc س=thSJn\XU}E u"t0h?>5c سÃ=t jjvXZjp=Yt jjZXZj躐 UUҋE t~0hXJ5b سu@ hnJIYE EH[Uj =XujoX1=j nojh|UWSWEtHu3h<E PEP~ uE 0hwJ5b E p\E@[u 5hJ}u5hJ` qEx u 5hJjh|:ZYuIh\j蜳jnM y t4=u+5h@6` jnSj_سvh=hLaY_~&1)QPhv ME PPEHPQXZ1=j mSjݲe[_UhJhu uسUhJhu uسUVS]ۋu t~6hJ5f` سju&5hK_ س?jv@hسt u `jvh`t e[^UESu)5hK^ سt$h*KE PEP t}~!E 0h1K5w_ سwj 58س [=ZtC; tj S8 ZYh58hs C; thShs ]UES] u1=,,t!3hKK5^ سhs. YZu ,hs. YZu,'hs. YZu,5?$5,1$h A5^ ,س]U=|jKu1Phxu uسpUh|Khu uسUhKhu uسUWVS u] }t~ 3.}t 3hK3hK59] uhksEEo- Y_Et8h*@sU- _ZEth?s;- ZY{E~sE_y ZEus Y6jj蓮jj舮EtP}uE죈=}t =|t-555Q$hB5$\ EtP}uE죄=t}t =|t-5t55$hB5[ VjϭSjǭ1e[^_Uju uسU}E u0h?>5|[ سWh LTZu2=سu;=|t5hLZ YXh=LUTZuoUSPE] t~!3hBL5Z س=u5h?Y uEj EPsM[у ɉxE8tsh]L5Z 0 440 u5h{L-Y Y[RPhL5CZ ]U}S|u!E 0h?>5Z سhL|S|]UESt;=hu5hLHhLE PEP t}~E 0hM5Y =(t5hMFX Y[j E pkhP:n h uDH5hWMK CAhس2k܆@kto=$u# AHAyQ0 @5ݙ Zƒd u" hk;X{VC뉃=$u# AHAyQ @5n Yƒ tB@BtC=$u% AHAyQ| B: 5' Z x5hyMV س]UEVSt!Hu:h?E PEP u!E 0hF5W سOjE p։ÃXZutVSE phM5KW  |w1سe[^UQEt!Hu:h?E PEPg u!E 0hF5V سPjE pEY@Zt-EP? $L $E phM5V 1}سUEU u2hM5lV سHu EMvOBE EMcOUShj] SuLtsshM5 V ]UWVSWEt!Hu0h?E PEP; uE 0hN5U E phE^u س~hG葔[t8uG1ˋ}Ӎ<WWVP9j WhSqj WuSgj (SBSس>Eu6Ee[^_UWVSEt!Hu=h?E PEPN u$E 0hF5T سhG趓EZt8uEG1}ӍCP*|Suƍ@P]i jj0h?EE pV|h?̥U|04̥>xE(4VU̥0|De[^_U}VSu t!6hN5S سh.N6$ [Zt(h5N6# ZYth5Q س;=tuE EN]hx N<[uh5T5@ZYujh_ ^_=t5hP(G jj/h NDžnDž Y[XuƅDžX N7X NvK;/tNSh NP\ X=u$=RthSP _ZRt jPr [^FRDž|C=t:;u )j/S ZYt@P9$5R^_|PjP+ u|tPh5F hPhS[ z\DžTR1;PsyT1XЉIP߉I9Pw/XIQSX uS\Y[TRT\xX$\ XZ PhPj, e[^_ÐUWVSEDžDžu} uH%hLE PEP u E 0hQ\Dž 5h9 }+j SE p t 9 |ڋ ;hu%E phQ5E سhh$PY k ;Cҁv R j ^ D4%@uѾ $t\CS=wY1u Kk |CЁw uދEK9|uȥ)PE tVX E |AiuOC;EDž}<ȥ)PE 4VX E <1эt1 F<; }0zYu 5hJ+u 5hJx t*=u!5h@%B XZس=|tN5hA Y=$_u$BHBy Rj Z  5j XZR5@VY=_tG~tA=$u)BHBy;B| RjZ 5jH XZh$PhPW {@EE k 9t C9ct;E,e[^_ÐUWVSQE1Eэqߊ< t < t< t< uGVRW! 1҅u4t< t< t< t< u< t < t< t< uGE8ڍe[^_UWVS8EEE%P҈UҁH=<ӋUEUu.=v PGf Z D4%tFFɉ0E=w uUvRe _D33UE EE@EU:Ee[^_UWVSEUt.t*}t$} t}t}t}t }t} u h4QjV EUEUE EUE Ufjh[QuE u"EUEEfP6jhcQu u(EUEEfUjhjQu uEUEuuhrQ U tP/E XUtP.E_UtP.E^UtP.E[U tP.E Y3U1:%j/R _Zu ub/+]CSSuP&S E8uFV4U $@W [^tbE8u \U C:Pj:E 0Q t@PָUYU 8Ut*?[uij]_S ^Zt @t<:tuuWhQu)PÍGPWS W輵uuuWhQE1ۀ~:u^j:W ZYtCUۉ:t1jST^_uuuShQ Uf]}tuU[E 8uhE9ַU Y=ХtpU u*UPffuRUu*PUu*PUu*PU u*PhQ5V< 1e[^_USpjɍjdh"R]SQ P=$Su @ 5 ZP;jh }UWVSLjhcQPDžDžDžDžDžDžDž 1 PPPPPPPwU@tt8tt8u Vh8R8j;P Y[hIRP9 YZu DžFhQRS YZt5hYRS _ZuhaRc ^VShRQ vVDžtj@P t)CP\;[j: ZYt@PXH8?t6>t1j/V 9[_uu xE9t{1u t=Хt{u*Pu*Pu*Pu*Pu*Pu*Pu*PhR59 $=DžDžtQuHt >thRV ZYt Džt ?thRWg Y[t Dž=t jjXZ EԋE؋Et EEEPR``Y`[t!Hu3N uhS t tEPj莩EPj9h&Sj XZ1ۃuj/V Y[tC=Хt+ۉu*Pu*PhJS5U7 t>taEPjEYuEwX=Zu0>V=سF5xhcS5 ^_/ۉ-t?uDž t3hVSK hhE9SK hWSK ߃$E*@}Eu t<=H((t E'@ES@EPj(R=,uj/W Y[t@,=,,=HEEEt Pj/PjXZسdљu DžtP%Dž_tP%Dž^tP%Dž[tPk%DžYe[^_UWVS DžPPPDžDžPDžHDžLDžDžDžDžxDž|DžDžDžDžDžDžDžtDžDžDžDžPPPPwU@/u0t&8t!hhTP2 ^_thrTt8u,Cu =,uhT~t,[uj/t ZYt@PtA_t 8uhT4=ХthT52 =H04DžTDžXDž\Dž`DždDžhDžtKh(jm [^t5:|t*XPR-ZYu04Eht U2 ^L_uthUX=$Pu LA L [Pz,ZYu#x40 tGjR=$Pu LG L< _PIv yth*U2 a=|thFU5 1 40у tRPhQU50 5j @0 [^uu.uhODžHuhOoYgU>hODž[oZ8PH1эq_{8tvj:P Y[t0j PBPR ‹ 8uA9u61эQ9rR)SP hP|m _ZdtPDž^u&ug PPPPPPPqU@-w/t%8t t#8thE9Pj Y[t h{U.Zt~j% ^_tkhUC Y[tPDžZtPjDžXoPKDžEtP,DžXtPDžXtPDžX质XtPDžX1}ԹxE؍PEPjEEEk tP$hM_BtDžӅSojjjhVss thhHVA =|t;tVhU5, SffBs js( y hUm _CssP[ y2PhU@ P+Dž [yhVh?P0l [=|L^thV5+ 1'Vth=|t)Wh+V5+ sfh7VLr+ =iLhIVRh\VL<+ j:蛼 tF!PiZYtj%Ss ZYtShnVL* ShyVL* ffPtPhVL* LhVi) LhVY) LhVI) 40у tM5W)) 5450hVL9* 5450hV5* sF(=tLhV( Y[hV˚ ZtPhVL) hChChWL) } t9=|tWhW5) sF u hRWL{) }t4=|tWh1W5X) F uhLWLA) =|tt5h ' [^LhV' Lh` @uhfW-jha:jPLcu&h{W HtD< t< t< t< tŃ=ХthW5f( j ¹ ZYjj @RPJ Ƌ t*Ёv RrM _ D4%@x[t Yjha:jPLbHD< t< t< t< t=ХtQhW5G' Wtdj P'у ɉ£ 8 =ХQRhW5& WW8*u@j SP ' ҉dh}8-nj @SP& ҉\`Gh9`5d9\!8/Px*u,j PR[& ҉TX8=Хt5hWH$ XhZudu5j*$ _X+`\hdhW5'% XThW5% 40  hW%X(Sh4X u4ShNX uShhXׅ DžH8u(P [=Хj]P $h~XNXt/ =Х|YhX XteGuthXv X=Х5hYF" XZYKu0Y7\BYu=Х9jhHY:t XS=ХXhkY5" tDž_/!,}d3t1 1t540 hYO |t |?u hY1 WBW~ hY 1uD=|t|hY5! u u|} =|t|hZ5! | uE DUD=|uD9ttuxhV85! t ?u hZ D85hDZ 5j Pj! u(=$uf` 5Ԅ v R4 [ 4y 11ۋD=Х@<Dž4Dž8Dž0tQhhZ5 BYt6jhZ% uj"S# ZYuhZe _X)؍XS.$P4^4 4hZ5a t+hVS,4 ShV854 h5V ^5hW u)=$uf` 5&[01Ƅ)M XP`Zu~tujSHDžW SDžH@u*P $x $h[5Q $ҡ |vj`X $DžFjh[6h[h[h\h\ Xh;\ ^_tPjfY[tPj fXZLt LV @t P#XPtHt HPXtPI Xt >_tP-Dž^tPDž[tPDžYtPDžZtPDžXtt tXtPDžXtPvDžXt WXt BX|t |-_xt x^e[^_USjhW\P. hCS! ZYth^\S ZYu 5hd\:h\S ZYu 5h\hj]S ZYu5hq]6 Y[Ih]S YZu$hhChCh]5. Sh ^5 5j t 1jjh[QSG t س ȉיut 5hVaʍ\PXPEPEPEPURhah}5 h aS7 ZY س ȉיut5h}aHt\PXPTPEPEPEPURPPLPhah}, LPT1UE E E fXf\\PXSTPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPURPPLPhah}\t5haLPT11DBvfXfS h`Ss5 [_  س ȉיDžXut5h`KP\PJPIPHPhbh}~uH:Iu:Ju:Kt5h$bjhhC8 \f=%h2biPh5P r xjh`}h7 =(t fPtPYjjP9 £Pyh豶 =(u2j`PjhR@uhKbhXbx XZmPh5P yh%t;j`Pjh5P[@u=Хth`h_ _X1DžD󫍅DPh5P; @uh_ǵ [jD5PpZYy hfb虵 _=(*ƒt=x=pjhdP&6 G eu Dž|j j VhSdPdR uVVSWhmb=A=Хpt5h` Y[t tIPPPPPPh}byǃPPj'P&P%P$P#P"P!P PPPPPPPPPjjhbǃX=u=(u(]1t (=uBj`Pjj5PDž`\@u=Хthbh_ XZ1)5PP_t (e[^_UWVSH=,jj5PZ rPj5P; @Wj]ġPSEfExXȥUY~B5 سBj1ҡY}hWn jسUXZ tj(X]USpj@jdh'c]S P=$Su @ 5 [PjGU jhwUVS$ҋuu*hSc肭 =Yt سjTjj=$ƅƅƅPuBRU ZPR t h#P Xhhvc5$: 5$% j (} h# X=t سjITXt4t/h=$PuFV貣 YP jZu=س(ujp^jhe[^US h?uEE( ZYE?u=N?uS?E4u=Ćt =u9lt jS]YXha+Zt5hc 0j=Xu&5hc jس9lt jSJ][Xh}hcZYuljhuY[hju>EXZ40 tRPhcm uuuh[U Htuj+>j} tU :-tRhc5( }tuhc5 =tuu ui 49lt jPY[^jDž`Dž\DžXDžTh:qZYt=Ȇ~ j`XhJj:h$jy:h(ju \# u hX ] ;|uLjj 3:] hCSXhuShM:XDž`i hu ^h_uu h?辥 سbE=$Dž``Pu hB hm [PFZYxE%=t%u hd5Q س EċUȣ jho^_ 40 hS?uA" Y[thI?u." _Zlt |_wWj5450h 5j54=$50u hC hV ^Pc+ ƒyu h?M Y[ 5450hcV  DžT?}tuuh[* uhM_ZHM Td^ho9v&lotP[Pho7`loYj7jj 7Xl M=jEPM7ljXDžlZ~ s19סho|9vQ=$5lou hB h軚 [P p $)׋lop=$Su dB de YPR l~)pÃpl=̥=Xt =$EU9Ӌ |e9r_=$u)BHBy;B| #Rj#T 5j#o XZËEUډEU5 Xzj|PU+U|+E^҉tx_yHt@Bxt@B+xPp[55ho=$Džl5lou hA h YP p $lop=$Su dB d莘 ZP{ l~)pÃpl=̥.=Xt =$EU9Ӌ |e9r_=$u)BHBy;B| #Rj#} 5j#m _XËEUډEU5+ ^=̥=Xt = $ɋ  9G|9sA=$u)BHBy;B| #Rj# 5j#l Y[=$u$BHBy Rj  5j l XZpyu h?؞ _Xl@p -i=$u)BHBy;B| #Rj# 5j#:l [^5 ËEUډEYU=̥t6=Xt =y$$EU9Ӌ |`9X=$u dA @d1 Z=$u4dCHCy;C|d dj % dj ^k _X $=$uBdBHpBy;B|p tdpRQ dpj [^ $=$u/hCHCySj" !h@ph Ypp=̥=Xt =$EU9Ӌ G|9sA=$u)BHBy;B| #Rj# 5j# j XZ=$u$BHBy Rj  5j i _X=$u hC @h/ ^tu h?ٛ Y[=$u d@ @d Zt)]08 t hd螛 X $j/`_th`Džh^d jDždY $[\j2/X=ȆDž\Zu سiPxPPXdtd DždXjس $_|vjL(^\t\j.Y[XtXj z.XZPxPP_`tht h`^dt d_ [PX04 $e[^_UWVSE PEh?U DXuDžLDžH#d $E40 EE[^t^=|tU}tOPt*}u P;-tPhc5 }tuhc5 =tEtuPu31҃=DžDDž@Dž<u EtjUhcZYt=Ȇj4XhJjY,h$jM,}@u)h(jPz ^_P8|jPLY[j/P衃 _Z,8t ,8 ult;PjE9tۋPuPYۉ8^t/8x)=uH,,8 u5hP_ZyPh?Q س=t/+8 u% =tPP^y Eu=ltRjjIY[E49lt jPIXZjuvDس^=_^ @W O jh'aY[ Et)40 tRPhc  }t];tSuh[_ uhMM_ZH hAH^K }h(jPC Y[u$|LXDP:|uVjj )PhCS<LuShMEXDDžDi ;uPj _LZuPh?6 [^u DžD`E=$Pu LA L YP@_Zt$E%=tXDpo9Lv&totP^LPpoCQto[j(lY t EtG40 t6jR=$Pu LB L& ZP3 =&jhP(^Dž8(,_,r (c19,po(| 9(vQ=$5tou HC Hh [Pi  $)(,W=$5tou LB L YP 98k=̥#=Xt = $EU9Ӌ |e9r_=$u)BHBy;B| #Rj# 5j#V` XZËEUډEU5 Xj`P_d+l`+h^҉X\_yHX@B\X@B+\Pha[&5po=$Dž85tou HA H蠉 YP  $W=$5tou LC LX ZPE 98=̥R=Xt =<$EU9Ӌ |e9r_=$u)BHBy;B| #Rj#a 5j#^ [^ËEUډEU5 Y=̥=Xt = $ɋ  9G|9sA=$u)BHBy;B| #Rj# 5j#] XZ=$u$BHBy Rj h  5j ] ^Xy)y$8 t h,d躏 [ $988xPh2d@ sE40 jjjL 11۾149ӡ0h|9sb=$u/LCHCySg !LL@L Yƒt3 ujjjL Ph?荎 XZ5 E@E=$u)BHBy;B| #Rj# 5j#[ _X5 ËEUډE^U=̥t6=Xt =y$$EU9Ӌ |`9X $=$u)HCHCyS H8@H [ǃ uEt~=$u LA @L蓅 Y=$u4LCHCy;C|L Lj Lj Z XZt\te =$u7LBHBy ;B|< tLRQ& LW`Z [^ $=$u)HCHCyS H8@H Yǃ=̥=Xt =$EU9Ӌ G|9sA=$u)BHBy;B| #Rj#P 5j#Y XZ=$u$BHBy Rj   5j MY ^_=$u HA @H諃 [t) 8 t h,dN Y $=$u LC @L] ZtPh? ^_jDD[tLDDžLYH jDžH薿XEZt'EPhBd5 5hvde  $ɋ )E|vj X=DD`juA9T^@_jpS$STPxDž|&@TP( $ $Phd5 ijhFTY[u/hjX=ȆZu س4H_$س |vj^@t@jGY[<t^_uh%jhx%j E0j@VG 1tp軃 EĉuȋUBEE`t\`EPE@P5Y=`[ut jWV^1 tt?=u6Ph i5h 5txM=kt}t/p'jh@V=h%jhx%j U=u 臱=$u @ 5Sj YP( ;ZUWVSL=|u=Xu }KjP'+w+w^҉_yH@B(qڽ $څ11ݝ |_vX݅ٞ։vAQٽRf,$ f٭߽٭؉Ѓ 5t(S5$5 h$ihP$ ٽf f݅٭۝٭Q~LعQӉt(RQh7i+P P# ؙt.PhAi+P P# غ<љRPhFi+PP# É @ |vv;Py   )Ӹdkd y PhQi+PPDž" }=$5  ݅ҡ 04񉝰9|9+RP,$WV,$ٽܵf fܥ٭۝٭عËhci+PP!  t.ShAi+PPp! <әRPhki+PP1! +w+w҉yH@B~2hui)P  h++PP }Su =$u @ 5d [P辮e[^_US}$ҋ |HvA=t0j=$h+u @ 5rd ZP_ j$X]UEEEjEEEPUjU$U@E EEPE }ЃEE$EPuݦ xUUMw1ҩ`uu Qhijk Ru QUWVSP}u:jhw襩www0ww4XwZjPi0  4$+w+w^҉_yH@Bw9w|E9v;www wDžxȥ~w9~dPz PhihS P=$Su @ 53b [P  jj@jjh@4=ȥ =X}ujh:jj}ujjjm =X$hihQDž D t.PhM+PP ҡ RٽP߭f,$ɀ f٭۝٭y1 d~dVhi+PP, ,=vDҍXt1I)˅~K։йdh)Sh;Phi)P 1 A |vvރBP;PVShi+P PB +w+w҉yH@B(q$ڽ11څ |WvPɉٞv?RٽVf,$ f٭߽٭ A |vv;Py   )Ӹdkd y Phi+PPݝ =5݅ $ۋ |"vs9 |*9v"ظ+hjP)~1ظ+hjP P +50=4WV,$SQ,$ٽf f٭۝٭?~~4hj+P5P Ɖ ؉֙t,PhAi+P PB +h+P2P Ɖ ؉љf<RPh*j+PP ؃}u-h++P P  =$Pu @ 5[ YPΥe[^_USj]U=$Su w@ 5w Yuz=$u w@ @5w[ ZuV=$u# wAHAyQ @5wu [ƒtBv t,tu1"xB\u:=$u# wAHAyQV @5w YˆC=$u# wAHAyQ @5w Zƒ"rxxB\u:=$u# wAHAyQ @5wc YˆC=$u# wAHAyQy @5w& Zƒt t t t ,g1=xt4C-=thx3 ZYtۃ; ]UWVSx1=Dž|hhs ^w_u$8=hhM3a Y['hS _Zyƅj.SEn4 [^Džt tDž|||o zhxur ZYJhx5r ^_0j.53 Y[t;Pr _Zu))ShxPs u xj.u3 Y[Pcr _Z+]Shxu:s x_te tk7TXU uhxU hxP [^(<U thhP ZYt@=$Pu w@ 5wW _P[^x ?+EE8hxUf=$Pu w@ 5wV YP艛_Zx ?TE8HhxU^3=_ t uA=$u#wBHByR @5w\ [Ãu t u5hPjhk1GFf=$u#wBHByR* @5w YÃv S Z D4%@t{ tE=$u#wBHByR @5w` YÃ0C' hu k܆@ktu=$u#wBHByR0 @5w Zà u ~tF뢡hkV@hu&5hoj3 hxhj] _X|t0 t+\ c@hj\ hj85wE 1>5hL5hkhj\ h0k\ [^5w e[^_ÐUS]Ct&Ёv R Z D4%@uhckSm ZYu xujh2OSn u |UhhkSm ZYu 8h-Sym ZYu htkS\m ZYu ]UWV=ХS5|u |hLYtWj h. 1[Zuj h- ZYt {.uK;hhyk5h tjhkhn uVt  Ćj hGuh@4 tbh@h=5 Ht  Ćt*j hkhWn u5hkx [_1t@~hO$h!衔Yu)0B9E H9]AB߃=t u(j9tvmu9.tlE H9so]AB݃=(jt 9t?E H9sB]ABE H9s.E%E H9sM %B9s BEEhM[^_UWVS1؍}Թ$EPEPhvuVEEE u u" Y=ХtVSh!o5< 1e[^_UVS]u SXu ]e[^&UyUWVS(uVjjV荃ePjVp @L=ȥufE~jEP覂ȥEXZuu Và C#8$=ȥ~JjEP\U+UE+EY҉EԉU[y HEԍ@BE؋EغәiMy1PjEPfE u 8tu <SCtgEt:EPEPhhVE裁@t7}tGỦ ; WjV#1҃ Je[^_US]STuYu Sh¨tt ¨uu 1=Hu%t th1#hd/ jU)uu h/ Yh/ j6fXZUEhu 1Huthhj/ j2U"u h3S/ Yh\F/ jeXZUEhu 1Huthh. jT"u h́. Yh. jReXZU=@S@t.Ct8tP3h#n j X;j h4hH9h~un 1]UVSƻ@=@t=Ct.8t!PMuTP3h\1n j AX;e[^UWVSP}E25xhiv VhVhׂ5x$w 1E tvE 0jh@VE GzPzutS t21:Ct!PC 8u RhD`m {t jS!EXO녋Ee[^_UjhPyU=Et't 8tsPh%t 8tLZPh:l XZUEWVS} V}uxhH9wGxZYuhHw4x[^tR=ts3h~fl ;j sh4hH9h~9l Gjh@wx u wh\PxYs tp}twh| YZu'wha _Zu h+ hCt!PC 8u RhDzk {jSY}thP8xZtwh5xt 1l{twSs 3hk Bwh讯 Y^t GU‹C C bP3h*j Ce[^_UWV}S} 5xhAr hH9w6v^ZuhHw#vY[tl=ts3h~Uj ;j b1h4hH9h~+j Vh|Vh5x`s 1m}7udjh@Vwv tPvZuC t.Ct!PC 8u RhDi {tWjSYOPevZR{tjSs 3hڄYi !C C P3h*6i M)e[^_Ujj"6jj5jj5U=t jjp5YXjj"5jj\5U=t jj4 jj"]6XZjj4UQuhj( h`( 1'ҋ`t !jEjEP9UEUE1USh- ( X= t.Ct8tP3h~g j X;1]UVS}u th_Yjh vNt u vhPtYtvh5xp <{ t!=uhU' hK' XZKtCEe[^e[1^UWV}S@=@t;F t,~t&8th|hՅf XvhJAf [_>j Y='t28 t-{uC "P3hۅ s 3hf ;;}U )jh@ËE 4rS6su V)sZt U 4huuE 4hf 1t3F t,~t&8th|hՅe XvhJAe ^Xt8t28 t-{uC 9P3hۅ s 3he Gae[^_UVS@]u ~FPPh'Ne ~F hf7e 5j2]S&o ؃t5|迥 e[^U1=h}$ =u Phd 5|l US\EPEP)ZYjj1ۅkEPEP)t"=tuE9EuE9EtN%jc\]USg\EPEP~)ZYEttth܆r}XhG ÅXuGj/S ZYu@}~jhhGPS2$ jPS$$ h}jxejEPEP( t$=t}uE9EuE9EtM]U=t>j5@gh# 5@(}uhE p菧 ZYt jh uUjj.U=St.Ct8tP3h~b j X;Ћ]U}VSu t5xh wj @jhvn u vhBPoZtvhn5xak 1s S3e[^U=@S@t.Ct8tP3h~a j Y;Ћ]UW}VSu 5xhi jh@vn u vhۇPLnZtvh 5xj CC 9t=3{ t(Ps G9C =|RhC5xVj 1v vSe[^_UVSƋtVsz YZu1e[^UEt@UEt@UVuSt@tPYXC t0PYX'jYáCYtXV:CCV9 Cu |9 C e[^UWVS=0?t0j=7 ZYt@P7C@=[^˸@ 8:tjhP; uzj:s ? ZYhPB 1E΋эL1QXPhV赀 s Xs u(tp h_h% h0h&e[^_USEt8PtPCtPWXC tPWX]]W]UVS]uShfuSh5xg e[^8ve9XEe[^I7USt&s sC*Ph ] ֋]U}U t+@(ttxt9Pt1UE1҅tP U=S5h_[] [}X~hE p ZYTtHh =uCPhF] =uCPhW\ .8=tuhoh =Xt h X=uʉPhщ\ YXt)=uCPhj\ XZ hP XPhD\ 5| ]USXӃt 1Ƀuj.hPPpu ȋ]U1ɁU ЋpAu퍅pPAPUUjhhhTXUjhhOhRjfUWVSSS}EE h1;ujh@E 4g PhYC ;E|-33{ t(Ps hM5x@d {{BSUpt=u}th h Xh 9Z}Ph h֊y ho h=ŋE 4hZ U 4hWZ _11;ujh@E 4f u5xh2b aYX{t.G1{ ~U DP1{ ~U DPSEXs Z?$jh AS$jh +shhSFL1;}e[^_USjh P f u jh`Se]UWVSQEEu }sQ}u>=$u$|BHBy Rj y  &5|j  XZjjY{jjP{=u5hX [Xt_~F< t O~FB1t.J: u(t =h] Y=t5hJX XZ5hh3b uO=$u @ 5A[u$=$u @ @5} Yty7r=ti t[CPdZthuh{ t=uh} [h 5SZY}u(=u jh Ee[^_\Oe[^_UWVS]u:h Y= tiGtP7jhzNV ?K~CE E 0ZPcZtVhB uVh^V _Xw ^븍e[^1_UWVS=}] Dž8Dž$Dž DžDžDžDžDž t5hxJjhopenf U 15пѸ)PЉсQ_ =3OhH3A YZhH93+aYZh3 YZuOqh3 YZuOmh3ʙ YZuOt:* u  uOVhT \P\  tՃ1}Թ󫍽@WuVjEE uWVjE ÃtXSQ$hL 5xx]  K0@- $hL 5xG] @ _5@jhS t T ^ t ? [e[^1_U>? Uhh#h<hb5h5x'Q j UWVS<] uEE j/3ZYt@jh5l# 1 HxctKd084DEF-SLN Xa1n9fRd+e1kJlNusrUsUx]yawm^K ?0jEP5Dd U :u;Dt=v.h5Dhʎ5h5xO @5DMD5hߎq5hd5hCW=DZ5D=XL~CDE9-5hu 5h5x@N hяSV誝 p=u1=p)ƍ~UȅEĉUth EȍEЉE}X}th UEUXUNU~ CUEh _t%jwO^h r[jjj EċU)PPFHZYe[^_Uhh@h  Huhh@h Htjz |USĀ| Hu@уӰh ||PjjBRIu )8tyh\gX @|]Uh !UVSh YÉY~.h ZujSjj5 5@M ÃyG茞87t;肞8#t1:5[5@h jh`1ۃ=ttAS5 j>v; t,Sh Y9Xuh Zt(1e[^ÐU1W}SU ]EPPډXP [_UMQB;As+QBAUU9BUE@UUBE ;B r+BB @ BUU ҋMtEAt+yA9}A;Q r+Q @;Q Au ;ArAAUS] S9u C9CrC )yC[US] S9r u C9CrC )yC[US]St9uK9u C9CvC))‰yC[US]Ct9uK9ruC9CwsC )yC[UWVuSt>uJ9Zlj| u9XSu Ep5 Suz] )e[^_ÐU=$u |@ 5| Y=$Lu @ 5 ZH蒛Uu u5LHUu u5HHUUUx9u :'y9u=t'v'op9ut_(Oz9u*(=9u1%+Xu&u9ui%s9u %1U=$jhtu |@ 5| ZPEUh j踉 j,h h` UEwi$,qx]yVpOsHuA|:}3q,%ztv~ 1Ujh0hp US4]؀9LX Py4Zv;EP5HΈ YXEPj5Hӈ  P@4w։j,h`LEP` E؋Mt=`E؉MtM E؉Mu e%=T} ME~EEu$E EEtEE؁eEEuEMtMЋEt@Eu EEt E̋MЋUtU(% ‰UԃCMEtlh{jF^h{j:^h{j.^h&|j"^M X-EC U}  Ef U} E E}I"#h Z~$jhh 2jh!j>,E? U}  E) U} UMu{`9tlugЃɣ`uh Z~$jhh jhj>E, hʐ YE&US]h  Y~Etj hh Bjhj hh (jhj>+]E]/ U t HtRh. UUtGU"dUWVSV}u UdEBM=wl dBãdu BdddB}du BdddB}du Bd[[^_ËdBU=Sw}dPd@d@Ád~Ph 9Z~6d-Phh d-Phj>!* hA X]US1=Ts&PyPPt 8 t  Ӊ[UWVSE E}M}҉U_~jjRkE ӉEUGֈEU:uUA9u_A 9uEU舂GARY u؃9ƉEGȀAWE舐u}tYAPAPu mtEe[^_4#e[^_US6TsJC t>;uCCCtPCP-iP j"]UtiU=Ts@@ @ jYtjZtj Yt%%jg8Zt4=b4=j8DYt@I@Ij PZtLUBLUj \YtXaXaj hZtdmdmj |tYtpypyj MZt||jYtjZtjYtjZtjbYtj3Zt b =u8jYUSFTsICt=8t7uCC CPCP-iP# j]ËdUB;VS+5}^u~\dPd@h ds9Z~'S5h 'VPj># hA4 ^t%Pd[e[^áUthPsXZh0Yu*h` dPddBdBdBdB'dBdBdUBdt@USh]Si ZYtWhSi ZYtFhSi ZYt5hSi ZYt$hSi ZYthS~i Y1҅[uЋ]UWVSQQ=]t;uOjjXZSXjj_Xujj[^SYjjÅXZuVSE1эt } d_Mt}ыELHL19 MD19vu)WR_ZYu-h d+d)щ dSGd^EtMdCt7dB;wP~ =udd뺋]t#dB;wdE떍e[^_UWVSWWE }EE1?u~}ujV;]}Rt&u}t u^tu CtFC;]|}t u[Ee[^_e[^_UWVS+Phj<Bƒ $qv;dB:S=t=tP _hTh^0pPjS dI(vDžd S[@Dž\@<:t\8|uG\\uލ PDTTYWT@΃1DžX@Dž\@cc|t c:\B\+X)dt)PXd uXTM1XыTPZ9sPX3 t݋Xc:\c<|u\\|c勍\X1c t cyOcv S'N Z D4%t%v S [ 4\\\ ɈcwTx@u21@u T9sB@VT9u:dt dT9s BT:tT51I(wSY 8u B1h ~9Z}>hhSjjhhh]Sg? $WSh FjhБ$)";B:lPhPhhhljj hhhMQ> }10h s9_VEPh CPE_j;Y@t2 t8@t t1T"T j9 Bt(tgtTt+|t/)PR)PR6)PR@)PR)PRj)PR ? 9+t )QSw`;B:h蛽^t1ۉI+vjj#Y[hhRjj#hhhtj2R薕 x(h s9Z})VtPh eCPvPj>  hCq Xe[^_U1=t'jh j US]t jj*YXt jjBXZ]U$jh |$jh h$jh TjjhhU$jh $jh hhh=tBU$jh $jh hhhZU$jh {$jh ghhhU$jh :$jh !hhhUWVSuh \ 1Xh u]EEEEEE)79؍}Z|SVh CPWj>e[^_U$jh o$jh [hhh =t=tjYU$jh $jh hhh=t,=tj^XU$jh $jh hhh3=t=tjXU$jh ($jh hhh=tR=tjXU$jh $jh hhhYU$jh z$jh fhhhUWVSEPEPY[MEuEE}EUuEU BuBEBuBE܈BuBBZh 5)9Z|SVh CPWj>e[^_UWVSQQ1EE%u>}tuhXEEZh5GDžXOFE$q u=u=Pl ~Hu,FOE=9=, u uFOE?=u=u jh(Y[=== !==jhXZs $qN?0!hhhQ! j =Bk==jhShhQ rShhQ SShhQh S<ShhQ@  t,Btt B!}tzt #t |/'t^vjj[X%hгYtP4jjLXZjS cYX ijSDXZj0 jSYX6"u1jjXZ cjj[Xu !jYShhQ  t(Btu Bu8t."u `t jSXZj/XjYu=tb=s =sShh8 =s P=s =s hZ}tuhN^_1}u}te[^_UWVS,h EEZt4=u$u=tu tEhyhEY^t=uE1=luhZtf1=1҃}RSuPuVhETE1Eu>}tuh"^_EEh=[GẼډEu NE= t$9 e=ts.t p9ujhV z9u j h jJ 9tU9t FOMɃ t u` T 9u$9~ )ރ}uV5YX~Sh#XZx9u )ߍGe[^_U1uf=ttt=t'u-=ht!9~t `U}tEUjÐUVSutEv SO6 Y D4%tv S< Z 4F봍e[^UEjPuu u US]t;|tPR XtHh(jSK ZYt7hSm ZYt Sh@4 /Shv5x, jh|h@N ]UWVSQQuE} EEuEPh5 =tC~9s(P*t Ph5 CԃE3 ~ 9sPh5W C E ;|u PhV Pj  XZ|6Ee[^_lF US=\ME ] =u4w4QhSQh5 =t*=t=t=mtn{ hcRQh5k /w54u5hĔ XZ,Shf5' SPQhʔ5 ;|uPhV [XE]EE E E ]: ]US1ۊ/w P4wP4hӔPSh* t//w 4w4hmSh e/w 4w4h>Sh'6t4/w 4w4h5ShC XZ/w P4wP4hQPShh: t//w 4w4hmShe/w 4w4h>Sh6t4/w 4w4hShŕ YXC]UWVSDE=\}Eu!= U : }}RQ 5Pȋ XZ"M PP5  C9=$u)BHBy;B| "nRj" 5j"R _XSuE 8t+EE)e[^_UW}V1St4 .'1] ;t3WZYt|ۅuۉ]e[^_U1}ÐUVSPPu EES PÍEPh6S-e[^UVSRu ÍEPS5S1~Ee[^ÐUE EtPXUVS] u~K~Ph' ZFYe[^ÐU UWVSP5MEt>u9Q@A49‹YHsD9uA9u9QtEFuu 5耉 @t}t @1ҍe[^_UVSuM FɋUX$t Iҋ tNHǃ u"PhV hAjǃ uPhwV thAj̳ 5|N1 Y?tDtTthAj hAj 5|1 Z%B 1e[^UES@@$P] N< =ZtPRS;>tjjC txtjpS e[1^UWVSSS}]t EEPhht@j11 @tu}} tltPtL  t k C;p89`Xt k C;x89}Etu]hThzL YtNu#h胝ZyhjS@W ƅu#h\YyhjSW DžufufPh L Ztj jP ƃ h K [tj jP ǃ }tE0}tE8e[^1_U=$Mu1|BHBy ;B| t RQ ZY 5|QWf ÐUWVSj&uFTEHU ;E듍EPV+-ZYM;Uu0EPEPjRV2+E]9CXUM E;v_PV'1[_EdӋE1Fdu+FTu-jjjVs%u FTuEHU ;E럍EPEPjM 1V*t^t Ut;] CEEvdPEPjV诟EBU B;Cxv!PCxPstV聟lCtKtCxEMT] suu su3VS-$E M9EPEPjRV)t^t Ut8EEEvaPEPjV輞E?E;Cxv!PCxPstV葞|CtCtECxE䁋TU BtPuu MAU] EMK@RPQ CU+BEHPu3V.,M yjEPjRV~(t^t Ut;EEvdPEPjV蝝EB;Cxv!PCxPstVoZCtCtECxE䁋TWuu EPEPjU2V'UG]BK96)ʍD:9vhjVCL uet^t Ut#EEPEPj;Cxv!PCxPstV莜yCtCtEK1ۅt^tU;StuHT;Cxv!PCxPstVA,CtKtMCxE䁋T&;Ev!PEPuVE]CUERM@PQN E+C| WuE 0V)unUM E;v[PVZ,ZYuRdӋE1Fdu+FTu-jjjV u FTuEHU ;E1}t/t"FtM;HtuT u踾Xڍe[^_ÐUWVSE} ptW^0F09tMCu/;N09ϋCuF4GS9ʋuF0S[Xu P Y_jj ÅXZujjuI ;} t9hɷu J Y_t&u CZuSjjuI1V0F4C9V0u^0F4^4؍e[^_UVS]u tP蜽Yu ǃV艝 Zu jjSI e[^UWVu SuEpH1҅UZ BLCBPCfCfCC PrZthηs juNs C {XyBEPB0 9CuB4AB0K9{uB0tW褼XS蝼XUB Fxt-PP_t$}uhݷsjuwMVu*Vu=FX uNFLt PYthvLju,MFPt PqZthvPjuMFHtPXFTtPvXFLtPȻ_FPtP躻[V賻1ҍe[^_UMQ1t*A @@t:} uh jQ&G1USMQ1ҋ] t2BXt:uhBjQF] M]]UUSD]<t k Bx8t#jSbYZujjSjb8#t X1҃8#uЋ]UWVSL&EU@R }tru Y[Džu@DžEEuDt;Ut k Bx8tEEE‹t k Bx8t @t+EPu}_ZuEݸ Eu;t2EPuC[^u E&uWPju EEPuZYDžu^tKEuEBXtB<9EuB@9EuBD9EtEuuPujSDžEjj% uYL ^U0(tk B@8DžDžDžDžjju y8U0dSu^_jjjjjjS1ۀ8Nu @1IQdPuPt(hjuH}tUZt UtM@D2DžDžvsPPjun&N@D2;CxvPCxPstu7CtCtCxTDž;t$<%u {%t%B h+mGXG(EEEO(GUjRURwP u]H$}tjCPu 莲 gX1jCPEPEm uVFd{jCPEPE; EȃPCPuVF\>jCPEPE EȃPCPuVu\E9FXF`FXjCPEPE趱 E܉EEjEEPEPV gXe[^_UWVSX{ Ɖwj C PsV%htqCCjC,PC@P+ C(ECSEjEPEPsEE R@uh C(@C(C$1ҍe[^_UVSu^1CX{,t+C,{ wjC PsVLgtoCCju C@PT C(ECSEjEPEPsEER@uhWF C(@C(C$1ҍe[^UMQBXu(z,ALuB,APB0ɺPB,APB01UWVSu^CX1Ҩ} ${,CXtC,}EUu3PRjWVt<t WVEEPRjWVE;C vPC PsVet|CCUCxuuCPϮ C(ECE܋ESEjEPEPsER@uh C(@C(C$1ҍe[^_UVSuFtjjPqvAVF9t RA[VF9t RAYTt5xj XZ^lt=s s{tPh5xH tCBC뼍e[^UVS5x]P XZtShqg5x t"0g $hqg5xؗ 5xj 4 e[^UWVSEhDžpu ǀhP Uu ǂ] EMAA ȃAApA|LA0A4Apǁ,0ǁ@ǁDhH1Džx\ ^_th<E0G Y[u Dž>hU2& _ZthM1 [^u DžxDžEhu<+uR{ujyYtW-c$1QUZ‰t1-@cCPBP̺ _XW<-uSCu3j"[ujhYf-s@ t<%MAȃB9A uQ MAPUBMAȃB9A uQ MAPUBPYtDžDž7xt *pt |t 3P '_Z0tqVhܿhW 1򮍅jPIDžDž ttbjjjj jjjj) (jjjjDjjjjH( t k B@8`B4Xt k B@8tB8u*{^ru'M9uwN[El dt k A@8@҉u Љltl%MZYCU:@ tRxU1Q苀‹MXu*jMAX@ pR _XEA(A$Ѐ ru `x P$ujPu[^u-~2P`…XYj@tfJ jjRC;UB|xt2dg_tP8^thPjRPj+jjEPE܃t"Hu Et tMd[븋 t1tPЃP1Yu31+h h h4M1ҋVu؍e[^_ÐUE @81US] S8t tBABRB~X1]US@ӋH81҅tA9ru ʋ [UWVu `S}uf't@9t't5v R誥 _ D4%tFE>u7E 9}tUBt;xtu TW p^EE}uuo[u~uEXt Ut+1}EvZuEPjuLt;>U;SxvRCxPstuKtCtCxE{tTpEEHEu tE;}s@u kE Etk UBx8Vhs EY8[v SB Z D4%u\u6=$u#FHFy;F| \Vj\ Vj\T YX=$u&FHFy ;F| tVS݋ VS XZGY=$u#FHFy;F| =Vj=袋 Vj=[_kE Etk UBx8v S? Y D4%u\u6=$u#FHFy;F| \Vj\ Vj\QXZ=$u&FHFy ;F| tVSڊ VSY[GY=$uFHFy Vj 譊   Vj XZ=$uF @ VK) _tjjuEE81e[^_UWVSh\jj&h E܋]P]D t @ rh\jjOh EP]D uQ1K1I1Mؿ = t)8|uSRA uu?Չe[^_UWVS,E {EEIhk3H ^_uEEc3EE1tH=t?u89u%}tuhju[=]tC봃}Et UBUVEYu:>nu~ouVE\EZuVuY[E:]؁ k M}Eu!uU Bxu8?u U fM؋AMrU؊B t}t ht}u h}t hqu_}t-k Etk UBx8u1[k Etk MAx8/E؃xtEPjuuURuVjSu贰VjSuaMAVjSQ}tjjjjSu}t hDbu}u}uEEԀHhU=j EPRMQ<t\EPVuÍEPuuyrtPShgj PSh~juxkEЁv R Z D4%EPVuÍEPuuPShju ,}t(}tUBt;Xtu TS,^_}"}tMAt;ptuTV][U؊B @t}u hu.k EU苀tk MA9P89E؃xtURuuuPuVuSu:gVuSuH_OUBVuSR2ujj}thVjuEu}u}uEMԀIE@ u\k Etk UBx8t4k Et k MA@8uP§ ZYE؃xtjuuuPu[juSuuFjuSu&^u1MAjuSQujujSutE݈ E E {}t uu_XE̍e[^_UWVS@jjjj?uEE䉅VEEEEbjjjjVBm jjjjV"M`jjjj3V-dh! Yu,Ph(hW. 1jPIVM| tDžhDZ ZuKPh2hS ߃1򮍕jRIVM tDž b?tj h?S 1jPIVM tDž LtDžkeytDžime=fDž61򮍕jRIVMr tDžVtDžmatcDžhtimDže=71򮍕jRIVM tDž`hbhyhS~ ߃1򮍕jRIVM tDž tDžrepoDžrt=5ƅ1򮍕jRIVMr tDž.tj hSM 1򮍕jRIVM% tDž&nhh*hS ߃1򮍕jRIVM tDž'!hhhS? ߃1򮍕jRIVM tDž+tjhSf 1򮍕jRIVM> tDž2hG _uGPhhS ߃1򮍕jRIVM tDž4$tjhS趥 1򮍕jRIVM tDž5tj hSi 1򮍕jRIVMA tDž6 tjh S 1򮍕jRIVM tDž9=tDžtabsDžtop=fDž81򮍕jRIVM tDž<hh#hS ߃1򮍕jRIVMM tDž> t k F@8Hu Džh+hW~ 1jPIVM tDž0FRV`Y[=Xw Dž2=w Dž t k F@8Hh6hW 1򮍕jRIVM tDžIX1ۃ= Dž Btt)tMjjjSVjjjSV(}t k F@8PjjSVTt k Fx8t5jt k F@8Pj SVYt E C 8'U :tMU  9t PS蔇 XZ1jPIVM u E 10E  hAjVje[^_UE E EEӝ UE E EE麝 UWVSSSEhu PR! 1E EE샸(,}ut k Fx8u"jjjWVjjjWV(jt k F@8Pj WVtjjjWVStk Fx<tGjtk F@<Pj WVBtjjuE GE NEe[^_UWVSPuE1(,t k Fx8tt k F@8PPXtk Fx<t%tk F@<PgPXE }NNe[^_ÐUE8ujjjjCu1UEMw jhe1=vhhjQUWVS}]u jh=vhhjSd PjjjS7lupǃdt k CP8tkd C;P<;ht dt k Cx8jjjjISjmFdt k CP8tkd C;P<;htdt k C9p89v#HPjjjISHPjjjIS(1e[^_Uhju51Uuu1U1W}1th:ju}US]S裫 1]UEU8t% 1US]@tP,ZtP X1]UE 1U1W}1thsju'}UE8ujjjjuB1UVSU ut k B@8H9r!t k B@8Hu[1^USQ]UCRS`YZu0ҁ}wuuu Sr‰Ћ]USS]UCRS`ZYu"E-0=wuuu S(‰Ћ]USS]UCRS`ZYu0ҁ}vuuu S‰Ћ]ÐUWVS} Eu)UB E hjRӁv R Z D4%t"Ӂv Ro _ 4‹EH@E tE 8Pt} u8tkXhu[^PhjuMU 9zuhEPuγZY}uGE 9t+wwujuEE?@\ˋUBrM EAtk}ЃEU@ȃ9t.wwuju虶XME?A\E ˋE@PU2u'18EPEPjRuU}tMYt Ut>EG@EEviPEPju1&EEEG@;Cxv#PCxPstu&CtCtE܋CxE䁋T}]t&U}rtVuS/ ]u GtPwS _ U1tM}A)ƋEM1t}ttUBPMAE 9uJtVuS賗  +]Suuu:yEU9BXfB`BX[+]܋M I ]1ۃ}MtEXtU;StuRTMA;Cxv#PCxPstu$:CtCtE܋CxE䁋T0UB;Ev#PEPuuc$E܋Mq]]qS跖 tUBVuP螖 +E܋MqPuuuubEU9BXtBXB`E ?9t%wwuju葳u+MEA\VSujupu E@\1}t%UBtM;HtuT uGXڍe[^_ÐUWVSuF H1҅F "t(NA9‹FuA BAV9‹uAV)H1YtfVZt u$F$tÃ;t 3vFXv$hFX~xt FxP}XtPGFXtP6FX@t PlXtPF[t PEYtPEZtPEXVVEe[^_UWVSEu hj}1r ÅXZujjV:EG@GCCxC {C,CxC|uǃqtP>% _fy1tPS`" tPS," tutPS! tEtf<W6DYu jjS ujjV gWRĒ SVt_Zu2 SV肓ZYuSVAD^_u E1 Se[^_UVSMYSC9t9uC9uMsK19tA9AuCBQ9suCCq9s uK CHK[^UEPu hPhUw<$Xh!hhHhg h}hjP o UWVSxLÉUu} w)EPSUZYq}u EtS0HE t.u}t#FU:F}tFMu%@u:EPPjjRS]E@E쉃B jPjjustr Dž DžWY^t^jhSC uJj S Y[t:WZt"jhV uj V ZYuh;PjugڐEPP8[^t蹐8uPq=YtP5y ^ZEPW|8Yl[t;UPlh lZujjuA lwP hYu(jjulY-lh8tS>-V8-XZExt x<XxW<_{ ^{xo l[uh[tjuԽt;|~hjuN |9~hju. hjPu u}t(lS,hH,x;0UBlPPxPTu U fJHX@1ҍe[^_UWVSRlj, YuhMujW E PS:XZe[^_UWVS`jj+}WD t k GX8ÍEPS66^ZtJ8ujS6ZYt%ShMjWhjW߶ vhS4:Y^E8t8 t@Sh.hVO hSt+Pz:V U BL[Zu'jjWmV:h;jWW E HX@1e[^_UVSƍEPhr;5YZthhrjVj%ShrhhxS蒫 S(e[^UWVS @}8P ZuShj芵(jj+l t k BX8ShhV֪ hSo@@jjjnHthjǴ uCBTV BP^ujj艴 xLB pj/VYY[uCPL hRhSh0h3h8hZWhVhhihS蟩 D=PS7 9+Vh2h2hhhPh Vh2h8PH# $hDhHhS L=v hnjtx u+<~N F+S6 9u4)lj놃t*t6[t hj1>苲 u @Tt O6Ye[^_UWVS$}wtFX@u1tIFj vPY[tfXhvLjW`E tNX E t VPE Džejj+W费 Ft k GX8Sh.hP) hS@GjhWh vLjjV;5 @tG#1S5P+5 x()uh P5 thMjW0(4ZuP^t#PL4}4YDž[GjjWh DžE tjjW>g t Dže[^_UVSQu^SXЃ1ɨ@CX⽃{PSXuw1j#Zu|EPVZYulFjhVhCj sPt#hsLjVFjjVh&FjjVh hsL2KX@1hjVne[^ÐUUWVSM ut9sZsÅu Sb#_ SQ#ZYujju 1>)<81Ѝe[^_UVS uEPEPEPu u菌t 1}OEtF9sBM)مډMEt$< t< uMAEEHBEtAރ}Ѓ1e[^USj/]S8Z…YtB]UVuSFPY"ÅXujju 1Vu Sq 3؍e[^US]̄uuu G 豄 8t蟄8"u ;t1҉Ћ]US]{uuu _T ` 8t#N8"u=t =t1҉Ћ]ÐUSSE]U Mtwt #tjjhQhljSt{u1jtPS[wV$ph$EPSɉZYu8EtPhhjS覬 M 2hjS荬]UWVSӉEU EE聣xu CPh1 ^_t jjS950' $t3[./GD?@\-E UBRu趈ZYCCKE j EPRE쁋PtPjju$UUEBU+C)CSE {u hExjuBPuB~Ck8Kv B]  ^ t(]v RZ 4U}tMYt Ut/E@1EvWPEPju4u?0E@;CxvPCxPstu  CtCxE{tT]SuWW` hWju臢}tUBt;xtuTWKX~ 8uMtF Pt)F @ u=Pt=u1t @ V B t6]d\t k Cx8tjF 0uS8uE8<huQU:>uIM M~tN;EuVJA҉VFF+EPuVu*F =u ]C($=u E@(=Pu UB(CMЋA( ~`F Pu ]uF`CL@FdCPFhEt k Ax8tfN| ]tF @ ut 0h  ^ C u FEEFttt PLNtZ8!uPAVFfN|V~t:^v RD _ D4%tVJC҉VFċFV:+zH~F}FEt3E}PtESRr3uumZYu!FvVHFBEĉFRU)}v uCC Y UD4%uM FHCFFMF)]ȉFءttuhÃ~V\Eu0Fv2z u,HFBEĉFRUUF } M FHCFF랁t E~v~=Ev PIB Z UD4%tVJGEFV봃~&}!t } F8 VJ@҉VF߁p~t:^v RA _ D4%tVJC҉VFċ^v RxA Y D4%u<|ujhp^$SZ F(>] ^ UVtNCFBFt6F8\uNv @FAF9uJFHFFtȋVEtF8 tE^FEt3M}QtESRrLuuj_Zu:~v4FP Ut|u= UF @MENFM} t}|u NEFHCFF@^CV^)ӋF+]ĉF~ CVFuӅt ;\uCH򋆀ƒ:wJtV`t tc  F`t4EPurZYj }uFdUBLMALFd]CP(FlVpF`FdVh4~`%~`u} ExF`u FlFlPu1r[_ t~luFdFdFpFhV`tJty F`MQLuC t?EPQqZYJ }uFlFd]CLFlFdVlVdUBPFpFhFdVhF`FlVp ~`~ ujF`MAL@Fd@QL8t k AP8Fl]CPFpFhEPSpY_ Et ;CLv9FlvFlF F\X ;;!Vu)F8!@FfN|BFt8~v R = Z D4%tVJGVFċFEЃbl/321tUSWlNcf&sw|F^t1+t% #t(-tlt0pt=F\CN\>UfN|J("MfN|I(UfN|J(VJ@҉VFngF.t'+t'-tK=t'^t<fN| %fN|@fN|fN|;3fN|VJ@҉VFu~<+t <-t<^t<#uj1SK ZY=wFQGFEHfN|FVC=w u;+<+t<-rF<-ufN| <+ufN|j EPvEPpMu ;0_U+F)FV;auFlFdNdVpAVhFlNXfN|uvVu$hMQEPEPE  }'}EԅtPulZYEԉFT1~ ءPvvVu uvFNFEËFEt3E}PtESRr.uubY_uFvVHFBFB2}v u/9 Z UD4%XM FHCFFSE)SPVu~^=Ev P8 _ UD4%tVJC҉VF뻃~FEËFEt3M}QtESRr,uuaZYuFvVHFBFBEFHFCFuE)SPVuuvVuC hju׃ % ^t@Tv RJ- _ D4%u@|_t h ~t;t-v R- ^ D4%C΋P֋EЁEv R, Y D4%u}_uEESUҁv Rl, Z D4%u}_uEE9Eu@CNljjGpG0p0jjux$u.h4hejuVUBT1ҍe[^_UVSE @tuFTtjs3Vڼ1҅th3jVUe[^UWVSƃ~@UEUu jUB <MBIdMNLw MJu?Exdt6jlWdSjV-jWSV0UBRÉ׀: t GKt? 9uu?t)Hu :.uGtZO)PRujVEgaGt$GKu jhujVE?aۉu KtExUZt MɉNL#tujVUZYtjMA 0V[Ѓu h+VhY[_jhVx PVOYh+VDYVYE@}u$ t k Fx8t<4}t k Fx8t@RjWV}MuPG]9tssujVE_u׋݋UVLujV\ZYtFL1ҍe[^_UEU E\UEU EFUEU E0UW} VStGxj@P ƅXZujju~ 1҅teu.1}IQuu 1҅^u1713txt p0u] tكe[^_UWVSVVE PxҋuuF(txu hjM  u>V(z1IQru V Ju V{4:EPVvq juV uOU Bt0uS3Y[t)M A|%ЃPjRu ֋F$F(0V1_X1ہ,F(pV1Y[t]@tfH M A|%$PjRVAutF(1ɍe[^_UWVSP]S(;S$u uhjS{tABE}1IQrVS u ]e[^_1jF|%PSB@ uSC(pS0_Xt:F|%$PjRS@uk(0ɍe[^_UVS]{$u uh#jSzojF|%PS? uQC$C(0S0…XYt6F|%$PjRS?u 0ɍe[^UWVSuF$uhCjVyEEEÃ;E1}ыE;^(TuF8UH9Erh+UE}tEhVR_XF(E9útR93=tRh VRFTu'jjjVOu FTu8h+VRe[^1_ÐUWVS EUEU0EE]E܃} U#: !t"%\ } E싀P҉E1I)M1}Mԉ]tUzt;wtuEE܁T;GxvPGxPwtuGtGxEwtT#U;UvREPVuuԋE؋UrS: E]ԁ UB @EI1}I)M1҉Mԉ]tF8E싀E1}I)M1}Mԉ]tUzt;wtuEE܁T;GxvPGxPwtuGtGxEwtT#U;UvREPVuuԋE؍uS9 U]ԁ } vUB<%t<#t u{EԍT8EV$F}t$uuSw+ ]ԃ}wÙ:/t/CGUPRSN+ F$N]ԋD;BF$@U F$ JtBxu8+ _Eu [];^$uhIjug "hrjF$+EPFU؍P 14]SEPUESX=`C1tz@Xtt$t k Cx8tjS(YZ1҅,?`Xt k Cx8tujhiS\ƃ 1PVE0WS]ujG 0S螲@1du7lu1EPS@YZ}uGlGdfVE0EPGlPGdPWSUSLtCPCPPRSK ECPuu hS<XZ1ҍe[^_ÐUWVSUB@X] tC}uB @8/t hjRECxtHtELhhW DžXu@P_t@t8u"hjuwb/Ct8 W1҅^{xCt/xu.v.uy.uAu4hPZYthRjuf1${tFCmhMWjufe[^_ÐUSPDžDžDž7YxP7Zyh!7Bt tlhj` tP[tPsYtPaZtPOXj?j2j% uphDhSU jShGhGhGC(h-Sj$ejB$hP$ B BhP# B1]UVSQ҉ӋEu2~Yt 9tBuPhejV_bCtP% XC tPr% XjEPsl tCBCC,tPXC(tP ^S1e[^US]uZE1҉؋].UVSƉӃ=$u SBHByR & @ s# Yt>ujډ~=$u#KAHAyQ% @> se# Z>p=$u#KAHAyQz% @  s'# Y 21e[^UWVSu} {thlWV t1e[^_UWVS}@u hW6#ssVhW6Fue[^1_UWVSSSuV ҋ]} uvS9ZYuwj5FEMjjEEv$REPPSEtwjSK-u ǃUCPSLCPPRS蠭1e[^_UWVSÃ1эq@=@tV7S! u ?1e[^_UWVSljtE:t@uVhW5Zp0hW{5s hWm58hW`5^@X=@ts3jhW;5;1e[^_UWVS E]01ыU IrxQSRuE Px9u.EF9tjSuU BtuVS_ZtSEE%=@uDhShhWzP VWDž,t.WjuZ j/S薈Y^,t @,1эq7QjV DžXZuj뭍G4Gw VSPq EGhwhh4PO 4P4R0Y[dFP7ZG,jj4P xVw,P 9t-hM4Rju_S^ SG,[01ɋW,:t::uB<BjAPM ZYG(tbh,w,q!Y^tdh,jw艭ZG,ujju Y jj [^‰G(tG,G,tgPAYG,W,EZuB0BtBx0xGE1҅tjE4We[^_UWVSEE8hcM YE1}у}YtUzt Ut+1EvSSEPju蝨u;c;_xvSGxPwtuzCGtGxEwtTCPuV u8tPu u h*EP_Zu؃}tUBt;ptu TV[E耈8U Bt8X~*v R Y D4%@tKG҅tp~,v R Z D4%@uKGԀ?t0Gt&Ёv RW Y D4%@uӉ$uh.juV Wu uPe[^_UEU4UWVS ExluhMju3Vl9Dž`Džduj j _dZÃXX j,j Y`^xdA`Z9Y uQ dA`P`dAAU҉PPPӁv RZ D4%ūPPv R^ D4%oot8tF>uHhoPjPPP+MQuWBnLJGLE܋GPjEEPj'W6:hj ÅXZtBC@tPC[ujjW;WV]iZYu1ҍe[^_UWVSu1th1tVO'YtfV!ZtC,tPpXCtPbXVlYtSKdže[^_U} >Eu E j1UWVSHLPjjjjj6TS։1IQVEPSF,SH5;e[^_UWVSExG|xu tBhj' ÅXZujju.:G|tG|XG|_|C}%h}tECuuu謋 CtLECu C71IQVus CtC 1ҍe[^_UWVS RuӉNju uZ1҅Y$t{ t}tt9C t CBPuWtrt0hRh hjW8t.tGt;Ptu T 'Ye[^_UWVSjjuhU, uF@|xtVpX1hi, ÅXtjj1IQSh)h>, ÅXt&jj1IQShVhh, ÅXt};txhShh4Ws, jjWU@ u(hShhWD, jjWU uF@|xtV[_1t k Fx8jj4hډ tt9bjjhډv uHE94u E98t2E94u E98tu#F@|xtV苑[1u1ҍe[^_ÐUWVS0ExujU B 0u-M Ad@Pu[^uhju!5}tEXt Ut-hEPjuE芅uY{xw8hCxPstuZWEHU BlCtCxEstTM A|tAlE Pd;Plu BM AlE @lEEEUE9%EPEPjuu\rEU؍T1ۃ}UtMYt;stuEE؁T;CxvPCxPstulKCtCxEstT#U;UvREPVu3ƋM܃}<EE @}}v uY UԋD4%tH EHECEMɉM]v RZ D4%urE8)tjuhH Y[t EGE EG EHECEEEt)]v R0Z D4%uEE t PuW EE܋UTljUԃ }t)+EHUBPE)+E+EHMAPEE9EU BdMALBdRlEU9vuuOY[u'MM9M}u@)WVuut*}tUBt;ptu T*VZ!}t"MAt;ptuTV蹥XU Bl+BdMAh@Ah1ҍe[^_ÐUWVSQU B|%Bxtt=6jWu`n u#t<Pju0 1 E Xt0#UVVBȁw uukj WCpC0pVjjujk$EH0҃E PtBpB0pVWu~E}PtESE1:Rwhu[Z wMੀt?2e[^_ÐUWVSCtCxEstTE+EP;}̉U)щMĉ}EԃEPEPjuuE;EvPEPVuzauuV^ uVWju 9}t%]CX8t{'tE9CuGCuuS ZYMԃ}EUЉ}ĉUEԃEPEPjuuE;EvPEPVu/zuuV uVujuE ul}t%MAX8t{'tE9CuUȉSEuu [_u-Mԃ}E}t"MAt;ptuTTV2Y]Eȃ}CLCPt,CX8t"{'tC;Er;Ew SuXZڋUMJl1ҍe[^_ÐUUt k Bx8uhOhjRN(USQ]CujE @ 0S w@X@uhjS(KtSwZu7EPSZYu"jSuZYuhjS'1҉Ћ]UWVS} Gt3uV9G|%PVtuP3V$[Xt;fJ G|%$PjRVu 0ɍe[^_ÐUMS4tQPC4PjQǃ41]UWVSQQ] EE};tH4vWZ4CT04@ 4uEE;uŃ}tWVXEe[^_UWVS}EPu +4P44P?Ƌ4|3 4t=vW[e[^_UWVSU80t k Fx8tMM] Kt k F@8EUM zE@ EE1ҋEu])ӋU;V86K,Eu PhVF TjjjVuFTEM;N8뚀uhV_ZEkFX‰]t ]hVY[Ã}u};~8suVXZ}qKtkE;F8uh+VE_XEuUPhVF Tu3jjjV3u FTuEEM } ]Me[^1_UWVS u] Et k Fx8t-jjjEPEEPEPj3Vj js}UWpKj^jE]@9ȉ]t)RWډ8u`FTujjjVuFTt.jjjWEuV1ҍe[^_UMVSU ]ut&j%PQEPCTuIjjjS`u CTu*%t!jPjEP>u:CTu,jjjS u CTu h+SY[1ҍe[^UWVS }ujE @ 0WpE0EE9EEtC?BwVhj ]S: ]EjjjEPU؉buEPEPjVWr}uEuh+WFXZuuuuWM7GTu(jjjWu GTu F;u1e[^_UVS] C|PClPCdPSuVuClFLCpFP0ҍe[^UVS] fC|PClPCdPSuVpuClFLCpFP0ҍe[^UVS] fC|PClPCdPSuV(uClFLCpFP0ҍe[^ÐUVSPP]{U ujB 0SnDCLECPujVEBdP1B|tBQPjSGuECLFCP0ҍe[^UVSE X|SuVTZYu SVmmZYtۋt1e[^ÐUWVS]CE䋓EUEE 8dE@1uKCTu~jjjSu CTu_}u@PVSEh1 uUr,WjSMMGEEPuS[k c=$u E@ @ uXYutuZug}tMU }uOEPu S!uuPhjS$}t#tCt;ptu TV!X1 hMu jS#u,}ujjSEh e[^_UWVS|uFU |BxEtPHBtE;!xu3ECOd\tk ||8tj ~u2jVZYjjPV}}E @xjWSu Vx腫WU Bx9xuj B pV_kHxCtP诐YU Btx0pCZu jjjU t% tZBtx0hVJ4 < t!U Btx0hdVk hV_XV[u t)jV|ZYt jU B ?jU Btx0EPE jdPu VE @UVLtFPFPPRV4l 1F @EWSu VU Bx~t} E HtQEF f@yRuNrA0Vjl tF p؎F X_F fP? fPVjpV uVY[jU Bt0hu聞ÅXZt&E=$PuCS4T_P ZYthMujVR*E%=t!=tSLh=jV}=$juCSS_PjjVuuhpjVjEPE dPSuV7U BdUt ҉FLt@ЉFLʍe[^_ÐUQuUVSPU V1zx]tBtPEPSjyutEC1ҍe[^UU B| Mtt t  1j B pQmg PrXQYuUWVS]CpE9uhjSOEEEgF @E1}ыETC8UH9Erh+UE}tEhSXZF pS_EX6E9t3CTu'jjjSlCT\CTu,jjjS\u CTu h+SnZYe[^1_ÐUWVS]H19rXp tAt1>ut0FIt,tt"8tGKtGF8uKI1҅u1} tE [^_UWVS(EP}WY[EPuVjuWEPUu.[Z}Et_t Ut;E考EEvdPEPjWfEBE;Cxv!PCxPstWfCtStCxEÚTuuu茯 EEPEPVu Wvt }X&E؅tMQPU-ZYtUE9u hjX)EU؋uus\ ;E؉ujh+sE< Ht$u hjW }1ۅt_tE;CtuNEE쁣T;Cxv!PCxPstWXeCtCxStETU(EE;EvPEPuWetgEu؋EuEP EEPuuWtE}t(tGtM;Htu T uUXUЍe[^_UVSut{VJB9tt T モTߋCtP蓗XCtP脗Xjjh3Vv s ʇSćdže[1^UWVSSƋC U}tP菇YGPmC Zu jjV" { u VWus ͬ C {81e[^_UWVS4uv1t HuDžDžp9t:t'Xكڸ t9~ߋ6뿍PjjtPGPtthjV'e1crЃ91.Ht PV_Zt^t Ut1hPjVDž.bE{xw hCxPstVbCtCtCxTDžhr' tu+V[DžhjV 9sn tuhNj!hD;DMt<M9΋Uu9t UWrXhMujujjuWuue[^_USSE @}]ujSZYu.UCRSZYu}u jjSL 1҉Ћ]ÐUWVSPPEEE E}jhWPkPqu EEE Ee[^_yVPWu/Shju^] e[^_qUWVS(E EEыt k Ax8tE]t k Cx8tMUt k Bx8t<]u t.v R;_ D4%uFKԅuME t'M@tP<]^E t%EtP<U[}E <u1} t ? u@GNk +} }Et7tMYt Ut1EEvWVEPjuNLEu>;sxvVCxPstu*LCtCtE܋CxE쁋TU܋} ^jChSi ]܋u t<< ujhSF  Ph ZYt\CCGNjhS $MC)˃ MM ]]E ]G}EtEXt Ut6EEEv\PEPjuKEuCE;CxvPCxPstuJiCtStCxEUԁT}] }t(M̊D t~t]PHt k Cx8M]PHt k Cx8uh`EPËHt k Cx8t=E-]PHt k Cx8u BFOu Ec}EtEXt Ut1EEvWREPju}HEu>;SxvRCxPstuYHCtStCxEUЁT}u ]Ѕƒ[o*d.[\t~yFOt~t&jhjhS  MPHt k Ax8ES迹 U MPHSt k Ax8t \C\EP‹Ht k Bx8t#MS6 E >~8UPHStk MAx8w\mCFO=E)ÉE ]UtPiM[}tE]E@PiUYujjut Mtuu Py ]E }t-}tEPtBt9E u T u liZMҸt\U uu u tE uuPu (E t ]@E t E1e[^_UWVSXxƉ}u jB 0@LVP|Ut k Fx8uƆƆ1ۅDžDžDž>Dž:EccA-tz,#E  +tC0 LlRg7pErHA\\H\Ng;j EPuE 8uHE 8"u:uh%u h8jjjV BlBdDBlPVTYZlPVYZCDžztc,,0O?Dž3Dž'@E UBEzE8u utj B pV@~t.t%uu t hL*Id@lDžDžDžDž Dž$DžDž9FTjjjVuFT(REPjV 2;uxt^t Ut2(DžDž$P$Pj(;CxvPCxPstV ACtKtR1ۅt^t ;CtuO(T;CxvPCxPstV@CtStCx$T3(;$v%P$PVg@b(u農 M (DžDž DžDžDžDž4Pj EPu Dž4Dž8<Dž@觽 6Dž84 @< Dž( @9vU=s҉u PbZ PRb[_ujjV7 E    Q4 (<҉uDžDž 9r B9 r B jFL VFP{#ZYjjhV PVbjj]SVXE܃ttr @SVA_X2jSWVSWV hj,PV.. ,@EEqy 1<@19Dž|a9v[|=s҉u PO`[ PRu`ZYujjV  < URP < FTDž2 FL4FP 14819ڋ|y9vs|=s҉u!Pm__!džw jj/ PR{_Y[ujjV  U4 RP 4 UJ  DžDžXG&t \t-PHt k Fx8LG"90}q&tCE^ePUlHu`}PNjHt k Fx8Z1SЉlj)8B)4u@4)@B)u`EujjP*DE@u,jPjjERPaEEjPEPEP)WVuUEjPEPEPWVuUEǂEEt ;Eu;;EuCUtP`OXEǀǀi%u(Ct ;Eu;EuCC<1];Et~u UCFu}tEXt Ut7EEvbVEPju+E>;sxv#VCxPstu*CtStCxEUT}1]܊t ;Eu ;EC\uMS;EuC\u \CGF~u{ECP‹Ht k Bx8uV)~uOEP‹Ht k Bx8t+EWu UCƃ 8CGF,EtstPjMXVKMU_uAjjR }tUBtU;Ptu T uM[NVuP֛ }tUBtU;Ptu T uLYuuSU Ee[^_UWVSE] SC9t5s 9BuC AJ9suCRsLSX9ɋt9SuWPSSILe[^1_UVS] {uusV}CZYtPF 19CtFjuVԜ u/j jsVTu 0ҍe[^UWVSQ} uuwVG[ZEPVv juV. tjEpPBO;N uUFJ BF f@fA.ujQu苜tju1u:GpjV]WUC$C( V1ҍe[^_UE UMtrt 1hE.E U3hJQjRXw UWVSSƋXF 9CUuC FLCFPQjuV u_SC BCBF fHj jsVou/SV)ZYu;]u98u PV[^1ҍe[^_UWVSE9ujjPM AxtHt UU BtEj EPu{‹E 8u91>9tJ~?9}uhkjun}1I>M}9tB;}t2G@Xj/S]ZYu@uPuW+ t}?9uhuju%1;>tu U B|%PUEe[^_USM9] t@PC|%E]jjQ]UWVSE9‰EUujjuPEx8"E6hjPaUrЃ9E;puuhu huY[Fu^X1эQvDPjjh  Sjjhu蛬U9ruhu胬XZE;puZXtSUR8ЃUv@1ыEQ#9vSRU9rtPhu"h+u[_6EEEEUBTu.jjjR6uUBTu E9Ee[^1_UWVSEEE EUE9‰U"Uz tr!VF[VuPߔ CCC E xCtCCUߋrЃ9~E,t F-E~ t EF$@EuEYuVPe ~tC(C~ t FC@C E9pu_GO J9GuWW 6EbUBG9u:UB8EUxUrtVjDZujju ^jVP躓 v$_CtBUB CB 6Z 릋UBt$P$UB^ujju H1e[^_USӋҋCtBA Cs^DSXD1]UWVSVVEEXtڋEUZu ut*Ёv RSy[ D4%+}vjCYujjuy-GPCCZujjuZ Cu SCBWuPV C8CUB CB Z  FE>tF61e[^_UVSu9t PVsXZSt CtPCXe[1^UWVSQQËEw(tVvPSE u}u jVhjPV}WWSEEt:j(V5YZthj)PVWWStu jS-u ǃCPUPRSLCPS1e[^_UWVS}9u jjWOiCpC9uh jWJE @|%PVW u*Cst VSWGp V sv$[^1ҍe[^_UWVS}9u jjWC0C9uhKjW JE @|%PVW u*Cst VSWo V sv$ _X1ҍe[^_UVSu< t#8t D0CB;t9s< uـ;u9s < t< u1ɉ[^UWVS@ EU BxHAtPf@^U Bt0Z A[ujjXE‹t k BP8…tEY1I9v+%xuhuju l UIt k Bx8RE 1ӍC Pjl Z{Yt @FF FF~SP uPhhShhS[_o<1щр) uщƄ) Yu0GKӁv RsZ D4%@tτGӁv RsY D4%@uτ(GӁv RWsZ D4%@tτGӁv RsY D4%@uτth,GtYӁv RrZ D4%@tӄt/08t!(:t,8t R_I1,ʋ(эL,Qji Y[@(C,PrqX,1IZKKAK (QIq_XFV S9Fu^^ hS2M 4YFV9uhjusVgVrU1ӍC Pjh _1sZ,AA ȃAqSP誊 @ Džjjr\K y.A [P+F[^u'jjjjj;@u&ݝB JYP)Ήљ;sC< u;t8VڋHZuމ)љ9sC< u9Ɖ;s2ڋ^tu;s C< u169Љ$s"8 t$B;$sz ዅ$;8 $C$1-tt !1IFh$PiZYuu-$tt1I Pu$ Pru P$hju t3}t!MQtBt9$u T $8Xs}tUBt;XtuTOS8_CɃ[^^19/4PQ)CZYtuj/r[_t]qhhSs4/PSBZYuRэqD0Pj_d [_@(CtVPt C0/ F@SPRP CC @BK$C RP! Q S 9AuYX 0DZYthju F_thju 1ъBtDž ҈AQ9hju{tf@tSBt3u/ΘQ hMqju(H҉5^1 Qȉƅ19Džugj jEb Y[XXX j,j'b YZ}GZ9_ uW GHGGUZ JLBPۉ Džt{yU u DžM A|%t.Pvu2 E@EPvu 9u$O9Iuy x9NjV9Rur p0FP vFp$E@XZWtMA BALB APB ZB J1.tW3Xt 3XVu!e[^_UE UWVSLPjjjjj:TSu 1IQVEPS ,Su_ZuU e[^1_ÐUWVSu @É׋EtPڥYt.t k Cx8twh9XZtwwhkr9 |Ee[^_z UWVSxU 9Et 9ux w u >i_ @E4E tStC|\EEtDC@S9u9C|.u/;U CuU BS;U uM SGgXj jjufC@EFtO}u(VuEPjufkug0XVsSjuAkEuuEE ‹@FY9_u2M A0E p)C9CEEC9CEEE1{9s-C0v RdZ D4%tF;suZCCUC@=$u'|BHBy Rj V 5|j Y[uE9S҉U+}t}tgSB9EEEvREPju Essuq} C EEEC@9EEjuM|CCXZ8E;CoUъt k Ax8ǀUt k Bp81E;Ms&CU< u1)AEE9EI1)1Dž|9w#1)1҉)Ѝ|9)|D ;C vPC Psu C|CC|tCS C|tCS CN Z juM|uuڋEE@t5Uv R/b_ D4%t t SEK CEe[^_ÐUWVSSSuFLEFP}jWj'VEOuo^CXx ȀCXC4C4t"r;u;WV;ZYu7C4 WV^ZYuC4X EFLGFP1ҍe[^_ÐUSh]S螐hS蓐hIS舐hS} hSo1]UWVS U BxHBt0v R`Y D4%1t&fv R9OZ 4tvP6 ut:C u4t$v REY 46vhCsshu8tPP8sshu迏wtQC tIE[v RZ 4EՋEE]BM؊BAuUsRj huF;t@UBTu1jjjRv^UBTKV e[^1_UWVSQU Bx}HBtxtj B pW j~N[t]u@9u<~u& t k Gx8t, @~u2tkGX SW蠄^ZPh W- F v R^[ D4%uvv Rh/W1EO~u& t k Gx8t, u@F tPhV8W膍 CE~2GTu&jjjW跉uGTtT 1e[^_ÐUVSh]jSu pv kE C EC`ECd E}ClCpChtfK|Cxstte[^UMSU AxYtEEBAx@Ax[UWVSSE] ߉E~,V09Ur/E@9v!PF0Pv,uguF,}~,=$uCHCyS:z@ SwYƒuU=$uC S胚ZuBE8u*;=$u fc SS谚XG) u }tEU1 EGe[^_U} S]uAC0@K,9t6S(t/zt)K0B8u)HPhEjS讱1]UVS]sjSZYuZjjS\ `t k C@8C4Xt k C@8C81ҍe[^UM UE $̪Ph_thvPjRLlPh\PhTu E !Ph6?ExEEE U霰PhPh)PhqjR~ÐUhjue1ÐUVS]u t k Cx8uhjS"vFdufV|CL%b tt*@t=t^B-;.4+-CLS BCPBPsLSC fH tvXPsLhhR#PsLh hR j PPjSF|%=t =t jjjj"jjjjSXu tCC CP葬^u-S)Yuh+SɇXZ 1ҍe[^ÐUWVSxƉUujE@}EtEUzxPBtCt&Ёv RWZ D4%uӅ};!d\t k Fx8tj UB 0 CEt,Ёv RZWY D4%uЀ}uj UB pj1IQSuVT<jUBt@0EPЃlPPRVfuu hV%XZ1cExdw@l@PV肉Y_uMExxtP}tA;>u<{>u6MCt&Ёv RJVZ D4%uӅt;u uj1IQSuV@UBx~tu{M EHtF f@Q:yOuKr2V tF pV F XYF fP? fPjpVV WVlbXZjSVuWElPEdPVJee[^_UVSuF] ujC 0V]d@XtjډYuIjVcYZu6[|SV@YZuۋt1ҍe[^UEU EZUVSu] jډDZuIjVscZYu6[|SVZYuۋt1ҍe[^UVSu] jYu&jVcYZuCx] ue[^+e[^UWVS|}GEE0E}]EtU M}EDž|Džx;ud|@1udGTjjjW}uGT}$u+x@PxWEhDžx EPEPjVWwSujuU ;EE=$uCHCx  Sj DSj Z YuEF|Sid ^udE=$PuCSYP'^Zu1E%=u!=$uCSYP2)Zu Sn^1t(G@XuhMu jW読Sn[}$ujjWUh }tM EU| e[^_ÐUMyU ujB 0QjBlPBdP1B|tBQPQSÐUWVS}u ujF 0W{fV|t^Xldt k GX8KXFd@EEtjt' tC 9v)@FdFd^dC9ڸv)@FdVlK9غv)؉VdFlGLEGPEjEPj'WܝK9غv)HVdFlVW跅ZYh!WEFdFlVWE芅uxh!WZEPDVdFlY[tEEFdDFlEPW[Zu+E9FlvFlVWZYu}tEGL1ҍe[^_ÐUhKju蹥ÐUhxju蝥ÐUVSS] EPC PCP3uVHt}thjVY ;C tPsZYtCCCCSC1e[^USS] Ct! C PEPj@Put CiC USt PRaZYtCC?CCC C HS9u CBCSCE 1]UVS] {uuUSv7RM, XYЍe[^UUM Aw7$ M UM UM UM Ug> DÐUWVSQQu V0}t؃؃PFjjS\C SLPSPPfHh+St1e[^UVSSjÍEPjsLS.ytCLCPE9CPr 1҅tPSPCLFDCPFHF0% F0e[1^UWVSQËE֋P PSRljEo^ZutEEe[^_US] Ct t?jjjjjj, jjjjjjHlPlPڋEf]; UWVSu F1 ]uF,= t= u_jjvx` =w:` Ph *ZY/ `+d}tEXt UtL|2Dž\DžtvwPtPju\M|2;Cxv#PCxPstuCtStCxt\T`;|xu(VdP\\' \0\ d j jPpPU z-huۋp~~)9غyy)9غtpuXy u DžXpXjdEPlǃWjPlPM y+lu#;hhl;h+hlulVXjdEPՁǃdx\% WE\PdS% |+`xP```S+d% |d+d)$R\E p4u|Kjà E1\t3}t!UBt\;Htu T \Xڍe[^_ÐUWVShj}, Y[tGE džudžHtCPDZujjWŊHDPy$ HH |t.1IQ|u F |t&1ҍe[^_UVSutZ0tPdXDtPSX|tPBXtP+XS$dže[1^USU 2M]Et0&t ^ItJWXPt k A@8E] ]t k A@8E M[E M[z1[UVSr0] t t k Ax8t<t k Ax8t4t k Ax8t@t k Ax8tt$t k Ax8t |t k Ax8ut k Ax8t-Qtk@tu@[^UWVS u} jËW4EdžVL$EPEPRVxet}tHEUtFP@9uFPFPSG1tGPjjuujWVu=e[^_UVSERPjju v4]S\buE1҅tPSPStk@uSpXVSe[^UWVS }u jËV4ELJWL$EPEPRWndt}t3E}uSF1tFPjjuujVW<e[^_UVS]CPu CPPv4SI u7Stk@uSoYu ]e[^e[^UWVS j {L_ǃu2EPSbZY}uEECPSEtk@uS0oX}uCjusLSdEPEPjsLSW`unCL@DjusLjSaeuLEPEPCLj@PSCL`u(CLHF1WtVRPjuujVS:e[^_UEU EUEU EUWVSu F0%V4 ;V<}F0u5EPEPEPRW bt}VW6jEF0ZELJtGF8 t k Gx8t!F8Pv4W MF4GLF8GPWtk@uWOmX}usF<9F4ukjFK8C@9st"B tHC@S8C4t B tAC8Ctu)t3(t#sڕ E<t B\M A4EԍEPuU_ZEPuօZY6Et ttE9uG;EuOuth juPyEԋ] C{8t4C4C GEЍCE̋}Ѕt)]v R>Y D4%uuuuV&}tK t k Fx8t,SjjE p4VwuHC1҅tPM Q@ E @@C1҅tPM Q@ssq4jVVNt9S1Z.u<P] EC8P0 uus4VkLÃtFtU;Ptu T uXM Q@A[Zu'jŰB<PhWLMM̋A,t @ t%PQW)7}E8z@MIt7w t@tB<v +t^uI11u!j jhgjWw5j uujWW5Ur{8t4C4CqUԉVӁv RZ D4%u)t]t"t '_UEԉG! 8uvSCM YCSM C)SC){LC(tPCC8RP C tPCCC(8RP e[^1_UWVSME@ˉUxAx9؋}tX9u E 9F s SsY>F(F$F FtEFPWv FF=E PuWuƺ'^9[usp3UBLFRP}F8VE* t}G)@F(E+GHE)E) F VEPF}O< 5u! PPvvu|&YT[u@hp9hh+u XZTu uX Tdt }X~^P9s19s<(,(8uA9s,8 듋t@t'BKAӃt )~~(~(t3BF(AHFKF(˅t|F+~;F vPF PvuFF ~^^tPWP Kt GBڃYP0[_9%=@"F(uSF@+~;F vPF PvuWFF ~tPW@PZ FHF(F/DžGtC~;juZYth ju): Dž[DžE*tikC;Hv.PHPDuy(DDjS U(t!kDȉtDž @t u}t u&Bw9NF(Džuy tDžbDž~7G =w uEDžXCP $U(t[tjvu{ t%UtjjhijR VF$9F8unuoTt`P PR PEo t"E*)lj~ t DžtE*tPE^XE(tF tHNF FF4FF0Fjvuyz fF(V E+F,^^ CF,t?v RQ_ D4%uǃ CF,v RY D4%us}FF t k Gx8t8Ct&v RZ D4%uDžB PRSumUxMA|G9QxuyxUB|8G F@ME(y|W(GuSWutPjQ}t!MQtBt9|u T(|cXWvVju=PDžGGXu\u TG\T ;G vPG Pwu2G\XTPE' E= E ,EX Qhs PE E U@Qh jR2UVSSu ]tEPSZYu#E9r jjSM h jS e[^UVSV] ۋut EPjj3Vu%EH9Cu jjV h jV e[^Uh ju~UE Ut8uh% hN jRV Uhz ju?UVSu] Kt)v RZ D4%tFѸe[^UWVS,B1EЉֿtzF4EԋF8E؍EPu0uY[-]t+u{Uv R3Z D4%tTF,t1@ t+Kt(u#1=p==вEPujvY[O}GǃEPut[ZcEu'Uv RzY D4%tuF,t @ DEPuu[Z}Ooǃ}Eu.]Ӂv RY D4%u _tEEPu't[ZEE"]Ӂv RY D4%uj}u5Ӂv RpZ D4%z_q/Ӂv R;Y D4%u _@u8F,t1@ t+=t=вuhEPut_ZK}u'Uv R[ D4%tEPu8tZYui}tOnV,tB uF49EuF89EuF4Pu2EԉF<ҋE؉F@t)B t }uHF@tB tF4V8 FE=w ujh jW j EP1҉ ZYtE=w uE1e[^_UWVSHE1} jU}1҃} EWEċuYXtujWF P{ } Et EU} UuE}"} E#j1WE)ÃXZ} Et MEFN0jW1ҋEY__} SEt EUUUwsti}0tcFPEZ1҅ MN0EjPEjY_} Et EUU M}"F1t h'} t jjj}1WEÃXZp} dEt EEFN0j1WE_X.} "Et UMM}~v7}jtEkUB-hu(Y[PuzMD@uF1tEFf0?uuDtCt-StYt!E$ E$dE_c E_y'j jEPju71҅u @1҅%}~u'U t k Bx8t,?~(}.t.1} }PEkMAX}NEċ@,9uN0 F(LUB0 uh%jufF1tMA0FAF1t FUBjLuVF0OMt } u`Eu EtEjEP1ҋEdÃXZ} Et EEFN0<[t <]tzjEP1ҋEqÃXZ} Et UEЁFwdtZFPE1҅YN0MjQEÃXZx} lEt EEF} tOUM 8tEE@uju[Et>jEP1ҋEfYX} Et MEFGxEPEPjEpLP'U1zPG]9s.E8v RUZ D4%@u9rhiju 4tMĉyPjQ9[^E];v RY D4%u<;_uEF;usFE]3v R诬Z D4%u<3_uEE9EtUĉ);4Ev!P4P0R]Sta0u}W0j0Ẽ 4}t}t$hjuiMċAQd_1ҍe[^_UWVSE0VjLj}W4 ^jM V(ZYT jjV\ t k F@8(`F4lXt k F@8F8V4dt k F@8FDF%u`FTuTjjjV[u FTu51t P P1҃?XtfF9t @t jjVU\\ vIF49Es)щEEԉMǃ\ǃXǃTPVB[^ǃ\ǃXǃT1ҍe[^_UWVS E@MEUu}Uu UTt.M䋁TtTudX U䉂TMu%tAjQY[ u+ZW} ujjuU\ VWhkpW } ujjuM\ 5|E%MXAjQ^_jj|Y[tjWDPZC tUWVPuE UCBPl ҉{uXllCy:ttXSYSOXVWh/5x_8EPEPuMp } uWVE$Y[|> uOEx4uEPju EMA8HMUE܋XUtI;E܋PvjhNEXZ&jhEjhEU EPOF9v R:[ D4%uЅ MX;E܉MvqE)ȍK9v&v RY D4%t9]u E+Eԍ-KSv R诃Z D4%u>E؉ËE))u)~|.uK)SVEU ^Xtjh+EsY[UBTu*jjjRxuMATuuuuuUjuMe[^_ÐUVS] uS ;Sw:kBjjRVt C @‰C 1e[^UWVSÉU@ EUDž|EtEǂtjyjsLjjS @s@9sDSL;sgVRPSCS@t9`9S<WS$Zx C<@NC<-;C@ˋ;VRPSS@t9ws9S<RS2  jjS C<@NC<;C@똋C@S49jrBPSMSUlCD9C}t8;t*URSV E;vPVˈZYujVY[F@9FDDžX9Es }jURo 5o}OtHtQ]SV_ Jt;Et PV1YZtjtPSn 벋tjPn jjV }thPVYZt DžX}F@9F<URV U9t RVlYZtgMjQRm jjV(XuhF<@OF%uSh%7Ote[^ÉD4ǐUSQ]vT S >%u3_t.w>D4%Ѓ]Ð]ÉD4뭐 S=뽉UUv R=%@áD4%@UWVS ÉKuvNt69r PU t2v PU tK9sNuC9se[^_KUWVS É׋uNt69s PU t1v PU tC9rNu9ve[^_C뷐UWVS EE HӋuEt PUǃ PU9uC9r}u%Edu8 R7<%@t"C9swۡD4%@uM}u9w؍e[^_UWVS ËEHKE@t[9vh3Ёv` R;%@uH PU ƃ PU 9uK9sM}uC9r؍e[^_3K댡D4롐UWVS ËEHCE@t[9sb3ЁvZ R#;%@uB PU ƃ PU 9uC9rM}ueK[^_3C뒡D4맍vUSQ@(A,A0hHҋ|ǁ4ǁ8ǁdA8A<ADA@AH"ǁt.llx‰ C4Jy]ÐUWVSNj@4+G(E;UEveE+E9ruw(ƃ1UE+ERPjSERG(EG,+EG,YG0+E_4[uw(@G0Lƃ1)URujPR@D)D[H+E艷@^G(u<Hƃ1QuUjP@RXZu쉷<Lƃ1LP)PT)uTLjÃ1tKVuUjPQ+؉W(E쉇ЉEG4e[^_UVS֋P0Í2;C4s 9S,sv2J9S,vS02C0[^ÉtS0ΉUWVS ] 1щOut/F0;F4s/~tF,F,@CF,u1҃ [^_ÉsuUVSu ]~ C(9C,s[^ÍvSC,)S(9sS,[^ÉC,[^ÐUP,H(19ʉtB9wz t H9w8 u)BÍvUUxB,;B(ǂdǂhB<B8vHB,ÐUWVS uN,V(9ѸtTh v@;V,lj@9vAV,C9w)D`F(9sF,e[^_É~,USS]C,;C0u;C(t'HC,S@S,C09r ;S(vHC,Y[ÐUS]C,9C0‹@vBA9S0wC,C0D[ÐUWVSuN,^09s=V(B9ÿv&AB9N,vQAQV,Bf[^_ÐV(B9vQAQV,fBӍvUSM =]w4t*CV FtQt\tAjRuC‰C빋V tiVuu WEe1ҍe[^_ËFt P2vEFt~S}u E 0Fu믍v‰F 눋EF :tAU FivUWVS Ê֋} tJt"tPPWuVe[^_ÍvU:usj.jhlE've[^_sj(jhE' ‰랉UWVS uEE8 t2S҉tvP8 tZۉue[^1_ËStEF>t'K t݃ VS EuƋS 0u&Et'CUBCEe[^_ËCU:t$1҃uà Q!1҉pj+jhE&ÐUWVSu<t[^_Ív|9tx9u<tމ[^_qx<uۍvUWVS ]ۉljuF^0@e[^_Áw8D4%t;>^F؃@7e[^_Ív S"%uŃ^tM\t_ t;w`D4%t\ Si"%@u;7O>\F7^A7?8>\F7\* S'"뛉>\0F>F0>؃F07)D4끍vUWVS M׉ӊt_u^C@EC8uce[^_ÉƈUvU R!%tC^C<@FCEuU:t BtCe[^_Ív}^}\} tCUwPD4%tSU R %@u.M lD4> R %u\C0C0C0\C ?D4vUWVS ƋEӋM t|t ~Kt I57tv0R$PSh#ve[^_Ívu:t v t;Bu2h87볍vUWVS uÉҸt= RWW ҉t' @PWuFv1e[^_ÉD"DwGPWt VR뭐F0"Dsj5jhE! hA7s_jUWVS lj֋]M ttH8tStӅue[^_É ҋRDS ҉tFA뭃 Qډ1e[^_À~uD"DCsP1뼍vUVSËu:t#"j@~e[^PVhK7sKUVS|$ S%tCw֡D4׍e[^UWVS|1ۀ>0NjxtCY<0u]ػE5t&؃jEPU؉C*t~"1ۀ80tC<0uE0e[^_ÃqjUWVSÉU썀AxEUEE|MMEt+UEVM 8ЈUuEu u֍e[^_É EPtUM܊ :E$XDU:E؃t UR؋U,UM؊ M E$ʉ D0 UM YE܉U UWVSuljE ƅƅ2"@ 9ʉv 99Pu;u  0 h57Ph57 Phf7w# e[^_;u u h57z Phz7$0h57T Ph7we[^_vUWVS EUxp_1EE8t4>P/uD> t>PSElMye[^_ÉUWVS Uxp114>uz/tC~e[^_ËED>E D> e[^1_ÍvUWVSzƸt<\t<^t&B[^_ÍvB 0Fw&$$vBt 3gu VUw G t*>t 3/;u Ve[^_ÉUWVS,Ëu@d…>1҉I 1ɉtэy9S`B=19ȉv>vt*;t Št/BGuƄ/G9wRhPs\$G={`~usjjh7G e[^_ÃVC\ЋP= K`@C`e[^_ÉV0 e[^_ÃVC\P C`뱐UWVS EHhEPA MҋAhPEuUBhP MQP@P FPF1ۃ @PtzCF9ExF PtIF1ۃv @Ptt&CF9Uz Ve[^1_Íe[^_ú UWVS Etppti@Et_t`V3IwuᡀtWvV3Nuᐺe[^_át EuE 1ѡtÁt|Vj EPuE8؋u-Vh NhA FTAFPt r QEq @'1 uuRUBhE&} GhPp 01҃Juu0UBhQuh7Ep"qWuh7uv XUVSƉ~k@Xte9PP|`PdBxt8uXB t 8Bt-8t(Ku VdPh8 jrKxuVdB$t8u+e[^Ã~OVh8 SSSrx贖P7Ph8 jr$%Qh8 jr VdeBt8E럍vUWVS,EDžDžE@EU;-tA;t<*މPUBXPh)%Mq1e[^_ÃttQVh,FUrFEMt 8u}wj#jh`Fe[^_ÍvCsvEM-މuNPUBh@uR%qމu`VUzXk*މuWUBYDž]DžN7މtAމtމu8QUBhph-%r`SEh-%pDމDž}76u݃P PSoPjt u,PM1hF}w 1 Cv%uCƒ%Mw$4%tWPhFEpFRUBhp J-MQd׃E}t:uBEp&vVj PR‹8B:}Gt 8PVh8 jRj0P賖1WjUBt 8-Ph8 jŐRj VP@‹8EM<83Wj VP‹8u(x$MAt 8Wh8 RRS+SE0hFUrPE0hGՋQU2hFMqWPh$GEprRPh$G봋[RPh$GEvUWVS Ë@h@ }Ch@EPhht@s @tfEfu\EftPEPhht@s @tfEftEftKh19A te[^_Ð띐9AuvUVS<]SY^jS-u VSjFEԉ$UЋEuRjVj#e[^à UuԋERjVje[^ÉUWVS<Ƌxp@\|EMwGPEl&7Y[w WRU܉p&XZw81e[^_É)DžDž@<9ss3hR8vC 9rDžE끋xiEXhMGE:t z hڋ @ 989BH 9rU15x<tp8"W~^MGW}7hLGv-u8.S2  uыU42hZ8뇉ڍ#~M;P0X`umyt7jډP &8΃j1҉\P2Shu8v랋~p11F@4;& uD; PPE0hpGvUWVShS^_jS PSj ۉ:nu HQhjrl XZqlg h%q蝍Wh$k*膍WhB$tWhB$:{bWhB$E*PWhB$KX>WhB$踍WhB $覍WhBtBvV PRc_P PڋuɋPhz kruB GTBGP* P+[@t3QjPj WL1Pe[^_à hTh=DžYh@rjjhG<Ah@ PAh@@@QhBB= jڋw;u⋅Phz B PPhrBQhvPhGp$wjjhG`U5u@ÉUWVS ]ۉlj~9XP} e[^_Ív PG@FKGuWP9|ԋGXy=WBGWtGEt jUG됉W닃 j PUWVS lj)9vz j GO9t}9wP|xt|)ˍCvWdBt 8.qڃ~Odt 8GXz9؃~à jKuwe[^_à j ~Ge[^_Ã~:Wdt-8t(Ph8 SSSqPwGXt=ʉ%9t*9Љ~E j 9]%GGW )PʉPh8 RRRqPh8 VVVr]vUWVS Ƌ@9Љtd9VT|_)Åv~XyFV8uD~%VdB|t8tv j >KF~e[^_ËVPJ FNVKjy~ċVdu0Bht8tyVdPh8 jrhvCx~뇀8tˉH~@Ph8 PPP}P;~LPh8 SSSr|֋Bht8t뮐UWVS @XƉt PdB u&v~ j Ku~e[^_À8tQh8 jr 贁ލvUWVS ]ۉƉ@X9XPPdtL8tG~6Ph8 SSS|PJ]e[^_B4tÀ8tB88B(8Ph8 jr8^ P"GKuVdB%9P6vh-9w u˃wj :e[^1_h2Z벍vU5ÐUWVSE@,EMQ09r#x9MA(MUQ,UB(MƋQP9u䋙 $Uv^vC M} U Rf%t>C;]~ vG;]|1GF9uwEGڋEe[^_ Uv4 R%u;]~+]뢉D4{D4͐Cuz1qA(9JUQ,UVSdt |ht-C,)t+S,t0~Q V踜ǃde[^ÃS,uЅ~*؉辜+ǃde[^ 멉ډs,֐USP]K,S09Ѹt0h s@מC,u du ]É]ÍvUSP]K,S(9Ѹt0h s@C,u du ]É]ÍvUSSEH,P(9ѻv"+H@9r"H,u duZ[ÐP,NvUVSUZ0J,9sOC9t3B@9wB,Nu du2[^ÍvZ,vuȋdu[^É[^ÉUUB0uHB,duÉB,UVSu^(^,tCv R%@t!C^,wܡD4%@uߋdu e[^ÉUVSU ]ҍlt l@ ~8e[^m lR%lVte[^l뼍vUVSË@,P Ut;C0t e[^ZSP+S,)…uZUv| R%t@}?t Eƃ@^Љe[^Uve R%tUD4녺\eu0O0؃:V0vD4뜍vUVSE u^@tPF0;F4sOtb~8t V@趟KtF,;F0sU F,K@F,u鐉 1҃~8tVe[^Éډ藝tuF8tF,;F0rIF,U F,/1҃~8ujVWe[Љ^ÍvUSRM =]w?t5CQ(A0)Љ4A,)Љ8A4)ЍA4;A,3A0<Y([^_ÐUUBUÃ1tsE tqP?5ti CC j(UC tW jT‰CtH@CSSC$C ؋]Ív J눃 ST1]à 3TX s TZUEP@PP@$@ ÉUS]3cTXsZTYs QT]]BTUWVSE EE}EMU 9JwEUE 9PJM' 2"ItG _G g$f$J\uG$G$G A$$JG .$8JG MWOAOWB9WOA9}E(A GPw GSG EG 똋G\WJOG MB낋EP71UOWB9aG)ƒURPR<_9W1Ƀv_W )WA9_G)GG)GwMGG$}gEtUEEtEMFW EWE1e[^_Íe[^_Íe[^_ÉG$G$G w^$LJOMGEW)ЉEG$G$G w*$`JGW$G $tJe[^_ÃW$OG pOG aW$OG LMWOAOG OG  OG W$YW$Wv}GEWUO)ʉUvG$W$UW}1U jURZYjjuuEEEPu}ÐUWVS ]ۋ} yQuhJW_UBWjjhJNEEpEvUur 6vhJW_FuRuRhJWw_WҖFFSPhJWI_<$襖N1ۃ~RFPhWC_9^Wj x^EE UE9P7e[^_RPhJW^vvhJW^Wj &^EE UE9PPvhJWjjhJe[^_ÐUUBtÉEQPu BPÐUSQt]ÃhKPCuCK]Uj$jzÍvUW Nj@@GPw N‰G W tGT1}G1}ÍvUWVS }ut_t e[^_Éut u -‰C1{щ MKxCse[^_C}щKUWVS }utGt e[^_Ét u ,‰C1{щ MKCx se[^_Ë}щK둍vUWVS ]۸/KtCte[^_à ChRLCtbQsjPKXZjhDK[x&PShG$VY4$[C8ut'觮Ee[^_+1Ca1ZUWVS ]t`S1v21 G 9v$C Dt PKGS 9wމ s KCu]e[^_tKe[^_à PcK]e[^_QKUEUխɸU轭ɸUEÐUVSE u]t>QPh5xZ SV5x (XZ5xj Ze[^ÍvSVhEPYie[^ÍvUWVS E u]tNRPh5x\Z SV5x'_0* PhN5x+Ze[^_ËEESVhPh}1уY蠬^0)Phqg)P]]S; e[^_UWVSju V}Uvt e[^_Ã>Y0f)$VhRK7W USP]x P Y x PXx PX0u$u2$u@ SI1]à StЉ PH$t‰ PH SH1]UWVS|҉Uǀ ǀǀǀ0ǀǀǀ$1}IHE EPju uW‰SEPRR;WjjT E%= tTQjjuwW+RjjP;T Se[^_ÿ utJnK uuu hwKV xVjjPSyhwKcjhVډ 끍vPhK3SEtPhCPuk SFe[^1҉_ÉuhM3S븍vEnKhPhK7$E;uʼnUWVSEEE E}uh4CFt4Ph4jSД3EEE} Ue[^_Zt(誨Z0%PVhL 5xUe[^1_UWVSEEE} uEh4Et4Ph4jS8EEu }Ue[^_Wh^08%Y[Pu1je[^1_ÍvUWVSE ҋ} 1tU8tOEEEE8_t^PEPjjN@tCCfCECF u)Љe[)^_É@E뜃W;e[^_ÍvUWVSE ۋ} u1jRWE 9!Ѓ@t5RVuE T9؍e[^_Ív触tWhKjuӉEEtxPEPWut9vZjuuE莘!Ѓ@u 1ubQSuE\S|2t E)uE+Ee[^_PhKE0PC&PhKE0PPhnKjuPhKjuxUWVS u ] }x1jRS 踗!Ѓ@t(PWu RxL9r+؍e[^_Ð3tShKjV{Ph6d6VfWhK6PhKjV륐UWVS 0 ɉƉu/{RjjjjWjB 1@t#e[^_Ðs3OPhL6VȍvUWVSW0x@,E1v1;M W wr;UwG1G ;u r w;Ewv Muu1ۉ[[^_Ë]u )Ήڋ_1ڋEHE%)É[[^_ÍvUVSu0u$Cu5 SAdž0e[^Ívs3NCt̐ P@ S@dž0e[^ÉUWVSTujV0*@4@@0P*H,P@]ELESVESLESVjEPE)PVg_h@VE1ÍvjEPEčPV-hSE%PV =G~0UP0@ 1ҍe[^_Ð}ESLESV-E{LESVjEPE)PVqhVEhPuVE =un0UPQPh%L6VXu>e[^_Ph6LQhGL6VpSh\LPhoLRhLPhLѐUWVS,} xShLjW$1e[^_É0H M P%1ۅ҉EEE tb^؋] %؉EP1QR EMU Q)؍e[^_ËP] E yE] ?ڍEP1RPh E؋MU܉@)؉Q뉋E %UR1RP" xjuu近!Ѓ@1PjEPLEԨu1%RP )M ؁%1ۉȍMQRPz juu!Ѓ@tdPjEPK Mȃ]%EȉUuRP +EPhL7Wu hLjWjPhLVhM7WxRhLPhMPhMPhMu1ҋE RP} QhNuSQ^ WRh@NPh5MWPhlNLPhRMAPhcM6VhxM\PhMQShNFUWVSEԍ9v׃P5~u}t25P`n1уt10e[^_É<$B<%uBpu1CƒrwY$NUЋpidיEЉRU2UQPca1уt1EЍU)MMEz O%vtK~W(@ AG9}1[^_Á뺐UWVS tt e[^_ÍvPjjS@tC@WPjSVjjS 1fz~1FB9~tꃹuQBtjS@tjFSF1PS 렃j1SXZF'܉UWVS E1҅t e[^_ÃjjRtء@@ @@ f@ffBP fzfBfBfA B ~ fBj@PQC {C@PCPQC Ëp k1fx1BB\B\@QPj \@tsP@9D GB9rE@@)E U nE11fx~b1t7FG@9~@@t @ƃuƃVf@TU҉PuT tI@ 6@ H#ǀE Ue[^_Ã=`Y= KLX@)E U 111t;FG@9@t @ƃuƒ P?"  P(" X@)E U ~w11N1FG@93@t @ƃuºER 낉Ut+@@ÐUWVS UҸUэ@R(s;B| RQ;x@D Pe[^_Ív SЃ뽡@x2v jj]rQx| Pv SЃrQB0ۃ`<~\0ۃ`R;B| MRQ:A P+ SЃmrQѮY;B| ERQi:9UWVS ǡt^ txNxA9~6x)tR(@98t 8 CA9ʉ 09ht P[ A+x9Tp^NQ AH9t@xt ~09ht Pt[ $QBHBx@Du= A9x;1AH9xAʼn P/뵉 SЃ닐qSجv0ۃ`;B| XRSf8L @pe[^_UWVSljU졘@uEv}7;wBH9t@xt <~,09ht PY$˅RBHBx@DOB9x M})7}aEU9U}9wuEE9E}U94tCtb;E}KCxl104C1C U9Ax9EE}EtJU09ht P;Xu%PC:PmUx}BH9t@xt ~09ht PW$˅RBHBx@D|B9x|E<)EE1e[^_1;u}BH9t @xt ~09ht PV$˅RBHBx@DLB9x}F;F0BH9x1v Pov SЃnrQX1;uBH9t @xt ~09ht PU$˅RBHBx@DuCB9x} F;vF-BH9x>뿉 PC믉 SЃ념rQp0ۃ`0ۃ`;B| FRQn2:;B| RQN28t/EQPEPPvf}f}v% h0ҡ9ht RSu衘@P(E9Eu苂hx@tut!@xu j{SVSxtdtxE<)E BH9x2 Pr SЃtrQ`0ۃ`0ۃ`BH9t^@xt <~u09ht PR $˅%RBHB;x@DB9x;B| rRQ/fBH9x P(s SЃDrQΣ0;B| RQf/ P? SЃBH9xrQ^0ۃ`;B| RQ.UWVS E9UEUEu }tB)@;~/19'MM99|!1C9~ڋMe[)^W_v)Љ‹M) h@ut!@xu j8PSuxtaU艐t1҉x\vCB9SvUWVS 09htxt POQhESuUxtOM艈tx1ҋEN@TIE])9< SЃCH9x} P:Y}wQ0ۃ`N;B| RQoURh h@u tBxu jm/ juxt@UtǀxU0ҡ9ht R/PhNuBx j, UWVS EHU]u MaBuNBt9SBt 9uBt9e[^_Ð9uu9u h@u tBxu j!, juxt=U쉐tǀxU0ҡ9ht R+PhPhjj+u =uu]ÉPjhjغ   ]ÍvPhh롃 h   jhtUSEpkB B$B($ l,hDRh`p ؋]ÍvUSRtC S]ÐUSP=]t9||u s kbXs$bbXs(YbC,}C0u (uiuQu9 s裍Ct K SQ;tM]à P8빃 P*롃 P뉃 Pn|#lp]à PJ7/8 < s)vU1ÐU1ÐUÉUÍvUÍvUVSEEjPSMu7]يt<;tAE@Pt;u9;te[^ÉxʉƍAEe[^ÍvUWVS$h]u j}f]fuFEܣEU܉|jWgPfXfXfpǀtǀxǀ|ǀǀǀfǀ\ǀdxǀp$4\tKƀ0ƀ1ǀ4ǀ8$G\$KU܋MǁHǀL ǀP ǀT ǀX ǀ\ ǀ`ǀhǀlǀp@ fx~M:%o@@%<@ f@@ǀH/Shh`DPƀGƀFǀtǀǀjjuV]Sb EFjjVSaE$P$P ǀdp @@cXc 1ɺ  BtRjjVS\a@ PVR PfXf)X  P  @ GtvjjV  @P`£EtP(EEe[^_j@)PVS`y PVR P= hG\G488 M܋C @94VC @U98KM EQ\ƿQ\ujEǀ[\8{}t Ew\ƿw\tlC MP4י4E܋RC MP8י8E8Eǀ\UELvUM1t6 \s# E  B @  1UEtEv1Ut,ǀd P\&`ÐUWVS ++ ++4+0+8+<+$-@|+~,_+:'#Xo< >v^## # -(-D<H>L*P!Tf5FlFHtD11I9s/FHa&`})+| .~0tC9rӍe[^_ÍvfwFHDC @C`lj P5aUWVS @;d~0P5``@d5=fG1f9Nw9~x `)ډ]C9~t)9tGHPLQuR =G9~2 `t9WvC9~t9~w9GKx^ `KxQt9}xA5`)ډKxt)9tDE@HPQuRgye[^_UB1;Et ÍvB;E tUWVS CESC)Eu uEZYtt$VB@EBB x6uޡU@ fPMfK@ M fE fB@ f@f+EfBU)UE M 1e[^_ÍvfJ;E|@Ef+CfBC9tLPWuR96K+E;EtC;EuEEC9uv} ;Mt܋M+MM뗃 Pǀ3 PǀvUWVS u }ƀxVW1YZu e[^_à h[oXZj5-[XVWÃe[^_UWVS EEt ltEEt;lt)hh@ fx~<!EhEu}tC@ f@f~2ЉЉ%?   !M9].EĀ}Eteu!#}}t-Eu&}u 9Uu EPjR*]h@A@ Et D@Qu jEE0JEAP @tt Et=t5@t#Ru j貆vt Dtt@t@}tG]u}t:h9Mu}ttE9tu EPuQ(@t@Hdyt@pht t@Hlot@pxjt@bt@]t@Xt@St@Nt@It@ Dt@?t@ t@@t)@tRu jJv}tMUhe[^1_ÍvuPu jE PEPEPEPEPEPEPEPEP 64P葃%h}6EUh9Mu}tEtE9u EPuQ%@CRu jhhG9Wu j輂Su j藂h0h}8Uu }'9Uu}tEtE9u EPuR$Ehe[^1_À}E9Su jRu jā)Su j諁.Vu j蒁E0 ǁ%hRu jpdkqSu jphUvRu jpl?{Su jpx)Ru jSu jRu jހSu jŀRu j謀Su j蓀Ru j zSu jaQu jHUhS]VEt<>t2vЁwAt70P \$C<>uыu]C \d<*t@<.uC<>tЁwt0P$5\]E뛍vW $ vUS RP=@BtT Йȋ]ÐUB@puvRJ uDǀxǀtpt ǀpRlqÍv@HPjr 0P軀떉 P諀sUSPҋ  ~ _әj@pYXj@p0XZj@pHdYXj@p8DXZj@pD$YXj@p,XZj@pLYXj@p| XZj@ǀPPB( uB<jjj.P4YXj j@p.PXZj j@?.PYXj j@.PXZj j@-PpYXj j@p -PBXZj j@~-P@@@@@4@@T@j@,]j@u,,j@D,Pjj @,Pjj+j@p +sj@+B9‹~=9~=93ЉXu1v]v9ËXtҋSpt˃PRutǃ@ǀ]jBvǃ^vUWVSV׍U؊ERDžDž9} Dž@BB9} SM )BB@,m8  ;EURVDž@@,1I9KK2qK΋vu (ZYPVNt 9} +} JBXLt ;_@B@BE؋MFE9MFEDž@BBH E9EM)Jt`9}M'ZYP EPVP,tB@D@B@Bt e[^_Ð]+]J'B@8tPhRQDDž@@81I˃9K4vP؋K͋9S EPVPvup 6&_ZP ]SVvPt 9%ZYP EPV Pt v9Wf%_ZP EPVPt9$ZYP EPV=PPtrPhRQZ9H;u:u1 A$M P(I]=w1;}9 A$] P([]h09G;|耽1;+U R<@$@(UڋCA;|);R MQVPDž@BURVZDž@@L1I9Kv>KK~%uDž@B |l@@D1I19v@O)P;tON@BDDž@B UWVS,ۋ} E9EK;M9|WЙEC;E1@ $|BHB N~?@P8$Z|BHBp 1tCH;E}E;E}EuuDžDž@BK PhREPGPt[}\S}~1@;E~%U+UE)}"tIhEPjuuWU=@Bt;}Dž}BH]B@0`B@H1~ B8t xvtPhREPw8$\vEEUjjuuWUE3@BtVhf}gVujh]ɐUMɋU tQ1ÐUWVSơ@H1ɉ~9tGI[^_ÐUVS@1ۀx tp @P~v9tCJ[^ÍvUWVS|EEJ1~`8uE;M~ ]Ѓx-E x&StGTuMA@9~e[^_ËU 19W4uGM TMtsMA@9W\_0E G4ZU R]11ۍ #G@9~"EP(UG( F uڃ|ލe[^1_ÃX뒋U JxUMɋU tQ1ÍvUWVS }t G8Eu e[^_É PEfWƀuEEG4M@Y( fDfxCЋuG0Lw())xUG9}fFft994fFft"9|fWEƒE ;E}e[^_ÉfN݉fVƉ1USP]t,C8t%PCC0PC4Ps89 [8u׍v]ÍvUWVSEUB PBPB@PB@P>EMUfAfBfffQMfQMfAMfAMfAMfAMfA MfA MfAHMfAHMfA MfA MAMAMAMAMAMAMAMAMAMAMA MA MA$MA$MAMAMAMAA0A4A8MfA,MfA,MfA.MfA.MA怉EEuh1ۉE䐋UMB(Q(M<4EtfEMP(A(fDfDEP(A(fDfDEUB ;E}Ee[^_Íe[^1_ÐUWVS ut" t1vC9tڋue[^_ÅF uKEfVƀu;1Eƒ ;E|(F(t PjfVE ;E}؃ v(j$j;5tC;5t/;5t 1e[^_1tZ뱐U19‰tÅ~ÉUWVS uEEt E u 1e[^_Éj`j舖EU1tۃ]j uiljC(fCUfBEHfCE HfCEfCUfS fAfCHfs CC 1Ҁ}SCCCCC C$CCC0C4C8fC,EHfC.fCfC@fCDfCBfCFE~+u N1ɋU{(fD9C(ft Ju }uUU A9t vCuFUS] E Pt&@0u t0 [É%鐋@ȉ 0ۀtÁ [UWVSE @uEu ؃} NVF0 Et0 E@V(fBf9~[fJf^A9}ffBfF.fN @f9~ff^tDjVou%vB9}fJf^A9|vfN1e[^_ÉfJlv^É Ёt߁ $ffF뵐 S3ExfNщUfЃ fEډUn  5UVЋE0 E ɋ^Fǁ\% t0 ЉEڍ@V(fBf9fJjViE4 VWfN @EF.9EEVUM~jV EUWVS,uE EE8@} NV;F0% Et0 E@V(fBf9fJf^A9fBfF.fN @f9~ff^vjV!؃@ SSEx'fNщUfЃ fE։UUvЋE0 E ɋ^Fǁt% t0 ЉE֍@V(fBfN9fJjV먐UWVS,uE EEB@} NVGF0#% Et0 E@V(fBf9fJf^A9fBfF.fN @f9~ff^vjV ؃@ S'Ex'fNщUfЃ fE։UUvЋE0 E ɋ^Fǁ% t0 ЉE֍@V(fBfZ9fJUSR];t0 Su{t @PC]ÍvCP]ÐUWVS }U t1ۄҋ5u_1F [^_Ðku@@ tԳUWVS }E t1ۄ5u_G [^_tvUSQ]C=wS1҉Z[ÉUMɊU t1HA$1ÉUMɋU tQ1ÍvUUtE B$ÉUM ѡɉt@u1Ív@t P1ÉUVSupw&9މt t#~ut`p tBe[^Ð@P@Ҹt RpS ue[^á@PP뺍vu@P4릍vU塸UP1ÉUWVS1҅ۉt C 9t1t[^_ÐStvUER,랉USS]t<@duRx4uf@4X5]1Ð@`tރ P < ˍv P & x4u뛉UMɋU tQ ‰ETÐU1҉t%JtRJTu tÉuڃy|t틉uÐU1҉t-Ru tJXu tÐUSPEt1 f@1҅u؋]ÐUSR]۸t SJ$?;t1]1퐐UWVS ]۸tvfS @ffsuo@uzf9C|tfKf9|k@S(fBf{tf9~frfKfJƋ C99v SN1e[^_Ðf9C~fS 낐e[^_ÐUSS1ۃ=d Cdt8`wdQP@4,PZ뽐]ÐUSuE&t!PjEPSpx U9t:t]ÐUWVS u ]}=ftTӉUCt58tSu68FtJÊCuˀtStʉ봃j j jÉEFt|Sf@ t0vj jitbFt%Pf@ >uf{ ve[^_ÀT@؃j jiCtÉE|CE SE<]u땐U1ÐUWVSEU @\DždXh/CTt 8/~ h~d QhPS`rFtd󥍅hEhCt5< t<:uCt!< t<:tt9wʃvTt,Tt t u+ P+R R 9|vE1=wJt@tÍF|PЊ=vߍ.<*u} FEt8$uF>V1ɅutÍFLPЊ=vߍ. 1*%/(7}u}u#gfffӉ )S.^ j$U$<Ugfffщ )QBe[^_EF=wt F|8Њv=. FF=wt ÍLАF=uFM *tFU h|e[^_ÉUWVS<uƋU pE j|tnE +Cj|t8+9uЋ9ue[^_Ë@[UWVS,E}utu u8vQhjSV{ PWS@vq Ra%tnt Sփu SYǂ`UD4%u heAct$tu늅e[^_à h]bUWVS|EۈDžDž1utl;v23@tFB~ 73 Ph5x:u~" $u-xBHBxM t(=05xj Su؋1~e[^_ÃRj QҋDžYDžC((Džv 32z4r,ƅ$_=t]9t4PhV02t|0ƅuuWU1׹ PRPV{HVh k_B0 9{(=1JK(DžS0p( ;SP>lC(t$@t$R.YC(HC(u܃SWYCC Co ߍjSiU*=\fK1fu "B9~C<ufKB9fK1fu &B9~C fuCр~{F)[^1҅t[^[1҉^ÉUEuÍvEEUEPQEBUWVSӋU҉t1t[^_ÐE[^_UWVSxEPe u38U5~|6 VK9MA$$;B}j|S茭tDv)؃ ~!SPU9&qt%1Ph3qeBj|^SHuMA( Pv޿'tY<EX( 5[V8C,UB(M@T4A( Poq XE0$@E =]Ctw@pPhVS|?_}XGHS?Gt$l1Gt@$qGt@$kGt@$xGt@$jGt@$mGt@$wGt@$umGt@$vQGt@ $t5Gt@ $n ju61e[^_ÉҸuP5q"d{9ljtpHOMqt5 tW5Phq>=tUt}2 =:t,P@A=5i V4}KWC }SG=H=  t$56R u܋G 1ۃ>tۃ4rRt#vCt4ORu j&!ƒ9zt 9zuB9uЉÅ=$P 5hUq =lj 1=P Pjh5 ÃK]S fJgj+ƅU2膧% ƅ}_u(u,CuB]C f@DfPhqhmqS-$2}WB_{8u?}G f@HfPhqhmqS-$B2WB8_s,e0MAx)MA f@Ff| PhqhmqS)-$1]SB,}C_vKXlj 1=P PjhKX]Ãh% ']Cx*N}_8 jiP荥ƅt xm8j,Xtw=`p+`pt8 t+1I9uWSR2uύvF@GlG EX4u# t4UBǀ ZuT}GxuH < u" hq/]S}_@b@[PhVSu7_UXBHS7YMALj\}ZGHkCXG@l-XGDmXGhnXG`qXGPtXGTuYGXvZG\wXGdx}4 Vx.WH$q7Dt@HLt@uPt@dTt@SXt@B\t@1`t@ dt@ht@HYCdN@ h@f-MQHMSA=y56K uP huq{6UB f@ffPhrF6}}Gu)x&t#0S,UBZulx)SGB@2B+Ph VS4_}XGpST4b}Gx+x'UBu?B f@JfPhqhmqS'$+MQ}W fzUB@}G4@?UC,UBZUBx%-4 C8}_MY; hq +MQ]C f@ƅ P*MQY P*W_]C f@FfGPhqhmqS%$o*}WGA hqK*]SlMSAY hq*MQBYVShDrf3lh67ZYhv&ۉUCZt<Gt@SRG S;1P6vhlrq6hqbЊҍt$t1A@u Q&)]OSxu@뾋}G@MA(Ή Kj+v,*uƅًFhv%m _ VQ(WH$r1GǀtSBS,BQh VS/XZUBpS07MAv hʹ'MQBALGx*fBQClPV5ƃs Eh=+5hq0MYx)rMA f@FfPhqhmqS"$&]S}C_"S]C fP hr0F%hvvv6hs/v1m hq*&MQ<Y hq&W_Pv6h(sZ/ahq[^}_ hLs/vv6hs/ hqt%MQB,AYRv6hs. hq;%MQA hq%MQB8Y hq$MQAYO] C,ZYPhsGS,uOUBMAp,S,u ]C\ Vj$]SC< VJ$USP ɋ]t91 <|tBwu ]Ãhj;묉UWVS}E UEUtjtdUUÀ}ut vFGte8tEt@UMtv8t$AuGEuGu1[^_ËUt>tGtu݊럋E֐UWS(1҅t t e[_à hhvt1щу v뽉щу QtRShsPǃ h],UWS]CuEuSCu`C umCuzCC 1e[_Ð PCt P/Ct PC t PCt PCz PCm P 1e[_ÐUU$$ÐUEt E*hj99E*UMU tɉ  t ÍvUWVSuI EҸt. U;@ Ѝe[^_Ë ҉U 11ې9=dP5)PPۣuE ыUYEE}= @< t< t}эQvE| 1| E| 8#:vMfD E 2e[^_ÃP56t̅ 5^QD = } USS]v9t@uY[UWVSuEEEsÉ9tjteE H9t]ti^tp\ tNF}E}X~}u h tq'E É9ue[^_Åt묃 t^u}%tÉw = P%%u SF#ZYPhu&?߃u,_ÉF@ЃwzEE;É"@Ѓv+ Sh8tZ&EE\Ѓ}]~]uEECjw$\v Sl"ZYPh\t&FiD4FJ hu%5 , $   ^\:, hu/& ;tB Z ht&UWVS|EEEt< t)P$t؍e[^_øС$NP Ҹuá Et +Ev t t t\==: . S #%.Phx} P) PE1 1t:uv/ t t tD4L=uE.t t t: Sw Phxht ##==|-|F=EF :,\ÈFà P_1҃Ft3 S!%uС_tF:6#Gt$}u S&[_Phu!}t%e[^_M t t t$ EPVƃǐD4E;V= }1эy R/ %@t*Ot1E8w֡D4׾OE<8,:vuN< t< t<,tFj|5請X 5& j|5ȣ }u8u hv_ ||9sPӁvX R%@1/lShv8F9r|D4,Fhj.|||1ы||:1эt=@A9t&}u SZ P5htv,911 P%t#\.FNw'=wӡD4D5PjEPuV}u@E9u5h"v5E8u 9t h:v=7 hLv} hu=|}Sh,uэv} h\u|PVr}u9t h:vB5g huUWVS }1KCȄuљE u,fC fx,M @W31uՍe[^_Íe[^1_ÐUWVS u} L v L9v#9{u3u51uڍe[^_Íe[^1_ÐU}@u@ÍvU}uÐUt Ív h]uЃ h]UWVS ֋)ЉE1E);v#PR2t*UVSz1эeD[^_à h] vUut0ÉH@É hUWVS 1\#^οЁvz R%ty,tr'tm\th:tcã    'xe[^_ÐD4%uEcã<  f1f0 غ   }e[^_Ív@у3%0%$} Ҿ\οfЍffʍf(ƒ0 غ \ã'fҍf0  +ãv@ƿ @tGсvUWVS 5ljtv9u}K=t7w0vJ K iuϋ t~{tB=2e[^_á1@@gHe[^_f?f6 h3l hkKue[^_UWVS ] }1ۣ =v.%3Co%CNwK$Dtȉލv=w u *t.uC ݊<3]<2&  %yKuPPPvZYPh$ P1  C сw uӀ*t΀.tɺ  e[^_ÍvC   J  e[^_á %빺zK KϺ5빡@uh@uhl@`uh&HQM%[ú:i*ú? :f  =+-*/úfD GPq}_di5úlúqcC&u tVE9tO\tW$t%  EVE̋u tE U tu9u1}ue[^_ÉU B<^t<,uE u   EE룋E x}vE NjE x%u%]S}Whu 蕳URWhu wmS]Shu Y#URShu ;EPEPh@u PWhu HmWShu HTGu Pu E؃E } +EvE̋E x/XvЁw u<.t<*uKM u <<  E CE̊Ёw u<.t<*tTj;u xZE uUEu Eej;u XxYE uUEzE̋E 8fEyE̋U j+u xE fEAE̊EЉUEIEK;$]j;u wTj;u wM=U=8E U_u u.EԃE }`JE  E E U Ã%Nw$ Ë EEU ME U 121QTj %t(E   EE̋E =v΃Ph,v#d낉 %u]܅E5u EEEUSP]KfC,fC'fC fC"fC$fC&S Ctd1f{tCCB91f{tvC fPCB91f{ tCC B9]à hxC뇃 jNC k j,jCK hRUVShjutQhVP!XZVSe[^ÉUWVS U1ˋ5Ӎ=v5e[^_ÃRPG5e[^_ÉUWVS E ug=)P`F 1ۃ~;NDŽC9~$t0+PC9މN(1ۃ~4V,DŽhC 9~t+PhC 9 5FR55P F``1ۃf~ u<;FVCF 9~!uًFF C9gV$F"V&Љ`19Dž\}S=PV1 DD\P)DDC;`| \Fo1;`Dž\}TVvF\PF4V<1C\;`|~(1ۅ~3V,FC 9^(~huC 9^(ve[^_DŽ 6fV 1ۃf҉t0Ftt PVfV vC9ЋN(1ۃ~0 C 9~"G,u jsG,N(C 9ރ vovF h]|UWVSu V}WfV1Ƀfu0HA9~FuGfVA9f^1ft'vF Ht`t G fHf^A9f^ 1ft"Ft=t Gf^ A9ߍe[^_ÍvGfV끍vG fH롐GUS ]j/St@]Ð؋]ÐUvUWVS] uSVK1҅x e[^_Ãt 08te[^_1IwڃVS7$St9tjS댉fDž.vUSQ1҅tZ[É1ۅuډZ[t됐UE`UWVS U ҋ]`(} g1} у Q4E"U FBU ؃"\w.D4% v  Ӂ R%C@~\F^FU BU >"FEe[^_à S/%O~뺉\^~뫍~\Fn~\Fr~\FbPShsV1э|1^~\Fe룡D4$Uuj ÐUUҋM t JEHɉBtUu juÉUM EQPQPÐUWSU ҋ]t11эyC9vKu)Ce[_Ðe[1_ÍvRQ{C͍vUWSU ҋ]t11эyC9v u)Ce[_Ée[1_ÍvRQCCȐUEÍvUSR]t#tPhS5]ÉhjčvUuPuÐU=tÍvP5h5x]xQPhz5x?xRPh5x!t8uE5xj:lXZ5xj ] E Pu5x<YX5xj 9QPh5xU 5h5xxRPhz5xzxQPh5x\t8uO5xj:YX5xj  E Pu5xwXZ5xj t$RPh5x뚐U 5h5xxQPhz5xxRPh5xt8uO5xj:XZ5xj  E Pu5x觤YX5xj $ QPh5x뚐UWVS ]EU}1~F~BE 0U2:|[~qU U UOFȋUUUFKO~U U UFOe[^_ÐUUUKFlfUUEFE KOKvUWVS ƉӋ}WP|tKe[^1_ðe[^_ÍvUWVSƉUfx"f^$ӍN&;EUEf)fFfFPv FF"HUEF)ЉEӉKx9 M4FU5rFU‹MEMKyNjEfF"f^$;E E f)fFfFPv F M F$VH)ʉEUˉKxAM  M4FUEEMMV fBKfJyE fF$fV&;EEf)fF fF Pvq MFV F&H)ʃKEUx[E E؋U<EEMMVًKx, 7FUűUڋFKyԋMfN&e[^_ËEF]UڋF fPUt ~"t 1Ð@"ÉP"@$Ív1t1ۉU҉tJtQ$@"Q&É@"ÉP"@$ÍvUWVS UUzËU9Ésv4utC9re[^_Íe[^_ÍvUVSËEt$Ht5C&K S$)C")[^ÍvCS")[^ÉCS$)UWVSu9ǃ1xGV$F"V&\ VDA9|u]}Zt~z}tBe[^_fVX9߉}vV fDJfJA9|fVBfN$fFfV X9߉}VDA9|fV BfN&fF 댋EufVX9߉}VD  A9|fVBfN"fFRUWVSƋEUE‰ËUEV$F"V&T;]Us#~v4u tj|C;]rEPvFMI VDI9wFUuډ}[to~*}e[^_ËUUe[^_MufF@fFfF"PvFFH VD  I9wfF@fFfF$Pv NF FHvV fDJfJI9we[^_fF @fF fF&PvFF H VDI9we[^_ÉUWVS ÉU@"S$fS&EEu9ƉEC<C +E)ЍSh<hshj=h<hksrh-joD E 둋E @Dž8x|E J>UVS uƃt,j=Vt!Rj@PVÉ4$贠؍e[^à V袠鐐UWVS Hɋ}ujxt^ZxLƃ:VWAx:D;upe[^_É pHE ;M} Cx:-txe[^_ÉBZ-xLtC5LLxj-W@tf-L- zuA py;tzD pAxpptңpt*?:t%5L #} Phq5xe[^?_Ë pA;M p|5x?::ttV | Ph뜋U D;VWt$ |$L$tfffIutCffffffffffffffffffffffffIu_^ÐWV|$ t$L$uL$u1^_ù))GV)^_ÐWV|$ t$L$u L$^_kv7̀rϐWv*̀rL$QYB̀rQ*U师ÐUEUEUEUEÍvUEUvUEUUWVSLӉiEԉ];vtEE<%EЁvo R %@uj R%@t'Ft Ӂw١D4%@u܍vU{uEe[^_áD4%@uF:]tE1EEEEy$=wtE]܅Et5t/=w%tEM܍Ë]܍TPFۉUu˃}hU}GE8Sj EPV8"~ ]8uEPuuE UEԃu u}}ԋ1׉IPQRVM|J Eԋ1׉IPQRVM{SUB Dt }GEu܊=E}܅Et5t/=w%tEM܍}ÍTPFUuˋEH UBWЁ= R%@N R%@8E}0Ӂw̡D4=2$EE܅Et5t/=w%tEMÍTPЋEFUuˀ}H}k} U}WvЁg R%@ R%@8EE0Ӂw̡D4̓}ԋu uXEE}BE} wjE؅uUԋED01ۉEǹIPQuVM:yt0EUԋEعIPQuMV yu} EUBu܋}u R%EEU5Ёw̡D4̓}ԋu u>UE}ԋUT|1UIWQRVM>xt7UԋED`Elj1IRQuVMxt E}v}}EUBu=^PEE܅Et5t/=w%t}M܍TPЋEFUuˋEH=mUB}0=EE܅Et5t/=w%t}M܍TPЋEFUu˃}wEUB 1Ё R%@ R%@E}Ӂw̡D4=EE܅Et5t/=w%tEMÍTPЋEFUu˃}5/Ё# R%@& R%@EUӁw̡D4F% }ԃ(:Ӂ Rk%@|=1}Y|}E0t/=w%tEÍTPЉUMFM܅uˀ}Y}yUCU}WЁ8 R%@L R%@EEӁw̡D4͋Eԃ=Ã0EE}xЁ% R%@ R%@EUӁw̡D4ͅE؅=Eu uM؅uu uSӁ+ R%@J=oaEE܅Et5t/=w%tEMÍTPЋEFUuˀ}M@}<EU5Ё Rf%@w RK%@E}xӁw̡D4̓u uau u4EUԋ1߹IPQSMVqEx (UBu}E9u])C)č|$PSVW}賴;FJXǹu8uE uES50uuqUB uϡD4"D4D4D4D4D4D4<54u}G u?D4D4};U}Wml[}DQEdHj8vUVSMEU uEQVtMu e[^Ð V EXZVEP複e[^US]fEfEBh-EEEEEDžDžDžDžDžRhj Pc uu EP%<xEE]à u蟍, ]UU uPRu>Ujjju(ÐUVS$ҋ|u+CHCx8Uu$uJe[^Ð SSCHCyɐ;C|} uSuAơ$tv Se[^ÐUVS$ҋ]u&CHCx30@$u:e[^Ð SCHCyΐ Sơ$tǐ SWe[^ÐUVS$uu^ u)e[^à VS^ $tؐ Ve[^ÐUSQ$ҋ]u"fc $u]Ív]] SАUWVSL]ـ} utytv9t ut"r}W豿R1˅t9vPRu聿e[^_átYwsth uvPFPRuGED0RQh}WŲ_tWPhfEP}衲BېU駓vU釓vUvUEPu hhuEUvUcUSR5 3XsStC B C Slju]ÍvUWVSPljiE SiE jN3WtT[uEEF1Ct SP C t V1e[^_Åt sۈECMtǃ u뷃 u谈C 묃 u蓈[u芈USRh=S:t8t]ÐUWVS,DžqVhP1trQhP脘E1эр) tgu Dže[^_à hdBF hd*6ээhƄ)Pqƿt޿uYDž!t~ DžtquDžq냍ƍttrډ0%Dž, ڋ@  U u1_1vUSS]Cu S<1]Ð P+ S1]UWVSjuǃ t, u dGZt1щ 1e[^_à R踄 vUEpdU  ÐUWVS 1} IuwN j9Ãۉ t4 h Cxt u p蓸 1e[^_à P vUWVS }u t93Vt5[uFe[^_ø1te[^_ËCE }e[^_UhuqÍvUh,uYÍvUhuAÍvUhqu)ÍvUWVS 'u`h+-5 hPUE X`ƒ+-CXҋ`uEPuO\X\r1vTD4T4GHG6@ $B5$tσ Wƒ1ې t vF t t `  F< < < |uh+xiDžX<@UhDžXhdjhPjP|{B`DžXƒ+8`BDž\^<@`@Pu聺-i@ht&djhRjPze[^_ËXu`Bt<@`@Pu밊h5 . 'i PUE :r i WƒdujP"z\:du`jPyUWVShjh]Pu }ptluQƅiƅhpFtFxF | uuhPhPue[^_Ãuƅiƅhl붸ύvUW }1uuE jEEPuEE2}ÐUWVS} Pu uP裻E1Džu<GPfwbEt;BEt0 uuu RW | W|Xu E uDžNpVn1IDŽ /.rhDostsDNzËXrv_XhV{lj$zvte]SV*vxzE%= $SW+1ZPv f W`Ze[^_Ãhh{ {ǃ  W`¸ 且 ݃ W1맸 ɐUW }1uuEu EjEPEE}ÐUWVS1}ȹtmLX*D@,8uY<<ۃ-1Q5$$tV$@PН$EEe[^_ÐEEe[^_yEEe[^_5|]5\܉]4\(]4\`]4E4E4E4Ew4Ed4EQEjj^ j.P tbFu74E@ E@Et@Ed4@tމt މjE ^pVղ.;D$L$A,tAPjjq L$T$QYai qyy1ÐT$z,tjBPjp T$D$JZbj rzju@L$ÐL$APjjp L$T$QYai qyy1ËT$jBPjgp T$D$JZbj rzju@L$ÐUjuu uuUjjujuÐUWVS }u] y{D4%u]$tX-tS_tN.tI+tD!t?*t:'t5(t0)t+,t&%FS ~ PjV%qux S%u;u t"u t tACCF\e[^_Ív*t?t[t #pt< w7$  S[vD4R \뉐؃ t&vV S%u tT\0FF0؃F0Fe[^_ÍvD4뫐@\FՃ@tPyMF S茙%^FC@u?F뎃 \F\FsFm\FrF`\FfFS\FvFF\FnF9\FtF,\FbF\FaF\F0E0F<80F0F-FFD4(UWVS ] MҋutCPVPQue[)^_ÉUWVS ]Mu }MvvFPWRQKwu+Me[^_jWPQh+Me[^_ÐU@B E1CUeEjEPlUWVS M}] ut"Bw0e[^_Ív$@$< e[^P_Á4tE1v`CPV]t0SVLtIE }vɃ}ue[^_Ëht*Mt܋dU }\ˉht֋] tdU ԍe[^1_US]x*E]EPEPa1@t$Ћ]Ð hЋ]Ðӹ8uЋU}US ]j/St @]É]ÐUWVSu %I@EMgt.v6- +f qguՉ8ou%AEtEt]tf#A!tf#A!ƃt f#Q!֍vUkt f#A t f#A ƃ@f#y 5XuE f q[^_fA!ƃ(UVSg]u Et;-=Xuۈt!fA[A^Ðotuuۈt:%Ѓ uXt+AfAuI[A^Ív+AfAt-tI=uI돍v+s-hv룍v-u fQ+AIHUWVSl}E1? ]S誑uȃ VSj'^$afE$a fUjVj]E$ TEU1EEE=v:EÃgtnaM GÃguM8GtPjEPWL‹Eă8u xt| uS1e[^_ÉotuuM G돃MG놐G+t8-t3=sEe1EX wa$=uU9Urj0u'S%EEEPVh=EBEEe[^_Ð=V]t^U9Ur8E]SuRE+EЍ\EU]EPuuXEE ,G6vIGvΒGtbE9Er>EUURuRE+EЉEEDUEEPVuӋE&E1 =@+ZU9Ur>EEEPuQE+EЉEEDUEEPPuEG EvEt EMGEt E G$GGEI=t|U9Ur>EEEPuPE+EЉEEDUEEPVuӋE EEEExEU9Ur:EEEPuBPtBE+EЉEEDUEEPuuXEM EE/M< uO1)E}Ѓ+t&-t!XtЃ+u1E1Ѓ-t$+t2Xu<A!Ѓ ÊЃ-uA E!!ÃA !E!Ut-GUfWt+GfwDXGf_1 uN=UWVSM1jhb^|x@uEDž|Džx pPw HhDžlDžhe PSjW (RSjV QSjV PSjV RSjV QSjV PSjVXZUR|躟 }uEueEMPQj|號P}1IQux2]E U|ƃvPjQ|]H  9sEt ؃Ӂ R8%tTEt#Ӂ RpEt%Ӂ\ RÉPjQ|Q\FH1EG,u}]QHjRjT (jQjT jPjT jRjT jQjT jPjT jRjyT|PPxZ$lYtD4]44e 1}}Wjh+xZu,}EVPj|ٜ |WZ :E te[^_1e[^_ 1UjhhuzuÐUEÐUuPY$WÐUWVS }?)Ѝ9    W+ t:FSj0^S5nFU ҍ^t8Fu1e[^1_ÍvFWh)j^SM 1u؍e[^_É~u m j( PUWVS }?)Ѝ9@@@ W^@t:FQj0^SEmFE ^t8Fu1e[^1_ÍvFWh)j^SU 1u؍e[^_É~u@m j[@PUVS(j+u n_EE ? EPa1҅ j GEEE$EGEGE'd$E 8ru u荗YuVU܉rZ$uPHU܉$Hu e[^à hD M hDLSv hDL랉 hDLE 8rQPuXuNEU MI d= d?UBс Rf %%u~ƉuDž|] u΅xt/v8t'CCfCC| u׍v t{Fuuxɋ] thx:t]Mt3t u*FCFCfFfCFC||~ t8u quuM|e[^_ÃdUBс tIt:f t1%`odiƋ`R`8?UU1Ɂ:ELFtËB%=ufzuzuÉUWVS@jjj}WDžDDž@Dž<Dž8Dž0!1@tQj4SWN4t e[^_SFZtHPWIxֿ(ؿ(1SR(ȿPWjj(j?$ $t$,ؿ1҃~#Ë,1ɉ8B((91QRDPWjj $0Dž8E t):t$@@f@@8 uׅj1RVW诒!Ѓ@@8@@v@PVRWYM9c)@4~8~ؿ#v4s8e$4 9tNj] t8t8_3 uh4BC4fQ=t ;|7C4P B<wK881 e,BC맃@P sO3=lDž8袞0t<0 I,t(,HY84Q ЃtK$Dt@DTD$D< BCUWVS׉QEvEXډ11 t؃E uZ[^1_ËEZ[^_ÐUE E EEvUWVS,EE9‰UspUz2Uڀ? Љw rP?vKvډȀ[ MQM11 udE9ErUB e[^_Éȃ* uM9Mt uUE=MQM u1e[^_ËMQM z1܋UERU܃E ‰EtMq؃! EuUԉ]ЋEЉр]E Ur؉р- dto119ӋMЋEwr9w11ۋM9ߋu؋Arww9vqEUruUԉ]ЋEЉр]E uM9MMqDuuEpuEEUr놉UԋE3U3E EUWVS }Wt5KG4tvu&Ku w"8Ge[^_à P8̍vUWVShjÍhuPb95w3vhPR3WtC t)95vиe[^_1vUWVS EEt9~GW R7GuG~4 HywMQӃ u+] S6EtN S‹Eu=GUBW}e[^_ÐRP6QӃ uq6ыG PV6G묐UWVS DžE H Ѓ/ ȋ} tj_vځ1 t Dž;E Z_ t ȃ/ uP} / Gt9Rv] S] VE HЃ/ ";Mve[^_ËO Fhu~E@ @uVPd?ubUB t0A/ AtE%=@_=uF u=?1+URQP$zM9vC觖V fDž.uF @ SV DžDž]C @t s {.u U . BuPhjQځ]9sHPjRÍ@vQщV t ;ur WU uEC+PhjP(uuWu4uF @ V SYt_ hڋ%EXu 1҉ hڋ\ZY0SURu MA tt "t; htuu]C @t|uVPS(E%=@;U/CBp臓?`URQ;뀍vUWVS@‹~ BuA Ƌܿt*v?{m*1҉WuG ;ܿA 1e[^_Ã[u!V +[G!DB u ue[^_h@t j+ܿPYܿAܿPcU9WӃQ uߍAFؿ]_[G!ؿ1҉W- Fu%^]t-G1҃W]uJ ]<% PƒҋYrt Pu݃\;$븸!GvUWVS, Ë{ CuC} C {uSW9uGDžyQI ЉtJЃ[ ЋN] t u uމN u‹uV  ue[^_ËSC  ue[^_ÉЃ{ u lЃ} _iF9ЋK[ [Ѓ, ȍ{{9s QW9rFQщW uރ u{9.Džv߃ЋK] t uȃ t{뽍vЃ{ t%Ѓ} ȍ{u{{vUWVS E }uE@E E tUB`uDž` vDž`E ]C ECCE \RhjhPwE);|advhVjWS褾@t3dƋ\rE);\}\F}  `PUe[^_ÍvPhjhPvE)9|11?\tshPjWdPν@Yd ؋\S\ϋE+\911?\uG?uK\\C@\뿐@ `PUe[^_1۾@0e[^_ÐUWVS(jj]Sjh:  u&Et| jjSPh: 98e19ˉM}-u}}䐃Vuqt2CE$$;]| u&(e[^_Ë} u ub&e[^1҉_à uK&뿐USP Pɋ] T~(QSR5L>/P1TI)9wkLuwI)ȃ TP%LtbRS5TP.‰PxD@)9TvELP]É Pc% Pr1]Pjjjf.P1]ÐUSRát=\\u1]Ðjh\u-x m1ːUSP$uE $ɉu-؋]É hXW*E` $ɉtӃ hXc*؃]ÐUWP$u>E&‹Eu1;M ~FE"$uE}É hX)밉 hX)E}PQRuuHUWVSh(荤t8uJ WPh2jhpp1ыEIE e[^p_ÐPj EPSU|ot>U t zуMt/tGum@뻃muS9\؁= h?kt?gtLShXW렃jhn9뎃KuȿqO\@]U jjEPhjEPEEEMo @tÐUWVSQE1ۅt)1v׹эQ9vӃEEuZC[^_USSv [P!ۉu]ÉUVSut3CuC Ry!f{2y߃ Sf!FuaFuL vJ!F$u& vr01ۃu9 v0u@ V!1e[^à P!*臃 v0t V eUUwE fP81Ív;ɸÉUE@(ÐUE@DÐUU EP(ÉUWVSl@$Ӎuur{,VS(fF fC0C@8.t:Cfx2xv9P(t@fx2ye[^_9x,uAHt .uxu%E9tPj`jVmfF艁 UU@DH vUSQPÍ=CvNCuC7?]Ív PC ?ӍvPs[C]ÐUWVS ]9XƉ|TN@uhX jSvSN9KuAKBuBe[^_ÍC(FPvJ[FuFe[^_ÍvUWVS Ƌ}F$UGIu PgÃ1tWF$uZCHS@C@tċHHPQEPuH FDPEPu1@tD҉V=te1عEPIuMl}1Ʌt"I;MrFBu1ɍe[^_F똋}Utv<=tBu+UM D P0tME0AMt<=EB@ɉEt=u=BFBu1g01vGu9t^ ȃ PM`ùPuS5000D}PR90뾐UVSu]SVktU0Btۃe[^ÐST$L$ 18uBu[ÐUS]9ډsvAtB9r[ÍvUS(PR]SMMu U]ÉUWVSEE UE;EU$%t/]9]t}UBUEMuًEe[^_É11EE}Ãzw$MY xY$۸g uU Eع<RU0puu$MIMWuuuUE8uEEEE.EPH9wMD|uUQ^EEP H9w܋]ɍuD0Ƌ]t}wlQЃu)ut.RuuuU<4gPuuuU]}GuuEUB ҉u uuډhM]C뤅PuuuUFu]u}*PuuuU EtUr+r$IEP}ҋ@)Ѝp$I鉅h )lMPu]SH9}D`UVuuuULEM|q]}G @EMA (}G(@UB %Ѓ0]E]MC0lEPpUHlMdufEnE+E EJ)Ѓ}E9E$9MhNdufEn`Emz}W H9M]MC @}MA}M}A@xuU+]{ w}sMPPuuuU<UBuufE]UWRuuUEE}9EMAUlduUaUBSLE Nju Pw Ph]S uU[EmxFVgtcMu0uUrFU})ϸ$I)@띰E}Ed(j]gUWVS u}EPEPE PEWUËEu19]t)e[^_à hbtփ5xj \QVhE5x5xj#jh,Etet65xj jh[XZ5xj W(5xjjhg5xjjhzy5xj jh랐US] ؃UUURhEEjEЍ PfEfEDžDžDžDžDžO/ uuEPۉtEЋ]ÍvtWLUWVS E"ЃU3B8e[^_ÐEP,1ۃ~ @(94ttC9EP41ۃ~@0949t}hC9E@$1ۃE~]UR U V'!uMC9]~9M %=uE#E EMy }^}3EM3G8^E #E EG<U1ۅuO}M4u(} uBƒfto}t }^E U1EE^9^}E#E E1%=^E#E u7ƒ(M4_t9]t1Ӂ R%_t3с RQ% _GGEU<tE܉E؋UX9ۋu}M9MPSuufU puuPuuuuMU EEE܃ uU܋E9PQ11ۃ EESEBME Z$EEB?1xZ(,t=]Ӂ R%_GuWuuMU ED4gD4-D4 D4uUBRUBS E؍e[^_EUWVS] ;]EU}v]EQ%=X=HEA %=H w3=(t=tv];]|Ee[^_=hWW=XuԋEvFRuSPUE uuu‰ƋE;Eű}OPWCSVUE]eBu]ov=x!u%Ɖu%=u%Ɖu%=uEFRuSPUE uuu‰ƋE;EuC}]O]] 9t!]PWuVڋEu؋]QWuP=0E]=p=xnEFRuSPUE9 uuu‰ƋE!;Eu̍CEU@%|PWuVUE9tAG_]UP%Nj%=uOPWuVUE9uPWuVU萋E,]uA%EN]E+C ƋSt]eE]PE+C Dt ]8QWSVUEuUWVS\E؉UЋE U9EE}cM؃8M}؋EQ%=0wZ=we=EMEE9E|U9UEuEЉE܋E܍e[^_É=)ws=`u벉= =(uM9Mz]؉ȃ8S+EPuЍEPMOƒE҉EtBMЃ}-v=:=*}؋_;]';]UЊ< Ёf RW%_}ЋM9yGЁE R%}_5}9}ttދ]8q +ESPuЍEP?NƒE҉EtB$]MЃt&*3F8E7~<ډEuH Sƒpu#44MtEEvEMv]}%=ufEЋ}9Gu}ЋU9z. $AډPhjSE}؋G;EU؋Z;]v }Ѐ ;EEЊ@ЁE  R%}_;]wMЊӁ R%b_Y_t9]t1Ӂ Rq%_t3с R9% _GGEU<tE؉EԋUX9ۋu}M9MPSuuNU puu8uuuuMU EEE؃ uM؋U9J)11ۃ EEVEBPE Z$HEBB1xZ(/t=]Ӂ R%_GuWuuMU ED4gD4-D4 D4uPhjuE%UBFUBEԍe[^_EUWVS,] ;]EUU8EЉE[v=HEA %=H=(=Sv];]u]EQ%=Xv=xuu%Ɖu%=iu%Ɖu%=uEEFVuSPU܋E uuu‰ƋE;EuC}]O]܉] 9t!]ԉQWuVڋEu؋]RWuP=h=XEvFRuSPU܋El uuu‰ƋET;Eű}OPWCSVU܋E]5u܋];]E܍e[^_=0iEu+EPu܍EPO=¹t@MM/=p=xEFVuSPU܋E uuu‰ƋE;Eu̍CE؋U@%|QWuVU܋EQ9tAG_]؋UP%Nj%=uOQWuVU܋E9uRWuVU܋EuQA%E]E+C ƋStEP]E+C Dt QhjuMPWSVU܋ECu%Eu+EPu܍EP;¹Q@CShju뎐UWVSEH 8eU]u9Ete[^_ÐF u=d~GFFt Dž UM  u r9sI,ɉhN4dv8WG R%uJ_tA$t6с RX% _ vt; R% _ G < 9 (RpS4 (pSS$(m$9<Dž$ G@WGt DžxMu 1} y9v,hO4w8GE F9*v,hO4w8GSjS(à (pS@98DžxlA 9<| (tN9ɉދu x11| i| $t'~%SWS(N܃t>||S R%uJ|_tA t6с Rp%_v|t;| R/%|_G<9(RpSL (pS4S (Ã} 1ыE LDžvtB$8Ё R%_SWS(Ãl@$l r$lA1xlp(D4WtB GЁ R=%_ D4}SWS(ÃtA1xtp(t@tr$VD4X,,`D4D4,y,>t@BӁ R%_DžDž LVV(脼ƃD4 (B1Z((BDžZ$rCD46D4@1< uGD@v@@P(@<)pRPP(t@wPhjplo0 D~ L詒1&QhjpDž$n 0 (;p@v 7v0DD DF(;p@v̋rDu - AH~ D ~D j@S(`@9PCP(jS@(tt(4@))Ӊދ}O_w ; M30DADAD A F;(;p@vAAA ŋU 1эLD4}Dž,(.,(Džax@<;Fu1 u"@Duv@B@P(t̃0(;p@v 60DD DF(;p@v̋qDu - FH~ D~D j@S(I`@9JPCP(!jS@(tt(4@))ӉƉߋMqYy ";M30DADAD A F;(;p@vAAA šD4D4r9ʉs\h9s68u܋)ȋV<9|lj9ҋhu9Y9ʉsZh9s68u܋)ȋV<9|lj9ҋhu9d@Gu1`u!@Du@B@P(起t̃#0(;p@v 60DD DF(;p@v̋qDu -FH~ D[~Dj@S(}`@9PCP(袶jS@(tt(4@))ӉƉߋMqYy ;M30DADAD A F;(;p@vAAA šD4'@)pPRPJ¹t@+@K+h9d P0qE 1} ыU Lx P(p+PP¹t@1 (@@ Pn0 Le xD@G20xDd PS+h9d P豇DFH(@@ P肇0*zD@Dž$ P&DFHR@GQ@S(6DDž (@@ P蟆0 !zD9ʉsZh9s68u܋)ȋV<9|lj9ҋhu9F{Q@S(' P訅DFHDž P藅wQ@S(褴r+h9}QdAPhjpPhjp[뭋0ucDuK L݄W 0„G0u:Dt̃ P뾃 P藄맃 P艄돃 0 Pm;h;hU;hUWVS E"ЃU3B8e[^_ÐEP,1ۃ~ @(94ttC9EP41ۃ~@0949t}hC9E@$1ۃE~]UR U V׸!uMC9]~9M GDH Spw9sP8) j GH G@({B9B=|BE܅~Ã+*w9FC<v6?t1{/B9$B= /w9GE؋E9EO9`:|WBMG +EPGP+EUPUGEXZjv?{Ƌ;Gs 8,WSVU؉Tw9x:}YB9bx}u ,v Ã+vu؋G+E@PHVG+EغP$uG+E@Px)UUUE j(h7u؋G+E@PHG+E؉$P [^u؋G+E@PXG+E؉$`P@=wSVU؉w9 8w9Et{e[^_Ãu؋G+E@PxG+E؉$4G+EPU؉tjWJjSjG+EPU3G+EPe[^_Bh#9Ɖf UUWVSUƋ@EEEN19:^9B9s ;E5:B\)6.E*dJ‰QN9s*eB9s \$t1E9ʋFEY!E9EQe[^_Ð{ugXЋDH S8IXT BtH$@)F@D"v9ʉ):B)}ރ[(F@@FX@  ShN9s$B9s :\ j)\ FDH SpDN9FB9;:\2z)(B;EMF@t>  j(~M |ME F jjFH F@(FEE9Epe[^_Àz{ZNjN9s 8,5SWUN9aB9s :\n9IB9s :\BFD  BjFH F@$FENBuF+E@PHF+E$PJXZuF+E@PXF+E$`NI .z}* NP9ʉs@=w u 9lj v 돀z) z}vUWVSQUBƸ11ҋ%=`=%=pt\w=0tw1=t=(uLB@=t9w'=xtD=u29~듐=Xt-=h=t =u kZ[^_É=tv4%=`t=t=u%=`t=uă뗍v9~׋UZ[^_ÉUWVSLE$t  "1} эq jL#dú UD@ EPcEE } 7|]xEE1DD@ ~C C KC C$C(C,C0C4C8C<C@CDxjEHCU|9xrxxux|9xrڃ jxqUBC^_SRubCEX=~5|׉2DžDžC0= ==9K<}%K<S0DžDž%=XZ=xP=ht1=`^9S<S<C0YUB;E rQ+u tK CHEC@UBZ eC e[^_É <7%=`t=t=uF%=`=u9S<|kK EK<~-C8C4}11DžK=Pt(%=HuF;~N=0[=(n9C<C<C0v== ub+}+ x}{AxxMK<oC0UC<C0Mp jxlr=2=p-l==H䋕S0CPPhP<9K<K<@S0 hr]DC4S4C<A~s<1)C, 8S4FGs<9UC< P\C< P\C8DžK<& +S8HAK<;؉OΉp94~9S,28:t(+{8A9~Љ4K<9N륋C0Q AP\C,PhjP荪KuPPCх ~GGVS s~U hjjhhhuJ~ u tu |É|ۋU҉帨uÐUWUWU1EEDž|hIQR|P}WjEP< x%uuu|u PW|}ÐUWVSMɋE EODžd}lj+EPuRu?E8/t)Ɖ1э|19vFO9rEe[^_Ív GDž`hNwX-\Xp.XEBPhE9XUElhZDžtURX@XUE9lx|1p;\rE`㉝`SXˊXJÉp\9sp.@.@ pXEUR0Wp/@p|19Uv u腛Ex.ux tۋ@%=.tQUB@PЃpPWXZEPXV̮뀋x9h uEu蜮u葮ۉ‰udҋEt uY XKG1e[^_Ív|9Ux9E7 DždhAKEU1} u-KN@98d+UѥdTdup)EdTPS)PVÉVEtP+Mu9sN/EPRP)VEPU[upEDžt9hN/)PWuVU[XJ諬1[虬"1I臬"tQBUWS]tH1 эAQItKSP~1e[_áuؐ PSI UWVSu }Mt2A:u8t,u@t:t.9uA9@t[^_1[^_Ð1ۄt@A8tĄt:u[^_ÉUVSu t4>Mt,t+BA8tItv<:t A<|tۊu[^Ê<|t<:tu[1^ÍvUu%1Ív PS1UWVS j=u uà ۸ jdG_Ed:tItE^td\twCAMu)FdPW %Ed: 0uvA)}XE8؍e[^_C<:tՄtDž։9svB F;r΋)SP)Z409rvPhRu oSB Nv;v ~\F<#uRCZYEt1G?:u_GPu_uuPZY PB&5PvpDžDžj=hYP Êt C<:uCJ؃ )ȉjE@PRu t!@tC<:u+)lj{:t:G+)9ȉx) ))‰|xSP)~O|40xP+PSL WL_@CGNU')эA9Ҹu1e[^_1Ʌ^1= ?e[^_ËE DžR u e[^_à u 2ODžCC:Dž#0hhS$jjjS Pjj2NE Dž u Nt u jN >uA u` >QR{ v u M u M됃 >뎃 >XuDž1IjRQR t(H8uI@H뱃 Sx=Dž R @S>=81Ӊ$< SPNjXQ{x0;0s S<DžF V<vUWVS} u= 5tP5:DЁ RHq%@1|3\xjÍ؊t:\t @FuP5K~=D뱐D4%@^:Q#D 61|3\X5$X  5BZ-hrJe[^_à PÃtnh0멡$X  5nto\:F|t:t @Au jjRjWEÍ@ vCe[^_1C PsÃ1Л'vUVSu] ] u[^jUjjujEu UÐUVSuU} ЋAu")čD$Ãt;E VC AuP50SuEe[^ UVSuU} ЋAu")čD$Ãt7E VC AuV2SuQEe[^聚 U 50u u!EÉUWVSj/uDž|xE81} у)̍D$eu Pkh,S:1}DžѾyD>=WjhjF VjF jhjqFh,S`n| e[^_Ð11q}эyD>=PSVSrA W\3SƄ5/uYAEƄ8Q50ux4Ch?w,$$ExDž@ /00PxI@8 Dž| U1: @UuB&)čD$ÃGxCPRCPEP`@ 50ShGLBz{ jk0^Uh#耵tRu PuÉRu PuUVSuU} ЋAu")čD$Ãt7E VC AuSuYe[^豖 UEPj #ÐU҉u@ ÍvU hj:j:hhhuBbUWVS E8ete[^_ËX t;EuCu}C tRK117C t0Q3ZC t(D3XC t G63@9{˃ s 3C,uAC4u'C8uA]e[^_2 P2r -P2ƃ P2뱃 P2뱐UWVS,tu uthu}51PfX؉ZfDŽ)/uPfY_hIPDŽ /LC_DŽ CTYPfDŽ EAp PAs S˃˃ȉ(!A,A(ރ|-!1!9!@!D!޿I!8»O 0t h1e[^_É 밃 _=t+-! 5/u hc Jҳؑ̑OuL SH  a p0뫃 L .  sUWVSE]DžlP $nCP81҅-E=7 2 P .1҅D裐 S4菐#SjuDHDEDE8 Q!|DD4 ȉ4 D( ʉ( D, ɉX, D0 ˉ0 1DD(ȉD((ȉ((ȉ(F~Nj||xR4}9||tI| u9||[ ]9ىp|1x SʋCȅ SCuB)ʉh|B<lЋU9׉|ah ȉJFD 9( , X1X~.tȉBȉBBȉBFD 9, ؋D0 1~0pȉBȉBBȉBDF0 9֋D4 |:;EfD, ( ȋl T P$+EgE}T RuneGMagiL DǃE@0D4 MP ( 4 , T< 0 }D 1DD(}D4(4(4F~ʋL d8 d@ TЉH ЉL pI1|dDžPDžLHPx ;HT;PD;HC)ʉC\|`|ً]L HG ЉL \!Ld`D KFLHP U94 ;< T]1T@ ~211ɋt;D;DD;DFE 9< ҋMD 1H ~211ɋp;D;DD;DFE 9D WUP |L Gw^Do(MP u ǁL ]4 u ǃ8 u< u dž@ }D u LJH Ue[^_à V'荊O1ҍe[^_SZ D'Z D'E1҉뺋H@ AUE܇1ÐUU1tuÍvUWVS }uU ]۹t)t1 t [^_É Bv w*vztH t [^_Ét [^ȉ_ú1^V [^_OvUWVS Eɋ]} u?۸t.FVv CJ [^_l搐UVSEu] MUtEUM] u[ ^ EUM] u[ ^UWVS E Eu}EtFOt0uVSutXtZt`)EEOuЋU Ee[^_Í}vt)EuVSWtЅuNjU Í3U 붋E 뫐UEЊ̋1ÐUU1tuÍvUWVS UuM }tnt(u1Ё~ABtZt1҅ƒ [^_ÍvtZ ÅtE [^_É1덉vBt Åt7V%lU]UEMU u(ɸt fx ÉQ…ɸÐUEpT1ÐUU1tuÍvUWVS }M u)9w_9vVSQD:PLqE؃Ot(Wv0t,vAvZB~vRBЃ w[ уW}w; уvnWBЃ w% EVv EB耂VJE$9USPE]M ۸t_tS}w}ЍBC wjՍC}wYэBC wKY[u8tGՍ}w%C?~tt Y[É_VY[à Y[;ڐUWVS EL ҸOӍv< t< uC j$AE1vQjEPSPU9tv҉tp;E~E< t< uCvRjEPSPDE9t=t7v< t< uCvG~PjEPSQPF E9tu VOe[^_ËEL ǀP $E죠$e[^1_ۺ u둍vUU1tRuÉUWVS EPҋ] }xo;gHx`[tZ҉]u[ ыL 1E4wNO C C$ [^_ÉME֋UBt| CB9v9r9L B !uE LtU E@1t+Ey21@!i~VEEE])։XpU]SsUWVS E@]} ۸tX L P !!9Pt9Pt?9Ptk9PtTL xWv ȀCJ [^_Ë8 CJًx CW΀xL}뭐UE̔1ÐUU1tuÍvUWVS UuM }tnt(u1Ё^ABtZt1҅ƒ [^_ÍvtZ ÅtE [^_É1덉vBt Åt|V |lU]UEMU u(ɸt fx ÉQ{ɸÐUVSEu] MUtEUM] u[ ^EUM] u[ ^UWVSE 0E}DžTEtLOtFE9sOSu6u]T)]uvU 2Te[^_ÐQhuhPf u6XRt[;ERPXPufxPu6XRtt,TOubE 0YE TDAU 22PhhRuf UEdHh1ÐUU1tRuÉUWVS EPu Z}tu#€uutE1 [^_ËUZuq%=%=&%=$%==EE@EUߋ %uj? FCE9v9r9;M|F]tEUB [^1_øE!F|xV [^_þEEE뵰E 륰E땰Ew뎋E)߉xUPMvUWVS E 8E]uEtLtHE@~>?~9&wVe[^_Ív~"U)EENtE䡄pUP xT,@TTu9Cv9C  ]t ue[^_É%EfS ECEHy}eEMeDEc 4fK EADfK ҡLf7f;Kto‹9uC +DLs99p suC;ESPCBPuhVD\fS D+PjWV*e>E䡄)PWhV[9s t5;Et%3urXa{sSMK S;HE@ C QSXn! j[ ;CC  SP C S +D;HLC;HvBHhx"e[^_e[^_"!ܸ!ո!΋t%t{9ysȅt t9xr !둸!느UWVSÁT1Et(J9s tJ9rz)ىBJ  +5DLLA9r54u"Utu'Ee[^_ QShWYɋEe[^_Ë ɋztBABUS jg %E U41;us҉(` V 1҅u߉ +DPH9Љ H5sUUWjjjh%j EPj 1҃Eu P5LmEUPLLuP U-UWVSǡhP19s(xttPWjS-Xe[^_ÉL9s΁wHEEuEuU܉ыZt1ۺCt1ЉUfB HffB u2EL4u+M܋E܍\ˀH 4:M܋A؉냸EMEU9Ћ]MfCufs MfC fCu1҉sED E)ЃwщЃ tB;U|9]m 5D)uLULMLLiE>Eb1R@PhU܋BPV[4E1҅rMufC fEfKfM܉уЉ!LE)EufMfMBыUfSfMfK UWVS5$ljUE"E<5@<uY!;$#,tEh +D "P;Hx"?LssF%tC ӭttttD;lu9uw;E1(Et'Ett;]PSWVTyvh"hc!5P"$CvFT|xt 4PjjjhjhjL @1 j/ DPu  {f|t@ut |ɻM}M]Ej PZ$< h +Zv h ZE<vH{ $fXe[^1_Rj?]Sh!RDt1ۋ | $<=ptEu ؍e[^_ø %Ette %C-CCxCpCtC|yCliC4YC8IC09Cx)CpCt C|ClC4C8C0!11Ej h W "< j h"ÃEEEEj PW?f1!Y"p<l*8u8t l]9]T;EE4uP+]ShMP Ov."!Ew!Su4tP+]ShU-vUU1EL"vUE1EZ"vUEU Ef"D$9v D$̀rD$ZUu ujuuuu ujh[VÐL$tD$̀r  PaYUVSƋ]t6CB 3ZsXs$Npe[^ÉCFlUWVSEplEP1&#tE9F~vue[^_à ^VEgˍvUU$t,~/$t &tQRh+$h~&Ív'ڍvUWVS,EX`ۉuMAl1\P9}щNj@uBGEo j- u1 uG uGte jHGUЉW E܉G Rwu# uwuUBlGBpzlUBp j 7v WjFUSR=t1҉Ћ]Ívhh> tUSP$uE $ɉu-؋]É hEt $ɉtӃ h؃]ÐUWVS<}E8u U :MEUM$vEPuuwM MU}ȹUUċB`1HVSEPhdEPhdjr` tUh$Ep` E뀸e[^_Ë $u hucZtJEPhd裪$u렃 hF댃 hEԋU @P M U2PujMME̋U@$M U2Pu5MMCvUWVSLE E8E} U :uM9E UM$E$URuMMMMċU }ȹUUUUB`1HVSEPhdEPh jr` tnh$Ep` Emme[^_à hJJ $u҃ hTu*Zt8EPhdj$u닃 h tEԋU @PM U2PuCMME̋U$@$M  U$2PuM M$UUWVS $u:1tSZw h} h눃 h봐UWVSEE8} E 85$FvEPuEEE EEEUB`1H5WVEPhEPhdj r` tah$Ep` Eme[^_Ë$u hЋ $u뿃 huuKZuU܋EEPh胤$um h#V hUWVS}E8u E 8$vEPuAuEEE EEEUB`1H5WVEPhEPhdj r` tZh%Ep`vEze[^_Ë $u h uZtJEPh$u렃 h댃 h~ uU롐UWVSEt8u e[^_Ë$tr h']5UEEB`1HWVEPh8EPhj r` tch%Ep`0EEURPyt $u e[^_à huZuUE $u ؍e[^_à hyUEw $d'vRPh.%h  øC%øT%øp&øe%ø}%ø%ø%ø&ø&ø&ø%ø%ø'ø4'ø%ø&ø'ÐUSP$]uW=t>tZtJ $u1]Ð hw1Eu봉 h#뗉v$u ]à h!䐐UU hBPRu赥UWVS1}ȃ,EPu Eȅ]̃E؃ @P uPu܉E0E@$f uPuԉEY_EPhL芟XZ5uSuVjǃE V*$"7e[^_ÃEPhL-E ׃EPhLE e[^1_ÃtEPhLE 떐UtÍv hsÐUU)w+ÍvUWVS,}.M A1E؉]ԋWPWRu hhufd u>FRPuu$S1эA)ƋE؃w$+])빍v uuh)VSc EƀEԍe[^_Ív uuh*΋E1w<`+Ph)VSct)ƅteWhMVSc뙐 uPh*h*jWh*h+h5jXh*h+ҟuh*UVuS] t)tCSV[ PhV85xe[^h*hh*h+oh5hh*h+QU u$hV85x/ÐUWVS u1tYVhhSjbuFVwV}NZY0p$ScN ttKƃ؍e[^_É)QVh*SG P$NZp_^_PS붐QVh*SG PM_Zp^h5hh*h+*USP]t" S PhV85x]h5h+h*h+ٝUWVS<}t ?PhWPQBY0虾;1IK+C$ )5x & CPVx@P xf` $uAe[^_Ð1IDžK9Dž0 5x(e[^_Ív 5x"'LUVS]ۋut%E >vB:u@t BKu[^ÐUu ukÉUu uKÉU j@u uaU j@u uAU j@u u!UhE PPu聞UhE PPuYUVS] SuV;1҅u e[^ÐCPV;1҅tCPV1҅tʃC PV/1҃뱍vUVS] SuV1҅u e[^ÐCPV1҅tCPV1҃ǐUVS] uSVs1҅u e[^ÐCPVs1҅e[^UVS] SuV1҅u e[^ÐCPV1҅tCPV1҅tʃCPV1҃뱍vUVS] uSV{1҅u e[^ÐCPV#1҅e[^UVS] SuV31҅u e[^ÐCPV1҅tC PV1҃ǐUVS] uSV1҅u e[^ÐCPV;1҅e[^UVS] uSV1҅u e[^ÐCPV迖1҅e[^UVS] uSVS1҅t t$Ht e[^ÃCPV1҅tᐍe[^ÉUVS] uSV?1҅u e[^ÐCPV1҅e[^UVS] uSV 1҅u e[^ÐhjCPVi1҅e[^UVS] uSV_1҅u e[^ÐhjCPVWi1҅e[^Uu u蓙ÉUVS] uSV?1҅u e[^ÐCPV1҅e[^Uu u+ÉUVSu] RjSV1҅u e[^ÐPjCPV1҅e[^UVS] SuV1҅t tt&e[^ÃCPVx1҅tڃCPVGUVS] SuV#1҅u e[^ÐCPV#1҅tC PV1҃ǐUu u ÉUu uÉUVS] SuV1҅tt'wHt?1ҍe[^ÍvuCPV CPV1҅tʺÃCPVJUVS] SuVS1҅tt'wHt?1ҍe[^ÍvuCPV CPVG1҅tʺÃCPVUVSLE E؍EP]ZYShEuuMPEPVStxUe[^UWVS,ÉUEE E̡$* u1E}_f{ua=$u)( PuuSg"ffC5$]EEju虯 uuuuԍEPuu tr} uA$u e[^_É h![ h!Gv h!v} uϭ$u 1e[^_à h!1䐃 u6Ẽ@tcE h!vQ@jjSPE̋U  u1cBaA A6C2USh)u$u uuEU à 1tPESPjSR؋]ÐUh`"h`"uuuuu uÍvUWVS}u]MEr&M]EU }u [^_Us$vUWVS8} WÉUE.td1}عEPSE*XZhSUXuujVS%VtNG4f@fGe[^_à P5Eu V襫 Wh0,j蝯1EЅt Sm1QWh ,ՐUMEU ME r&UMEU ME )U/=vUh)Eh`"`"ÐU vU1W}E@f@o@_1ÉUh)u$u uuuuu uÉU h)uuuuu uUWVS EEE0)] t e[^1_tCE EEe[^_ 5ƒ֍vUSP]$t3 h)hhu uuuuu u3]Ðu7$uEh8hH$t h!S5| h!u렉UWVSUҋ} ut$PjjjhSPRr tVjWugLe[^_ÍvVSWuQLe[^_ÐUWVS ]E;u(= =2CEe[^_Ð j tŃ jjFtVEx^^Fjuuuu VM1E v4$Ee[^_à V~JWjjjUKM1}I ыMxQRSPvS< <1CUX PGUWVSDž\`v `R;C t޿$, uͅ S0dVjjjxP jhuzVƅyg1IxQjjxRd> jjDžhjDžljptXRjjxRP{thdxA uu hPSdq \ `\e[^_à pVѐU7UWVSSVuu u,sCCC:e[^_Ëu>$hh϶$t h!^v 5芶Ã3-I$9C;E 9C /E9C#uCPH VP-EEPCPEPjsRC PEPjsRE C EC1ы}IwщIEEC@uuu$u uuus pe[^_É BRP h!蹵eKuCPMZYVP>WWjju; h4zt/tC]P5苶 C~UWVS<$5^7GEjEċE jEȍF0PSEEYXEPS` CSPF`C@2jh`"v,S$t(udG$uue[^_Ív Td\t h!G$t h!߳vv h!藳jdjPtqtOF,5 h!S$ SЃ h1|jh`"똡$u1 h!1vUWVS\Es$HS0ULFjVPC0 Fs`uVP U UUFRVPUP VPRuVU FVP$+)Y_FjVP@EġDEȡHE̋UEEԉUXZ}WV6EPWEEUP WPR Ee[^_Íe[^_à h!]$ h!sC0Eh*hh1h1SW V e[^_ÉP LFF  $f h!]fF>SWUVEPS< uuF(& h!kvh43hh\3h2gS* h|3d h3d4$T1UWVSu\ uU Ã1DžddWPhWVB>hC0C,hPj`‰C4hQPWRx dDždPWVEhCUWVS,uE FPhvPRWDž6Zyl8tz8tp8*PhhS jjSPRWDž6x pYXjF@RWPF늉U单x Hu ERxFUWVS E ~\Nju0$ufʸ!u6t%fFftO uà 6}uލve[^_à h!W܉ h![$UEU tHt1Ë1~ÉɸÐUVS] SuV<1҅u e[^ÐCPV;1҅tQjCPV@1҅tRjC PV@1҅tPjCPV@1҃뛐UWVS }?] E1;EEPW=tTEt`t@Eh0jSW t,t1EE]1;EEPW=ue[^_Ðze[^_ÐUCvUVSPj] SuV?1҅u e[^ÐPjCPV?1҅tCPV:1҅tPjC PV?1҅tPjCPV?1҃뛐UWVS }?] E1;EEPW<tTEt`t@Eh`1jSW t,t1EE]1;EEPWD<ue[^_Ðze[^_ÐUWVS]Cj Su PʋȉFȉFȉA CSPY_~ WSE81҅u e[^_Ð CSPEXZvSV1҅tփ CSPE+EF ^XCuSPZYWS71҅tCuSP둃VS81҅zFPS81҅`FPS81҅FUVSu] PjSV=u e[1^ÍvCPV 7tCE uK e[^UVS] uSV+81҅u e[^Ð3CPCPV;e[‰^ÐUWVS }u V E(N,ʃ(GRWPڃȉڋFȉEFڋFȉE~ڃF ȉڃFȉڋFȉFEڋFȉUBȉMAN$MڃF$ȉڋAȉAE!Ht)VW6EEe[^_ÉGj WPt‹ȉȅFEuȃFEuȉF ȉFȉFFEȉFCUȅBts=E^Ru#PjeMAE4MAWPWRPUrSrN$MGjWPȉF$UCȉBMA=EYu&Pj賤UBEBWPWRREpSpRFPW7(FFPW4~F PW4FPWr4FPWZ4FPWF$E }e[^_h5jAh5h54h5jBh5h54VPqSWPqS:UBÃPEppW6EuWe6F,PW2QMqqW96EwUWVSL}EE0EfGoP5555jhWġ þt_E EȋEE̋EEЋEE؋EE܋E0EE$EE EċSu,u(EPhT;EPh:jSƋCSPfGe[^_h)6j`h`6h5)3?h:6j_h`6h5 3vUWVS ]ۋu VS[1u 1ҍe[^_ÃFPS;1tFPS'1t̃ CSPY_~ WSE11҅t CSPEXZvSV1҅t CSPE+EF ^XCuSPZYWS01҅XCuSPAvh5hh`6h 61hG6hh`6h 61UVSu] tOtihkjEEPVu 1e[^ÃCPV0tEsVS h5hh`6h6N1hS6hh`6h601vUVSu] t]ttSV/u e[1^ÍvCPVo/tCPV[/t̍C E ue[^@/h5j=h6h60h6j>h6h60nUWVS,U]t1t e[^_Ð )tr&Pǃ1tԃ PPh6j ]SSWt)PWu u4$r<$Je[^_à WJ1mUWVSh)} E1tPSWuYE$bJ hr&tQPWu*Ɖ$4J1uUte[^_ÐUEtPEPjjuEP} uUҰuUE EU1ÐUWVS E ۋ}utSWU?t.e[^_Ët4tSWU?uӐ SpE 뻃Vj2ÃE ۉtPVjS끃 h6 ?1UVS] 1;EEuPV/1҅tMue[^uuSVe[‰^U1ÐUWVS } ]GC GCG CS@BDs C@LtJ~~tU $890tl@u$u4e[^_Ív} ]e[^_j} ]e[^_` h!Gu뺅u} ]e[^_$WSP$҉u1؍e[^_É} ]e[^_ h!t@ h!tUSP]vV$uR89tkRuj j5tyE B8B$ۉ8u1]à h!&t뜃 h!Dt1ա$u ]à h!t$u ]à h!sUWVS <fDžE@U ZȃtHe[^_Ë3΁w䋅GPVwSxG0FËGG CGM Y(EȃE̋CEЋ>fRf?fn)¡<EȋỦE؉U܋ AEEЃ E䍅PjjuVDžDž H=E؉ȉEȉMɉJE9Љh6hj袘 hjP<腺XZhj1ң@v@fPB?~Bvjj}W<t)ЋtD ?B')Ћt;xPh6h7qfSwte1VэPph*7 vh<7h7qhI7狵v<?ÉtDžddd?9uA9CuҋSt19ɉ֋uC9H1ffDhV7h77p;JijPnu+9Љt]|ihj7h7oh|7h7orL@@~;9}jjBȉE؋ȉE܍EP}HE؋U܉ỦEȋU EȋZ(ẼEЃMA@Du QF(BHA+^(XL<)4VF@fff9f@fXf XCf;u狍AyFQ1׹Qj\Fpv"QVF~ tf@1FBVAQ F A1h7h7m Pg)h6h7mVC9Ddh7뙐UWVS EP?}wm)Ѝ4<\fSft^1ft2U CUCUCDSJye[^_Ãh7h7l1e[^_à WEPEPEPUr} uAh7h7l1fC뺃j&jzÃ<\fC5h7h7SlEfU EfCUEfCUU fDSJy#UWVS$hh7Yuƃ1RVhPuw<#t<+hPʲ[h7P訲8tڃuSoWu '4$˶e[^_É Pms2DžPP}1IQuh7o u 苘4$/XcSPh7h 85xsRVhPVt V̵e[^1_ÍPh7h 8먍vUVSu 1҅tHhSu1҅t-j:S1҅tQj0SVȇF0ve[^ÍvU PɋUE tE UtUSP]tu]]b]Ív BRP]]bvUWVS<h`Mt/Uq9B+ PPR^91DžPh@J S=tL q $,uЋx, SG=uu2t(hPK! S911oBp Ajjjqh" DžDžQPPj1R PPj1R[e[^_ádu<$h@Lhde5$t h!Bf 5dqen9BBnA P PR$jjph  "PRPj 0RvPhP\i h!e=dRjjk j _1rtW`o BRP1e[^_Ë S[61ރ5de뜃 BRP1UWVS ÉUtuCv tt uvz1t'1BWVuu uuSR e[^_Ív \tuRfl$\MPQ@Ae[^_ÐXPuP#l$X뻡T,jPl$TPMQ랍vUEPhhu0g tEuUME H1҉UE Phgu ist }҃JÐU uh`jj9ÍvUS(E] ESEEPhhEPUtgtE؅u UE܉S1҉Ћ]ÉUS(E] ESEEPhhEPUtgtE؅u UE܉S1҉Ћ]ÉUS8EE؋E P]E܉USEEPhhEPUg'tEȅu UЋẺS1҉Ћ]US8EE؋E P]E܉USEEPhhEPUgtEȅu UЋẺS1҉Ћ]UWStjhj]S臩 Shxijj et Etve[1_Ív}t} e[_ÉUE Phgu0g t}҉ÐUWVS ]׉u Uuu wm1BABABABABABABABht5QRSWЃt1҃e[^_Ðe[^_ÐPRSWWƐUMȃ$xt$th!Pc<$ͅ$8<zDž DžDžPDžT04HjP{Bx PFBDžu E4džBRP[_@ȉE DPDPRUP PRuU BRP j6謌 ;48u<=@EġDEȡHE̋EEԍUU؋0P(v9t4)щ+T((҉W G $RjxP DžF@[jW(@,(+H+LP(P89ډT09c'=?BB-@BыS4?BA04<94ً<)щ+T(|A((@Bm1GDž(_@vjjj6HA y^8tT8#kt9NjS]S諉XZ}WS補EgEЅ\džzuC~9UP WPR t";<džx P{Adž$A $RjhPj8$e[^_Ð49T~B@BPCVF P h!7E U$ h!6w8i409 P5e[^_à h!{6 h!66PFP6<x8dž^Edž<謒dž8PW蚛dždžU]ċP SPRudždžEȅSPwUEPM AAUWVS8E]ȋpSHl EPSjY6$uzvt& $th!P3͐uWU á$u[PjEPj5=$ue[^_à h!@4t Pd3e[^_à h!:4듐UÍvU‹@1=wB|=@B~ÍvUWVS8E]ȋ} pSk EPSj&5$ust%th!P2$͐$u8tH M$: h!3멃 h!;3uF$$PjURjF4$u e[^_Ë P1F$u%=$SjMQ뒃 h!R2ɋ$ $uRjEPj3$u 1e[^_Ë P/11݃ h!1$ h!1 h!1l h!1? h!1EeMQDMȉ0MHȉ@UȉMȉB@ ԋMȉB EP$$PjURjU~EvMQUMFAA8M(MQRFPuyʋU h!/- h!/WRMqFPxUBUWVS8Ep]ȋ>Sf URSj0$9tC t1 $th!Pi.uщFx P8Pul V)UB t 8UBt 8 u($uPPjEPj/5$ue[^_à P҃냡 P-e[^_à h!\.랃 W7! h! . P4(= P#(?UWVSu F^ ~DžT)DžPDžXDžd^d~f?uc `P\PPTuDž``3 xH jXPPTus3 xRdVul3f?t ڍe[^_Ð跉ۋ8h9tPdPVuF5y膉8빉DžTDžPDžXDžddSPhVuDžd4@\QdjViup.) j\PPTuT2 9UUVuS] SVgu 1ҍe[^ÐPhCPVt݃CPV$tɃC PVthjjjCPCPVo u덐h5j@hp:h\:RUhI6jAhp:h\:4?U1ÐUW}fDžfDž1hX0jlIP DžDž(Dž<DžXDž\Dž`DždDžhs EPu P}ÐUhhP)ÐUVSá$u1ҍe[^Ív)uhȊhm*uЃ 5P6)1҅ujjP tP5P*u끃 3#gvUhhT(ÐU$VSu1ҍe[^É(uhh)uу 5Tj(1҅ujjO tP5T.*u낃 3"hvUh̙hX(ÐU $VSu1ҍe[^É(uh`h(uу 5X'1҅uh jN tP5X_)u| 3"bUhh\?'ÐUV5$Su1ҍe[^ÉC'uh0hH(uу 5\&1҅ujHjN tP5\(u낃 3O!hvUjh@;h:hAjh`;jÍvUuh@;h:hAjh;jpÐUh@;h:hAjh;jGÐUWRE}1 E@@ @@@@@ __ÐUVS] ؋uEEPuuSuh@;h:hAjh <V01HtUe[^ÍvUVS] ؋u3EEPuuSuh@;h:hAjh`<V?01HtUe[^ÍvUVS]؋u EEPuu Sh@;h:hAjh<V01HtUe[^ÉUWVS ɉlj EP55h`V׉ËE u"tu e[^_脁E萃 5=wW PtREu"n또 hs1҅tA"1WU;vUvUS] MUEEUM ][mUUvUUvU1ҸUVSU,u! jjjjh:|s u#v jjjjh:[sà 1t5jEPEPSE:ES tBw؍e[^ËEBvVRhD=j$S1ۃʍvUSP]t,u]] PP]]]ÍvUVSE] qu tt*ve[^ËE0E@u&EpًEtЃ PPE뻋]C UWVSl} UEEw0tTEu Eċ~te[^_ÐuE2-UB(πB(EtыEʉЋEE1ЋEЋEЋU@EESUuW]ċ3 Et ]ċ[]EȉE>]čMS E ЈEȋUjRQ3P  Eċ@ uuWuu E@]ă{ CEɍMEgЋEE3 PPEăj+렍C |U#E@]ċC]ă{ ~ EKUUCE;EvE"CRPuuhEċ@ uuuuƃ QjuEPt>w@M]ĉECELvUWVS u] 9ދ}sY:tB9r ɸu:t0OtFB9s :t B9r u#BB9sE;D@e[^_Ê뱍e[^_ÃVu0de[^_ÉUWVSQUM u9ʉs :tB9rEEZ[^_É9sB9ʉVs:t B9s؀:u9sBZ9EwNjڍ[9ˉFEwF C9Ew‰Fs:t B9s:u9xB9ʉVl:t B9r[9SB9ʉVG:t B9r890B9ʉV $:t B9r9 BB9E:@9F(^~$EUWVS u] 9ދ}s[:tB9r ɸu<t2OtHB9s :t B9r u%BB9s9ED@e[^_Ê믍e[^_ÃVu6be[^_UEVU S9Ћ]s 8t@9r[^Ív9s@9ЉCs8t @9s܀8u9s@H9ѾwˋȉCȃ9wȉC ȃ9w9щCKs9t v@9s8u9s@9ЉCt8t @9rc9[@9ЉCO8t @9r@98@9ЉC ,8t @9r9@H9Ѿ ȉC$ȃ9fȉC(UvUEu EÉUS]W]]HUEzt ÍvEǀE EǀɸÉUWpXwXwXw  1}ÐUWS׋҉u jjhXjj]j ‰tB1IM]EEEjPEPRR1@t e[_ve[_UWS1t,jEPэEIPRM]R e[_ÐUWVS< }E|]U Hyf)u$u uuuh<h:h:MQEP0upEMP1|EtKv u$u uuh<h:h:EPEP0te[^‰_Ðu$u uuuh<h:h:URHe[^_ËEx@(DžpMEPt1pMQt1pEPt1pMQt1pEP t1p pttMpcEMQ2EEPEMQEEPEUB tEEuM <KU2S)SPV59؍tEUr)QSPV59؍tEUr)RSPV59؍txQ(@AUrS)SPV`59؉pCpxtP(_xAmUr)QSPV59؉ppxtP(%xA +Ur )RSPV49xQ(txAMAtxB MA t||t2e[^_1щpME9Hu t2"U$"LEM1u @Z뤋Eu)RWPV3}u)QPRV3t0Lu)SPRVp3t0uP)PRVT3t0uP)PRV83t0tEP+tPRt 3ttsMA/EiMAEEE@EE@E@ hp=jy USP]tXuCu+C]] v PPCt؍v PPCb]]N ]ÍvUWVSL = }E] 0u ttie[^_ËE0E@uwEpU Hyjh=h:h:EPj9 e[^_ËEu7U Hyjh=h:벋]C w PPEUWVSl} UEEEaw;} Mu EċKSe[^_Ív} uɉЋEЋEЋU@EEMu} ]ċT} C]ċKMCDHPEȉEUċB!}rCEGC EȋUjRW3P M+-t}EċPUċB@B]ă{ ~CzvUtEUEMQ(πQ(׉ЋEAt@/UăAt Eċ@ uuu uu >E;ESPuuXEċ@ uuuu ЋE PPEă:}]$UEăxDEVPWS u fE@D뽍C ^] APPUPRMQEP~ tEt8tۋUă, ]ċC){E,:uuuuuRujEċU ƃ uuuuus@ujU `ƃEp@DE@@Eă@DjUE@A(@ AP]C@EċH@ @DE;ERPuuwVEċ@ uuuuƃ Nt]]ă}EP(t@Ct MA C @u S(] Ep +C MQ(S(uuuuuuuu U E@DqE@Dhp=jmM E| EpCtrMQ($ EpgCtOMQ( APvEă@DlE"M"hp=jE UWVS ]E 9Ë}st::tB9r :uRtHOtSB9s ::tB9r :u*Pj EBPR+‹E8:u ;Ute[^_Ê 1}щI)9u9u8U 1}Puu}I@ÍvUWVSu UEDžx!ЋEЋEЋ|@tEtuN];tSEuotgPh;j@EP蟅@tie[^_ÍvhSQ0E]ttgPh;j@}W0@҃uEEEPEP}1IQuEPu &rE;|RPuuREU_u3[xuVuu9 w."x**Ee[^_ËUu{EPEPPPEPRǃ ! uxYEiEǀzf,vEǂPEPUPPQS}WRCSe uh;}wE)|U|TOElpEPEP1߹IQSh;u jEu)QRj:PBGC9>)PVj:S_B');lH uuUUE@}GUB(π B(Et}ЋE tuuuu^ǃ exh|u賁;|t"ЋxePEPURSeEW|uu$늿nbEǀPVSprNpUWVS<u 1ۃUDžDžDž\eЋЋЋ@ P PtAjP9 V81IQ3 S01ۃVVxqP@h-;hRc=wMP3";"TvtSiuJ(0EtEe[^_h8NSXj1ۉǃ P荄mЋЋl_"t"N_8@_АU1҉t3REPE P EÉUVS5&v 6sXs $u١uh5Cu5C uB StZC6t׃ PCt˃ PC t P밃 P}뀉e[^ÍvUWVSL sWFFuމ5u h uՐPP1IQh=5  LeW5hP =4<+uU h[hR?{<+t<#< t>< t:< t< t< tt C< uv)< t< CvC< t< t뿃 5u1Å۸t[suOS Ct8:t3:(t8h=QFu1e[^_à jǹ1󫋕ZYhjaQnFDžh9PGF4< < h=V )~* XS DSPVql B@< t<,t< tvFVm<  j@F$n AVPWB01уqDž<\Dž~w GPɉ~"RPNXPVPS*:P5hQ'ty1эqD3< #ND3<\DžNDžD1эAJ r"ApUWSp];=t5S@OELPh=4ŰEȉ uLhh=/£u(Ltx=tGe[_PEPhR6X5}+Lu|t/t PF==e[_1 Q^ZYSP(묃 PFRV8LVUWVSLMtE8u 1ҍe[^_à uLtE E…1Ш uvWVS &U ttPu >uɐEttPu>uEttPu[>ue[^_à h1҅E Dž=E Dž3GPh=hVsP1ۍPعIQV %}I R1'%@t FӁwݡD4%@u9= P&%@u#F,tt=wՋD4%@tPuu+;,t=v] P\&%@tF׃?@9F1ۃ tҺD4멋EthPh=,ucE tQPh=hVq h=Hj됋맋M1҅#nEbDž=BUh8h !?ÐUVSá$u1ҍe[^ÍvCuh0huЃ 5 !1҅ujj tP5 !u끃 3OgvUhh!sÐU$VSu1ҍe[^Éwuhh9uу 5!1҅ujjK tP5!u낃 3hvUh,h!ÐU $VSu1ҍe[^Éuhh muу 5!61҅uh j| tP5!u| 3bUhh!ÐUV5$Su 1ҍe[^Éuhh!uу 5!f1҅ujj tP5!*u낃 3hvUjh`>h=hoh>j1ÉUuh`>h=hoh>jÐUh`>h=hoh?j۸ÐUEUERuu uh`>h=hoh@?P蛸01HtUUEUERuuu uh`>h=hoh?PL01HtUÐUEUERuuu uh`>h>hoh?P01HtUÐUWVS ǡ,! EP50!5,!h!V׉ËE u"tu e[^_ME 5,!0!=wW P0!,!tREu"m뗐 h1҅,!t0!@,!M"1VU_vUvUS] MUEEUM ][UUvUUvU1ҸUSP]tu]]]Ív P;]]USPE] u tt7]Ë]Eҋu=thh >rˋEtƒ P;E뫃 RV띐U3vUEu EÉUSP]t ]]v]ÍvUErt ÍvEǀE EǀɸÉUSP]t squ]]\]Ív Ps:]]EPj Rhh >J{ RKj PN9EUWVS U u} 9r"v R3%@t+F9s~#tcӁwԡD4%@u׉#t?9t;}t]1] 9ȋU}v9s8::t#B9|}tuw2}t9e[^_Ð@Bڊ뤋E띐9Ⱦ}ڐ}u1}+U9эAu9u}8Pj EPRv U9x::o9E뚐UWVS uU1]z))~h,EPV3ue[^_É8th,EP&3Ftσh,EP 3‰Et8tEQj EEPR E8uN~ ~YEt/uh9V2t 8tK~*Euԅ9E")EUWVSl@@ }} UEEw} {e[^_Ã} uЋEЃ8ЋU@EEMu]3} Et 3 ]KMC EEP3&tRE| v >+3 uuu PVqE HtH]EP3?&uuu En}Ue[^_ÍvUB;E_QRVW1EXZuUE)HPDPuRW+ Eu]lЋEHE%ЋEqUM Hy6IQE'E@ ]hh >i]FU HyuuWuEph0@h=h>EPEP葮0EM EpE@E@ }d]} ! uuWuh0@h=h>EPEP0E]1UM U$VUQPj:R"t\9EtW )]EP$CEP$EHSPuR/E@MDE@ ] E@ ] P3ExE"EO} } MU9JECUEuuWuuh0@h>h>URuuWuuh0@h=h>MQU2uN+lhd@j豼M EwUWVS,} UEEQ} [ЋEЃ0ЋU؋@EЍE*UЉE8 E} } EEPEP1IQVuuf DE؃U90PRuV-EXuXuuu uV } u} 0} 0Ee[^_Ã} ЋEE$>Uu{EPEPPPuRaǃ  uXEEǀJZfvǂE싊PUEPPPQSuRSye uehP*?UЉEUEEU؃)uJRTRuPVǃ )uhuV#^;EqEк"ARuuVk҉ЋEE1>EǀUWVS<} UDžDžDž} ЋЋЋ@ PcOv} } PBtoPl} 0! u >1IQ67 Vb} 1(} JK} KP@h=>hV+\=WS6l9؉WVLb[^)HPD:PWRà !PhoPj<8t<tVauHt ڍe[^_ËMt틕Eh P!a몉ЋWЋE<c} *"UWVS,} UEE}w} Ve[^_Ã} uЋEЃ8ЋU܋@EԍEUԉu]3*} Et 3]SU؃EP38tHvE|  uuu PS# tE]EP3uE؅u Ee[^_ÉUB;EQRSW&EXZuԋUE)HPDPuRW u]pЋEvHE5ЋEhh >btO]ELUE?EԾ" PC)E9UԉUWP4!1U B55h4!h\ uhjR 1҅u4!Ћ}ÐUWVS H!tEe[^_ÃhS#1҅xѾ1I~ Q1҅H!tSP H!눐UWVS, L!uE L!jjzXZj`jiB: ]@S URSj$Ch!Ul!4DžPPPu,)=$Pu5ISjURjKFEF FYU 2FRU rrP#U FF[_jPL!333L!EEEċEEEEjjF,P~HW+EPW)? FLWPFDFL@n S= PSjK$#P!u<P!$T!X!\!t`!Xd!PjRjp@P! Pu +. Eu .E[^hhpuuW]!e[^_589@ }@5C$IPjEPjvt6tVg Vt e[^1_Éh@h@h@j&? ?4Cz h!h!,Pjh! l!j[l!51;| V ]S EPSj$h!tD vt1 $th!l!Pyh!uщFtt PFLPF VXu$uTPjEPj/5$ue[^_à h!%l! Pe[^_à h!뚃 Pk FHP҃Oh~AhzhAhUSS] tl!t'RSp<(PSR á$u؋]Ív $u1]Ív h!CЃ h!/1h5jvhAhA|vUÍvUÉU1ÐUÐUVS $ɋu]u#RSu V`,á$u2e[^Ð VRSu V1,á$tэv Ve[^ÐUVS]u 19sHr e[^ÍvVsDhƒҸt܉SDsHe[1^ÍvUWVS $ɋuurF8Pu@~"Svj 69tPCߋE )׉U8fN )~ $u Ee[^_Ð V V뀉~EGPPV VD+EURP6u+ }4$8uPSvj 6tSC+ljEWVuTVDUQu6u E)FU :$uBFD%~N VE $u1e[^_à VFD V1UWVS =] C(Eh,P EduEUh,EPC8tK(h,EP8K(Wj MQVCP8"nE8UEt= hAm<+K(h,EP'CQEu21e[^_Ë<+h<-`Et܃RhB v hB跈뼉EtVh&BvzK(mE{Eh,Pb8K(Pj EPV)8"!E8E%Vh:BQ hNB:EQjVh^BF:PhVhB訇!<+C<-;ERhwBEtt p{ Eh,EPWC18tK( h,EP/ 8tK( VTCZYh,EP8tK( VC$h,EPC8tK(@h,EPCv8tK(h,EPqljC IEtF?uih,EPDƃEPjVhB<tK(PhVhB؅wcrtPWLuEt hB蕅U!u !ÐjPM!!UWVS,!LhhC!oǃvPWhV#t/ttF#tЀ/uv#tÄۉu&뷍v RK%@u)#t$t FӁwԡD4%@t׃ 轕ZYP5!'LPWhFV2S We[^_ÃjP>LUWVS,C}ء!dK! EPED=@1ۍvSh*Cj EPS6 hCEPugEt518tv45!G>Ku V说C<8t+ u<UЍe[^_ÃjPLK7EuEUWVS!qJ!!u h!EEEPEPEP}WhC5!> u\UEu5!AJE]PEPEPWuShC5!$S薳t1҃Be[^_Ãte[^_ÃjP+J vU!uIhI !hDch4ChCh`Cj Ht;!u"!@CÐjPI맃jPI΃j5!DI!ÍvUa!ÉU!tt!Ív/!U jE jEEPujEPEEp @HÐUWVES1ۋu t%߉CtA9uu1ۋE[^_CU j jurUcwÍvUWVS$EEEEEEEu }Ej`j,C8PjCC=$zh8h!n$t h! 5!*ÃFM;zE uYE@Ep 9uҋE@Eܿr&uܿ)u E0fËE !{vr&uMv$uFh8h!U$ h!Me[^_鍀 h!茨!u럃 h!q5!}c E0莂U҉Et! uzu5!{{S5!hpEj~vUWVS}j ƃ1t\t1ۀ?u)Fwb$(EvPWt CDuDxtFe[^_ÃhpEjO~XV茡1e[^_tt Fƒ ՍvUWVS ]1taKt5 3vEUt>EPBwԋCw($LE 3|ɋE@tBwvEe[^_ËMAtJuJuE@ E9utDuTEp)KB;E@ E9utDuEpr&^MA7vUSP]t/tTj.V,Utg @PEj.VU tA @P ] j Et}t}~} VEe[^_Ã}u jjܚtPjjjSl CjgV{Wa1I EɃHX됃 j膚Ex}1E@U؆fBЃQPVjE@UP! jE ǹEUB؆fBPЃPVj薷~AE@UP uƙXu轙E uۉUE Pu1҅tu u‰ÐUUt~tÐJvUE HEPB:At É<uzuB %t.B %=uπyuA %=uAB뱀yuA %uU卅tDžtPxPu1҅xyt Ht#1҉ÍvuvfzЉÀzUVSu] tZt;SV/X1҅u e[^ÐhCPCPVXe[‰^hH6jNhFhEUh5jMhFhEUUVuS] tt,PjSVWe[^h5j_hFhEUhDFj`hFhEgU빉UVSu] tJtaSV1҅u e[^ÐC PV/W1҅tC tBtQh5jphFhEThQFjqhFhET넋CE uKe[^CPVS1҅iCE ue[^SvUVSu] SVsVt$t*HtOhvhhFhE>Te[1^ÍvCPVOStCE ue[^4SCE ue[^Vh5hhFhESZh\FhhFhESAUVuS] tUtoSVRu 1e[^ÍvCPVUt{uڃ jhEC PCPVWh5hhFhE3ShgFhhFhESpUVSu] CCt e[1^ÃSVQtCPVTt҃CPVQtC PVQtCE ue[^Qvh5hhFhEWRVh5hhFhE6R=UWVS }u Gt2HtGFt\wFu"GFGFe[^_Ð_ue[^_Ívw[$,F u܋GFG F븐GFe[^_É_ txF^`vF^HhtFh+hFh F&Qh5h*hFh FQ    htFhhFhFPhtFhhFh FkPUWSPt e[_à 5"膗=$u1h8h"ut*$uIPe[_à h!뽋 $u ڍe[_à h!ʗ h!趗P륃 j薑XZS5"ʘtw S膑뇐UWVSE HUB8Pu@Dž<Dž8Dž4H9AHvh WL%@teUB%D4%@t4MAHCAEvà R뾡D4%@u%u0DžDDž@H:BzHwF$FMA~^E9u)MZIH49AH JT Džtg<,Gt ,uGh#SVbTuUDBuuh#SV TthVSuD딋DBJ!܊딃 hfS$RS2B9, P"sT떐UWVS<若@u1@ hVjjjjSj負01҅hPSVX=fDž9};WuD;9|Ƌ PqDDž9DžWuH 9W0LD\ D D Ë9Љ;tR9XZe[^_Ívu Sp+A;s0G4;wFPSWQ;rЋ4(1ҍe[^_(;s(9Dž9}. 4o9|҃ o1kU1=YC61 :$ RUWVSuu }WLƃ1tGCt VDo؍e[^_8uG t܉щUWVS@] DžhSP轓=j@R&5Gj.W 6)߉1ۈʋ}EхT1эA9.!T1۾؉уfDŽ).uR٢Mt  v8.t1fDŽ).R脢tuR Q|Me[^_ÐljыI8.1TэA9.tu(1e[^_Ð<.tfDŽ).U2Q臡6 (vURvPhFJWut 1UU"t1Ð "h"1x1$$ÍvU$ÉU](t*~=t#$Ívu$Ív$UE1҅x)"u6Pu u5"@"t‰És" P/k뼉U1҅x)"u6Ru u5"|"t‰É" Pj뼉U$ÉUu5"pÐUVSuhh"xSLtPSVhPHte[^Éhe[^ÐUSE]M UtEUM ] [`#EUM ] [UE#E #E #E#]USj it( @@jPit؋]ÃhTJj6USP]SBK9tE C1҉Ћ]ÍvBCP3ȦtԋKUVS]ۋU tYu]e[^ it$S1u 4Fh9sw 3h]e[^he[^ÐUWVS Ex1ۃv0u 4ڳtC9we[^1_Ëe[^_ÐUWVS, dɋEu tVP蕳e[^_ÉEE`EEEEÊ>vEE;t%EPUREPS0];tEt܊t.Eu'}܍UREPWVm0u܊t EtމUE9Uԅu UE)‰UԊt VuVUԄUt؉E؃ u+gXu"gE؍e[^_à Pr1EЉ4$e1ƃE>u뱊)‰U멐UWVS<} R%@t#7GwڡD4%@u݉<-+EE}Eu10LME"EEEERPjjEȉUtuujjEUCUȋM̃EԉUMčC< wNv;M}Su؅x'E9EwrU9UwUE3U3E u};M~xEGC< vC<wN7;M|}M tU؅ҋEtGU EUe[^_ÐC<wWSEeUUEUċEЋUUЉEÉEEEMUUEGE0u;uBMM1*e[^_QG;uX뵃DQډ#_4MS )ʈѸU!9)uEtGU-UWVSv=EUHM1ۀx0u vCE<0t]u1u!:UyE0e[^_Fu:M+Et)}P"pU2+EX1F VxƃEu11҃;}v,O:Et ك ƒ;}wԋEM)ȍX YR4{)ËE 89EuU܋E 9PEE P;U~`+]9EUҍsEMtMSupE @)߉E܃Et U B OHMUM EU܉Ee[^_ËMM10ۊE@ ,'Hj u;}wS1Ҹu9rEutm19sSuFU]9EsuU:t$Ue[^_ÉE1҃8te[^_à E 0EU U‹Ut{먅tVjqÃE ۉtPVjS贓E hK1`UWVS }19] svSuUt ]F9re[^_ÐU0u EEPUÍvUÉUSPM] t2rt1҉Ћ]ÐEEQPQR‰Ћ]ÃUARQ1҅tƋE뽐USRM] t2rt1҉Ћ]ÐEEQPQR‰Ћ]ÃUARQ1҅tƋE뽐USU ] t#rt1[ÉB] UH[B] U[USU ] t#rt1[ÉB] UH[B] U[USQM] t2rt1҉Ћ]ÐEEQPQR‰Ћ]ÃUARQ1҅tƋE뽐USSM] t2rt1҉Ћ]ÐEEQPQR‰Ћ]ÃUARQ1҅tƋE뽐USPM] t6rt1҉Ћ]ÐEEQPQR‰Ћ]ÍvUARQ1҅t‹EfUSPM] t6rt1҉Ћ]ÐEEQPQR‰Ћ]ÍvUARQ1҅t‹EfUSPM] t6rt1҉Ћ]ÐEEQPQR‰Ћ]ÍvUARQ1҅t‹EfUSPM] t6rt1҉Ћ]ÐEEQPQR‰Ћ]ÍvUARQ1҅t‹EfUS ] EEPu,1҅tEЋ]ÐUS ] EEPu\1҅tEЋ]ÐUSPM] t:rt1҉Ћ]Ð1;EEQPQR‰Ћ]ÉUARQ1҅t1}믍vU+vUWVS Uҋ]u t׃u"tUt#1Ƀve[^_É)ӐPCRVSP 1ɅtՅtϋC}E K]H ,QCRVSP1ɅttC}E #]He[^_UWVSE E]Uu}SV1҅tc9witsqE]E ue[^_ۺt3}u؃SjukUEu hKq 1ҍve[^_Éte[^_Ãuً]t u>U빐UhE PPu ÍvUWVSEMu }E]MVW#t8Kɋtv9t2KuEtMM }Me[^_e[^1_ËEE }e[^_UWVS E utuۺtGv1IMEPVQ1҅tE;EwHtr$t61Ґe[^_Åɺtt5PuSVAe[^‰_à S0=E 봃QjiÃE ۉt E뮃 hK 1끐U ju uÍvUVS]u tKrt1ҍe[^ËFEUECRSP1҅tՃESPSRÃUCRS1҅tUCRS1҅tE1ۋM 1 ȉVxUVS]u tKrt1ҍe[^ËFEUECRSP1҅tՃESPSRÃUCRS1҅tUCRS1҅tE1ۋM 1 ȉVxUvU?vUvU'UWVS<uttu ude[^_Ãh$u6ude[^_Ã51P;ofDŽ)/XZuPqoIDŽ /LC_DŽ COLLDŽ ATE_XhPQJ'jj ]SH޿K8¾d h 9u h9| P9Gjh SOHjhW2HVj9n cXZuh$mldl1ɉ=ddȉʋdDȉDA~١h.h~,1ۉhD ȉD hDȉDIu1ɋl1`|uA 9t`1d0Ku0jjPH΅ 胚On 0S7<$7[7YӉ>0 P7 P7\ Po7^0 0SK7<$ٙ 0SzUWVS E uUEhtUU tH8Eu1IWQSVVuыU I C UC"EUdЋUdDUe[^_ÐUWVS 1ۋ0yEǹRˆIQRjF jhK9jE} عу IQu jE jhK9jE4$Eǹу IQujE jh+jEXusUutÃhKjG"UWVSu1эAEt>uEe[^_EE EEP(5EEnl<1iF}uEe[^_ÍAMhKjGUEt $Ívx $UE$$ÍvU $VSu]tW Ph5 $Dt'PuS5 $`5 $jjhK9\l u  PhV85 $C$$u Vqj5Ztv VЃېUEPuu u8Uuu ZY0uUEPu ZY0uvU $VSu] t\L Ph5 $ CtPuS5 $U5 $j NB$$u VpjMX뚉 VЃߐUE Pu ucvUWVS $}] utu Ph5 $eBt%PVS5 $5 $jjhK9j WEE V8 $Ee[^_BvjX끉UE PuQ蝔Z0IÍvU u uQ~Z0*UE Pu uÐUVS $]u tP Ph5 $|AtPVS5 $ $E E e[^@jX릉UE Pu~UE %~MEEÐ~*E )ȈUEÍvEUS]؃MU w$LAtI[ËBAAA͋ER3 ‰Q뮉UWVS@fC냐UWVSjh,Ã1tvCt~  ChHLtR sC1щ $,CtBVP`CC ؍e[^_ÍvChpEj1e[^_à S+1UVSut> tCe[^ÐFuKF u6^ 3.؋[$m+u V]+e[1^à PK+뼃 PUWVS u} ,v9vBx\u te[1^ËV ^t;t߃j:SF$tՃ j*@VuWF؍e[^Ív3FuhpEj v[@uFu빉B먐USP6/@$uY<$u5$1ۅuah8h<$.à $u,ۺ@$u 5<$.t;ډЋ]Ð h8$7/‰ h8$.<$u넃 j(XZS5<$30tt S(@$둉뇍vUSj (Ã1t&D$,$tC0$C؋]ÃhhL8D$u ,$ S`(1]ÐUWVS }t=t= toe[^_GG,$H~ ,$W'1e[^_É50$,$($0$4$" s'Z3'$'tC@vtσ Pz' Wk'X5D$y1D$\USQ]t 36'Cu]] ']Ív P']]'UWVS Ɖ* 1D1ERPhVzoUPRhjyEKL ut}L u)CPEPhjyEC-E}t+bt~v~KC뙐KˉPEPhjyC UPRhjxCtd}PWhjxCtDPWhjxEt'(juujCC1ɍve[^_øL ut-Lu8¹uCCCuo j$CCuj,uESC4C@C^_Ps$Cuu1Be[^_à Pn$냐UWVS } D$?GG0$G1=($ h#Ã1V5D$hSr4;#tރ j #E jD#Ep@F|@ 0$uYE4$0$G4$@e[^_Ív1e[^_ÍvG @G@뿡4$UP4$@4$뚃 S"($릃 S"뛃 S"[u"뇃 S"4$U*w $4Nv\Mø4MøPLø MømLøLÉUPuhL 5x52ÍvUWVSEo*E"E89uX0$t4Ɛ^u3$mvu1=($hhL1E h~!EPuhu2t>8#thP[1}щ؍Q)9t@u u%! u?sEe[^_à V!1e[^_ÉPRuVmu jD Et@‹E@Euz5xj%jh|MX5xjjhLX 5xj'jhMX5xjjhLX 5xj)jhMX5xjjhLX 5xj&jhMkX$ s hƃ1 jDEPjDSunY_3V1T_ZUjVY^s pVT_MZA jVY^spVS_ZUBjVZYspVSMAA$,UBtMA1uE%jVlZYpC4VSMQG9yw* uq  2 uEdUWVSL] 0Q@u0e[^_Wj j PhWPS2 u> uZYPPWhN- 蓀0e[^_ShhH9WtB j hH9P^B떐UWVS ։J?P@u8e[^_É uQPVhNWa- e[^_ÍvUOUPÐUOUPÐUVSÉO|uO[^ÉO[D0^ÍvUWVS UEBty1ۃtME [^_ÉF9Au4AuA uAuAtxA}tcvCv#O9X ~Gu009tC1ېN9X ~u009tCۍvAt;FuEE [^_ÉUWVSuUfB O~q hPVuu- xYƍF;EwO V/4$Ã/;] u;EuuRu1e[^_Íe[^_ÐUWVSu UfB;u w E ;Eve[^_ÍvUBUfB19tpe[^_Ív hPVu u, xƍF;E w V.4$.ZuuPSR t2OMUBS,1%ULxBLY0)LwL@kL@_L@ ÍvUWVSEL@ } h mL@h5|jjhOR 5|u uDž)L@u } ~ DžDžDžDž<Džxo|qDžK9P,DžK9H ` b҉tx KXtR1ۍ} JZYRuuWURVP u r_ C) 1ɅtJ@zJ@}J1x8pJ@t,BtPJR9P 8Jx(JRP JVjjQ JZp $Id ;zStQIZ0#R I@SE P +E E DžjPQgIZ0"U 9 ufDžSPVQ0IZ0&ff)ffuÅ u*;EAfff ! u5RPVSHY0D& ff)ffuDž taEHf+EfftDf=vPSVQAHZ0%~ff)ffu‹Uff9 PH@uEHa 5|jjhOM 5|E9Pu賞]GaGxG@ tG@dGRP RGPjjWEG^p P!5GU #G@gG@ mXGx tTFFpu2StQFZ0  F@ju uSFY0&&;E  F~Fؙy DžDžjW?B@EHEfDžfDžDžDžDžQjVjV|i <uDžPPjuuS"EY0J!  DžvUff9,E@u!Ea 5|jjh:OJ 5|E9Pu菛D jJOxaD@ u P~zD@ EEPuUE PROGD@u5|jjhO%E 5|E9Pu$b+ooZ0 PG o>@Dž(!>@>a >@u>a t;hjhk5| 5|E9PutN>@uz5>@ to=Xv11!j\C)O=ZYRuuu uP u=a5|jjhPWC |Xm=MQPhO5|="mmZ0#Pxill^0.Pll^0;PlVl[0FPl<zlm`l^0QPxIW5l^0XP lZ0_ UWVShSRj^) 1эA;M Qu Su-^VNvh)hP1xZ=sSxM4F;E w-]RQRCP`W%ED1ҍe[^_Íe[^_ÐA%t$` AtAHDRS~*'1IЍe[^_ËE1e[^_ÐuEu 1u׋UԉPjR]SQڃېPjR]SQڃ UvUWVSu1[^_ÅCu؀8u؉CCUVSƋBCB RڅtۉuۋBF אe[^ÐUWVS\EEH1}:_<]w,EЍ_;uEE]sGG,t@x\FEE;us,t&]!Ћ]:u'uFEEE;urՐE9E~ ]}ĉ]?uEă\[^_ÉEyEx딋Eč}EEEEFE0vUWVSPu~] t{NE;9t3{t-uuxttfvttt2tA@9B@~&_[^_Ð{:_[^_ÐuxE9E|؅x ;E|ʊ8u9}_[^_Ív9{tЋB@9A@xBD9GD ,AD9BD AD9BDhZBD9GDIUPtEHt\PuP uPuxt t?ÉHtX tt@t޺tٺP Ð@ %=t=@%뵺xl[/ÐUWVS<] u}t UPRVj4tpEPVHuyt<uE؉E1}ffEuMQe[^_Ð8u]S֋EPWډmf*dɉ{WzrDž71;1C$;)Q9u)8)8@ 1Ƀ!v ": u A99p\ A{42uuWt01A uڋNt5Bt`t[e[^_ËE1e[^_ËMe[^0_ËU1؅DžytvuKz) S@ɋً1DžEEE)E&jj Wjj]SB L -jjWPjSA  H;wL jPQRjHW@PCCHGH;v Dž9c1Qh8P`BCǃ9Ѓ9FF?ƃƃ-qDž@9ȉ}:vD8D~"44T5DD5TC9|ɋ9fDž:RjjPP8P8R~8WPSZKd1DžC1҃9 @0  yu:uru zƃƃBBB Mhh&Dž9}7SF9|Ճ 1tO{tG jn @@@ @ug Sa1ۃ\U@e[^_Ã]ShHl%]PShj HlUWVSE‹t‹p@lElhh?DždQhhRtƒUVRPSHup9t}utUȉEȍEdE1t DmFuDdXpP dxBExldDž|d h<dE@e[^_ÃURP US EƒX02蹾t ME@]USEƒp02t E@]UWVS\ME} *~} t1e[^_É} uDžfBֆ fB;Dž%DžEH h h%V  h%t;} } MDž$$A$Dž`$`$A`$DžDž ;r<v; +PV x tލF ;wh V{4$d4$Y؍9ЉwAO )vDžUEMt苍UuE1}򮋅)9|uP8U EE#1ӁAU%%E%} t*} t$} *U 9uӁ$ hQV  P; 1ыӁGэˋ+9PU ى hPV  RV;m1ˋ+9UIQ3 ^M1iE9X u#U 1߁E$xPSRV7" +PV  lMU`UWVSe[^_-F&ٍvECe[^_ú먃 W봍vUWVS|EDžPDžDžlDž‹‹@E (x@u 1} EEЉUhһЉ1K hj jR %=y ڍe[^_Ív; cvfэf0G v8fэf(fҍf0GfЍf(эA0G.KGNx0WvURj P򋅌( UЉEԋE؉DžEUe[^_;}3 ȃQG.QGG.KGNuՃ23:#B% /Z"0"UWVSEPu] R11҅x7UtB txt+u1ۃ uwX?8ڍe[^_@9uͅtPjrSŐUWVSE}uE WZWV[u$E9FuU tu v (uɋtLJLJe[^_à WZLJLJe[^_ÍvUSQ2X1҅t@PSu u"1҅uډЋ]UWVS }]g@u @z@ hVjjjSu uj 0W@ @~uuWSV%Gu fGfub@Ge[^_Ív @uuڍe[^_ÉSu uhQ vuhVSY Ã.fGRPGPhQbG hQ?vE@+ @u:3 hQ負봐UWVS<u] @u @z @ux1҈щ߹ыLSVh=Q uuuu=e[^_Ð uutEPVh$R j1эY.˃x<.t6뉸R|juQSVQkƄ RމRމu[H@EH CPd ʈd~@u@ Mv}t*} t} CEt< t< u}e[^_Ã0d_ZPhRE럃 CP 0@ Y^0hRd3 C P~~@@ }_ZphRrPQuSh(S^MT=@t hR" pVuuhLS HH@EsH E]HEGHE1UWVSDžtDžpDžlDžhg=@@@ @@$Hc@ofx@{@@f@5@x@ ddǀ`$hhR|{W|hQ<<;t<#tϿRu< d< \+u< < R u< < Su< |< t|< t< _VW|hQ"tddh ʃ d|mx`ln\HH1ҍe[^_Ãt< T< T ۋT= $ R%@ F ЁwѡD4ҍh Th\TTT t tT K;BTd# V3%@uMTTt;VhhR gu#;txwD4%@tTۍxWdhhxhhRfTxBTd RK%@u8TTt&;t!xӁwšD4%@tȃTۉxPdhl\DŽhhhl$Ah\p:< T< T ShTQC`$83ƀ_'`h+P TtDžlp< Ti< aTm dPhTP`$ƀ_`j P8d Ttc`TUTPDpHDžx)< tPxtTDžxTT:`\9 T< uTDžx뺃 h SBTS@@@{fx@kfC@pV1F?`CDCHthS3Gj.SbT+@PV`$ hSATBRhPP`$ƀ_Džp`TuTPDpHDžx4 tdxtTDžxDžlTT:R\9 T  uTDžxXىptx vTT t t vTT t tvTT t tfwPPdjHt xTh "\DŽBBB Bz8TxBTd R-%@TT;ӁwD4#hhvlTt- t( t# TTt < t< t< u⋅T=xۋT&x /t(xdFJx d]yIhDŽh3hDŽl\$Ahى1׹j5hfj SDžDž>PPSTA u~xuwxB[tVqqR xMtTQppRe t P)hhShlTt$ t TTt< t< u担TDžl7PVdjHdtT1tShjR vUtÐU j juUVS] S;t*Cst P Su؉e[^ÐUPtEHt\PuP uPuxt t?ÉHtX tt@t޺tٺP Ð@ %=t=@%뵺x/ÐUWVS\EEH1}:_<]w,EЍ_;uEE]sGG,t@x\FEE;us,t&]!Ћ]:u'uFEEE;urՐE9E~ ]}ĉ]?uEă\[^_ÉEyEx딋Eč}EEEEFE0vUVSƋBCB RڅtۉuۋBF אe[^ÐUWVSPu~] t{NE;.9t3{t-uuxttfvtt$t2tA@9B@~&Y[^_Ð{:Y[^_Ð} 9E|ԅx ;E|ƋP@@8Bu9vY[^_Ív9gtЋB@9A@hBD9GD AD9BDAD9BDhZBD9GDIU1ɉtTT 9t u1ÍvUSQu 1҉Ћ]Ív uiCuUWVS8hmSUԉE6tEQPRjHUԋB PÃ1t_C MԉCRqjPeMԋASACSCB}St!EP VpuRj؍e[^_ÐQ WEqPߍvEԃ8_~UMЉ%=9=.&ETUEUWVS 1҉t St te[^_ËShE>ui} twІЋuuC1e[^_Ív z e[^_EPj EPVuUt :VLE3 뗋CfP1kCr&t )t1҃RV(ƒҸ RvUjÐUWVS<ƋE EU1҅t e[^_ÐF1҅t8t+PEPW3HUE e[^1҉_ÃEPWHuًF;t EPډE jUUtЅv@ujvF;tu[ EPډ-EtA jUIu+uGUЅ @uEu P Uuxtă Uu]륉UWVS1}DžpDžhMUȅɉtEEEEEEEEEMAyqY]QuFt9t/DžpvE}pe[^_}u]tyutrSDžlSx_UllxG9u鋽lGt܋Ot9u9t͍vDžp e P^vM% ==YUt tuB}uMuEU E4p}u}u=SDžlSllE}u󥋝ltϋU9t Ct…ul]N9tFtvluO9tGttuuEulBtEulAtEU9U Et/1҅ppttCvt@u= YUPMEU ҰtEEEtS]Pjjjc P藽 jjjA Pu]=SDžlSll9}u󥋽l9Eu΋]G9tGttuluQ9tAttuutEulCtEU EtDžn1҅tp=tB,t@u"}DžpEu pDžp]t]u0hu&DžPË[PuPu1jDžhDžp@PjjSp/DžpE:1҅@9j%u M u踋`+E`8PuVCu E\dtX{t[틍\{9WG< Pj P\Ɖ 89G[WttCPjjuEh PU E1҅E1҅wE  pEC jU yE1҉$}PWuh. W覍UEE jjE PujEP 1@t8 t ?UWVS@jjjxtGPju]Sӱ Sh i V褚@t V艜U؍e[^_à Vr EP1҅xՋ]1ts t~t'u ut*e[^_Ívusu~ɐUWVSUEuU P uV< uk6u>t;^t΃3u!tt3uu㐋M tu v uEt!Uǂǂe[^_à P] Uǂǂe[^_ÐUSP1҅t@PSu u1҅uډЋ]UWVS|uEEEEEfEEEEEEE}ȃjjVjjW  unjjVPjW Uč9؉vǍ9wvEEEHE+EU4 EPE{MMMMM1}Uč9؋ufEEǍ9uG TufEGtfW fUEUO`MuPMGAUBQPWhRuMAUADEMEA G`PuuG`EEeUMJVjPGPQEPEP@ƉUU S8 5E}( S蜈jjVjjW e[^_G fEGfG O`EfEMG`MLMMEPAMLM S;uyMU 1e[^_f}~fEf9G f}eGEWOE1MEM F;#EtMEt EEEf}~fMf9O @f}eG[UBMABAGAEEEWU1 FЉ#EtMEt EEE뼋E S脆1 StE u[1yE.MMM1M F#EtEEt EtEEMM뷄uMMEEU1U FlOM#EtUEt EtT tnUU봃uMUJPuuQ8EEҋMIA΋UĉEEFEMARuuPUU뒋EMAU:uQujPMMgRuuuvαUׄUSRËu 蹄ǃ]É P 舄ǃ]ÐUSP]tC][[YY[Uh*hN苉 IÐUSP螉@It Ћ]Éh*h$IRu Iu 1҉Ћ]à 5N uhjS1҅tP5Nъt S蓃1룍vUWVS ۉ WXZEPEPPPh V dž uuh/hPSue[^_ÐEPEPPPSh VS袂tdže[^1҉_Ð P]1҅e[^_ÉUSP] u&hhV<E ]Ð P3E ]ÉUSP])ǃǃǃX[ÍvUWVS<u GqQ6h*ú<+% j蘛bu P"t hhPbdždžPP1IQPh V  h/h}%Ê<#h7S^t}h=S^lC< t< th(VS^APj PScG9: =UBFz Bh=W^tuGtoti< t-< t)9v;h=W]t;G‰hhV"t^1ҍe[^_Ë% Ph+VhR dždžu PvWP1IQRh1V藉 tP|WP1IQRh VK 5 h/h$<+WUqtPu.UQt PaÍvUSP21҅t@PSq1҅uډЋ]ÐUWVS(hU WuEPR]ƃ 1x)u;$u"CHCx6.Ee[^_ÍvSj.iSWj;C}ŃSj.Uuhu uGÐUWVSu]SEuEPu Nƃ 1x#щJu1;M} f.Ee[^_À|.uvUVShVhu uuà 1tuV蒊؍e[^ÐUWVS ]Sҋu }t vsV[t Sute[^_Åte[^_ÍvUUXtnw(XtbwdRtV.Rt7wQXt(vkRvtQRhXh N NÉ Xtw\XΉ Dtv'@YtȸR@룸Y떸Y뉸&Y|5Y@ovUWVS } uWjjhtFF뮉)9܍vUWVS u9Ér )e[^_hahhahl` )e[^_UWVSM uMM} uQM1RPt Et?uct |.tCU;wX.CuM9v?@@UE u؉e[^_Ë<u듉MEUe[^_ÍvUWVS } 9Ӌur%RSP6Ͱ؉<$1e[^_yUWVSÉEE E׋UUu u9s3D39u uIxn+Ee[^_ÐPhatu uax)u ux CNsUEE Ue[^_UWVS u} E]ۉEuBB9v;)ʍBvVWa`x8Ky1e[^_ÃVW4xָ͋EEUWVS|:E(M$M U01tuP>@U,E$M4E0QPaDž#Pu4u0u!DžM4 QU0& uGPu PhIxPsU4RM0Q‰ƍx DžU4PRM0QW35Džd}#}$t`U4RM0Q‹EDž&E,t },?U|2.t0M4Q}0WWDžFPE4PU0Rj~ǃDžaQPh,axRHXZM4Q}0WxDžfE ;D)ƒfDžx ƅzz~ Dž1;|#] P3Ph6aW贅Fǃ;|ރx}4)WE0Pډ<z1fDžx; ƅz+v@ Rc%t'3F;}#] 3G€t.ءD4xU4R)ǍM0QxwE E ;}0)lje[^_ÃWM0QjaCx VWU0RjC0{Dže[^_ÃE4PU0RaEE<0]}4WE0Pu,] SU EDžAWM0QDžWE0Pu,SU EDžWM0Q W}0WjDžE4PU0Ra)Dž u !aE ^_M4Q}0WúaDžmQu4u0SDžI E4Pq U4RWjDž}4WE0P a\Dž u T`E XZWM0Qa DžPu4u0S6Dž WU0[XWU0RiaDžHQW}0WjDžE4PU0Ra mxU4RW(VQDžDžaG3}4E0WPja W}0W(VDžqDža7UuuuuU  PPP:MuPA)PRaÐUWVS u É׉E~BWS\xAUҍXtP9w-H 9w&@R ЍN9w +Ee[^_赬(e[^_ÉUWVS]E ؋}Ej0j^WsEK9GwvfC fGˍI;Mw[fC fG 1;Mw@QfA fDw FˍI~1vfDw fu.DF~;]t<(e[^_ÍvPVUx׉\G$G(G,e[^1_UWVS } u];~$tD~$F(F,zD~ 9mF(9~DF,F(1ك)VQWCF, F,^(huPv6TZ V,B;FV,<fR ‹EfV,BJ;FN,RfA ЋUfV,JN,B;FAR A A ‹EV,BJ;FN,BfQ ‹Mf V,V,E  ;FwkEN,F(1҉e[^_É۩e[^_É^(ZMǁfǁ ǁF(1멐菩(벐UWVSl11} MEAUAEEUȈÃEЈNJUE ÊE? Am ?nFb>Fb>UFb>F}  EEڊUEȈUوE؋E 1EEE vDAB;U rM؈UوÃȈNJEڃ Ӏ?FE=F;us }7l[^_ÊUȈU؊EUEوUq=뽊EȈE؊UEUوEqUȈU؊UEUںE멐UWVS u1EvFӁ Ry%@uЃ=cShbStM t}9}#b(ȋ] };E1Fgv=uEe[^_ÍvD4Q} [MA;M-b] };лb(U D:M] <MA;Msr-b]} лb(UDME tE9Es*йb(] };dFt v t(Ӂvs Rx%@tFu؃=FtVӁv* Rw%@uظǡD4סD4뎋]KU fU M< P]KoUSPEM U]tRQPShDb5xQ n RQSh|b@U w BÍvBUWVS }EG}.+/€D4%tӁ R=1ƊGЁvq RD=wztpڋu E ؈EvGt E9EEe[^_à Ru3v4덡451UWVSQUҋ}] Utr~19}DB H0CB ,0Fu 9}.Bv9|EZ[^_É7ҍv7붺NU널UWVS }EEE1GtqÀ< St%wKtAtCEvGuU~EuvE Ue[^1_ÉMvM SHt%tv< S;ÃCw|$bD4BD4봐4č)ƍv4v4v4u1EE e[^_UWVSLRPhbEPu }FfÍ@;wEP7wr)1ҍe[^_ÍvUWVS,E <1҉EE񹉈EUv)ƻ1󸫪U1ع%I$EЉ)UE1EE;gEu|E܅teK~RutHÀu8 SOr%tvo S`FuU +Ue[^_Åu}uuEPE PSEdxCaD4끐4됃EPE PWEvEPE PDCECEPE PHECvEPE PMClUVSMɍD x,D ҋst99H}pJu[^É9H}pJ@)[^ÐUWVS uu 1 $UB8Pu@UB9u}s1PSE0W觉U$貎)ރuiEX9rQVU2WxE)p0$uEe[^_à uтa P脃E1Bd$u)uE1u e[^_à uFݐUVS$uu^u'e[^É VO$^t܍v Ve[^ÐUVS$uu^ u)e[^à V^ $tؐ V藂e[^ÐUWS U1эAE܉UE+EM $E؅ɉEEuF|@8Pu@EP5|rۃ $Kue[_à 5|&말 5|ցe[_ÐUu uRPYnÍvUuu uRPUWVS uEӋ} uPRr8t ËRWuP]e[^_QhTchcjvU1;EsE ÍvUWVS E1v&uSUZYt PU F9wۃ u7e[^_ÉUE E EEvUVS] usv跂uE Ee[^雂ve[^ÐUWVS1ۃ 9}؅uC9| 6$7e[^_É P 7CӐUWVS 1Q$j SQPu)t*G9rكj hQEQ-Qe[^_Ë~uSj uV \e[^_ËVF.UEPUWVS4]S} jCP Chwj5QQte[^_Í S‰ jRhbhS =jS賋hcPSPP҃t; t PhbchcjDžjhQQpZYhwjQQ'Vhbchcj}vhwjRP^j떃 gDžp$hbchcj& WUS]3O4CtSu; tE]]Ívs s҃CϐUSQ$uihxj QQQXZhzjQQQu]à hQ:]Ív hQ:녉UWVS$h}hɉdt hQ9E$Ph.c=11҅Q9E+hh.cBhxj QQXZQhzjQQQL 5覄ZYhwj QQQEQz҉t˔de[^_Phwj 5QQEiPl@`1;`lpE\E t8U t/1ېE 4p~ U uQhwj5QQpt Pt&u\phrchcj DžtG;`-h hQ7zde[^_à hQ61҅s hQ7$Q7v\ xU|hwjp pxP @ tR$EVPtuҋlD GU DtT뺉lDž`?``Džu hQ6t4j hQ5U h,{Oo. hQ6ƃ븐UWVS<uÉ0DžE4!PP1IQSU4!B: PS*:ƄX.j S th= ËEM ACE@tZre[^_Ð 4!P=r̉DžuoPHu`@ t=uuIDžWujWKHPU B@J r< t< uCvEUM ,,!EAh=S t @1򮋅+9ȉ QPSQ< < E(;h=S0 t @1΋+9|URPS#QJCB赎/e[^1_ipUSt}Su uRVUWVS<]ctdj.uVPSKtPuu Se[^_ÍvUWVS tD]p]`GPWU EI]ۉpt1e[^_o1UWVS FtE]pw]`GRPWuU EU]ۉpt1e[^_o1UMȃʃq1ÍvUSMȃʃ˃q13]UVSu]F9}Å~PSu 6x)^e[1^ÍvUVSp=( Rt e[^ÍvPjhhd]SEjEGN jjuV5(5@t  R RuPjhh%dS N jjV5(5@tN R|Qjjj5(]RjjP5=(9= R0Qjhh2dSM jjV5(+5@u R 5(e8(vUMtRɉRttuRÍv ,tsRÍvUWVS u} u2 $uL$u\$fe[^_ÉSVhTdj# $tv hR-$t[L `Dždjjh j`R3. DJ \SK VhpqD37XZPS" Ph;dD 7R RuRtDP5RRsh`JW PDžTjjh jPP=-  t2<%uWm%SP5GuЃSj5$YxƅPuWD]XD,x+d pR =RjSP5(7@87t/(t P05( R jjSR5(-7 &= Rt ԇ87tRVjjhBd4j>PQ@h)Ѓ )ÉlDžpVDžthjPV04$X4 hR*e[^_ 5,Pj@PL`YXSRG$3GDjjhK9\q'3 PhOdD4@ D]k+dH RjR*Hx)ЉH+H|Dž+DžPjxPjQ/KSj%2XZSj%G2 Dvu"UE Pu uÐUWVS $}u ]u9 ST5$u e[^_ÍvERe[^_( hR(뵉U$uQ 5(G2$(R RuÍv hR_(É hR(띉UVS$uu$t5$u#e[^É hR'$ʐ hR'e[^ÐUÐUu uwÐUWVS u F]Et01эyCt :EuPWVSuKe[^_Íe[^1_ÐUWVSQ]CU t/ MzvU҉tsv9tAuCuZ[^1_Z[^_UWVSLu1ۅ~E;oMɍ]E ̍v1fKUEEuۋMxgK K:Ruhu _E uSu Ee[^_PuU4pu (E;Er؍e"[^_K-SU hh Ruu RÉ裂ɸ RÐUWVS1}Sƃ1t PSuVne[^_UWVS u} E3v PCEG=v: PyC9Eu8Ftp=wċU싄4EG=wƋU싄49EtӁw<4Wv> R C)Ã؍e[^_Ée[^1_à RBWw¡4)ÉUWVS uE }EU9 PBEUB=UvC PsB9EuIGt:Nt7=wU苄4EUB=UwU苄4뽐1e[^_=w*U苜4UB=v" PA)Ãă PAÃЋU苄4)É뤐UWVS ]ۋ} t*E48VuUt~E<Ku׍e[^1_Íe[^_ÐSD$L$ T$@AJt}tm8ui@AJtnt^8uZ@AJt_tO8uK@AJtPt@8u<@AJtAt18u-@AJt2t"8u@AJt#t8u@AJtt8t )[1[SD$L$ 8t@u1[ÐUS1 A ƒ~[áHZU08S48~"avCSuI0uDZ1Ƀ)v`aP@uA09[ÐUWVS#É`tC&C_<:df؉֙t/vUt3t[MIMEE [^_EUu͋uV)ȉEMIMEE [^_ÉME@ O1ɃE~5EE4vd)AE9݋E љ}zKQ։)ƍˍ  )ÍL gfff)ȅۍ…6)@֙MA)Ep~$EEU|dS9}A9Ή)EMIMEE [^_ÍvMuV)ȍMM ;ESP 0F UWVSMɉÉUEE1IˁMEUet U;EE@@EU؉LǂPǂT}G}UҋEtsUD}G =w)Pu]LuS5]}Cu1ҍe[^_E1VuuS5};ωUB 뒋E4+EEv;tU'ú덉؉]+}É}iE-Eut'ee<,M<;E#EX11ɃUPpA91Ƀ}9PuA91Ƀ~~UP}9\u E)DLP؅uA9<,<;Uú>vEU؉LǂPǂTE؉`ǂd}G}hBCUȉúC<,U8E@@EU؉LǂP}G}TE؉։Ӊ`ǂdǂhEEvuEPUEuURNjUE9~sC>C1Eu&dEיufEיud)EE}hJv>C닋LUSSødu]à jڸdG]ÍvUx!1@ZCu É@ZU$u%$uÐ h$ZÉ h$ZɉUWS h*e趍~ShX1I1;ug@ZDZHZaaahdhu@e[_ve[_Ð@Ztڀ;:t j@Zt@Z1뱍ve[_YShV@6U$u%$uÐ h$ZÉ h$ZSɉUWVS$M UMU 11IWʐ;LL*Iy躀Q؉љEE)yOvQEQй]Cй<CEљ]SEUxA1Eu)dEәfEәd;EmEәM}+UKҍ…ۉM܍<"QUԉEЋE))ƋE)؋]KDžۉQUԉEЋE))ƋE)؍)NjU)}UM€QM€Qxd;EE-lUB ]ȋMZAd9dv]C @)MC]9~EUM@B B J$$[^_ÐutpBC71tfp;HɿD@9LH@9PxIGkD@9LtWvp딍vUVSE DZɋuEto9PZg~9PZB9`vV@Zh@ZLLESV Cu0F(e[^Ða1҅t HZaB9}tB9|1늉UVS$uts h(Zv Dxz h(Z X5D  h$Z7 j SjV$$ZJ e[^ÐCPh jV e[^Ðh8hDf i h(Z 1ʉ j,Ã1tS5DPUSS $ɋ] u&RSju$u9؋]É h$ZO RSju$tʍv h$ZO ؃]ÐUVSEE$u ]uGtZ $upSh yEXZtC(8e[^C(le[^É h Z uv y $t h Z {vUVS$ҋutN h,Z= HxQ h,ZT X5H t[PSjVe[^Ph jV e[^Éh8hHV y h,Z 1͉ j,Ã1tS5H yUS] Sju_؋]U h u uB ÍvUuEj U@u EPuP ÐUS 191[ÉUWVSSE ɉ׋]xșƉ)EY[^_볍v҉Й։)EY[^_뎉U@+Bu'A+BuA +B uA+BuA+Bu+vÉUWVS|ExtU Ep }|u]j<^jEĉYUj EZlEMą%]̋}ȁnO~F1u(dי4fי!d)MĺE+%Mān~']̋}EEMċ]̋}Dž4u%ؙdu ؙfu Dž4444d9~E)EčG vEȉDž4t444d9EICE̅8U;Džhvl=XhEEPEPtURxUEH;K)Efљu DžDD dMąɉME]u[}ȋũ~FDžDudљu뉍vd)MĺEe[^_jtvtJAG?u)[^_ÐUWVS u R%@t#>FwڡD4%@u݉<-U+EJ}}Mu10DEE1"Ewl1ҸuщEC< w4v;E}9Uxw;}wrtlE}NJFC< vύC<w`7;E|ǃ}<M tUҋEtFU e[^_Ív9~EF딉C<wW[0 FwڡD4%@u݉<-Y+EN}}Mu10DEE1"Ewp}-1uщEC< w2;E}9Uxw;}wrtlE}NJFC< vύC<w`7;E|ǃ}.M tUҋEtFU e[^_Ív9~EF딉C<wW[0  Be[^_Ð#PG6gt1ҋ #11DžDž)ÁHN%)؋<PSWM E MA Dž19s@u6fGft-Љ)@9!ׅtՋt F9ru7 Pu+z JzhjVpDž1t[{t=Ft=t܋PSR uE t뵃 5@ XZju@ XjUjuÐU|t ‰ÍvjjEPh|jEPEEE @t|UWVS $ɋuuVvV >FZv 24$ $u2 V}e[^_v F P뙍v ^ S$l V̼}e[^_ZUWVS UEEMEtF}E9v1+uWVU ~]vFAKu+};}wϋEEMue[^_UWVS\}e] 1EEh] ] CPEȋMȃɸnUE} EĉUuuU Mȃuȉʃ3E EEȉEEE9Mĉ΋EȃU9ЉM̉uEEEu+EEċM9uMEЉEtEEE+EEĉE̋E9Es U9jU9UlMM܋ũ9MrM̋U uM9u_Eȋ}ĉEċE EE}ȃU9M9M u芺1e[^_ËU܊BU܈MG9sU܊BU܈MG9rlM9M]U9Uv+m]SuU;EV]؋M9Mw׋u؋UE9UԉE=]vU9UrM܋mMuu9uE9EuuUlUM̉Uԋu܉MEEu4u;u\VuU;EFE}uEEESuU;EeU;]rڋ]+]9ދEU9ЉEvE)1uESuU;E]؋E9ErEEu9uUt3UMЃ9ʉUrM̋U u9uMuFuEG9ZuFuEG9rBM܋EЋuMԉEEE PE )EuEuE2XEZ+EċUȍDuĉEMPMVUUE9UċEȍHME;]EU+EEȃEE~E FAJu+uU9GM벍vUBUG9rM܊AM܈GMIM܊AM܈GMu3SuU;E]UPWU;Eu }E;}rփ}"};}s`W+]SU;Et;U+EEȃEE~ًUFAJu+M9r};}rE~+MUFAJu+M9r;}U+EEȉE1};uEFM$vM މMEtNM܋9MrumuumuuvU܊BU܈G9rMAMGMMAMGMukEW+EPUUE Eu uPVuQbEăECk;D$T$@BtX8 uT@BtL8 uH@Bt@8 u<@Bt48 u0@Bt(8 u$@Bt8 u@Bt8 u @Bt8 t)ÐUVS ju"Ã۸tL$u^V$JABKFC FCV$tXV$F$C$u Ce[^Ð F Pv F P|둍vUVSuF$U  9St ue[^ÅtF9Ct\C jRP6WC FFKu:C]e[^?v VotԋC9F|ʋC ;FuCBUVSuF$tv ؋PuF$e[^UWVS M9} ]uUt [^_ vyt(t >1t:AwZ$`gt >t@gf1 [^_c,  {i UWVS u~V9|YFu1FFtNN uffAft]؋F)@9PFtyuFuȍe[^_ÉuFuFPvv 69ljF~V됍e[^1_ÉUVS$ҋut* ^ S¶4$2$e[^à Ve[^ÐUWVS ]OEE5$tu C PER$tH} uNuYUۉuOE1e[^_É S[tH} tt U ExUWVS ҋ}EPu Kƃ1tfPjjW1Ã1xPڃt E9ue1t/fr Eu/fzRB$PB,dB(xB Ѝe[^_ÉủfB W1ȐUuu jujhÐUVS$ҋ]u&CHCx30@$u:e[^Ð SCHCyΐ Sơ$tǐ Se[^ÐUVSUBrtC~wt\[1^Ívau<+u11ۊ<+tC=C<CCCBCAC@1҉DGDDDFDEDEDFDDDGSVSVB~jjjW!Ѓ@tWRhVWɵtB1=t NF<8t jjsP8Sz t˸e[^_Íe[^1_3O(,ϐUWVS4jP21u-t1ۃ~8u=C9t P謴 V1e[^_Ív PߤC9믃 0H 4誤H@uσ 艤188,8eUWVSjpÉtMKjPEt11K} B9|1e[^_z0Yl0܍vUWVS<} Huhj/Ã1ǃDžt 8Džt:PuWV@Wjj裯Et MAuh PhS謲$'&C%C$CC #C"C!C CCCC C C C C C CCCCCCCCCCCCC CC C CC C C CCC C C!C"C#C$C$C%C&C'C(C(C)C*C+C,C,C-C.C/C0C0C1C2C3C4C4C5C6C7C8C8C9C:C;CC?C@C@CACBCC1ҍDDADDADEADFDGfSfGSSB~Ou-;au%CHwj hg ;C@t 誮 S81e[^_DžC8CC C CCCC4h RhjCDP1P(PV,1҅҉}tUB hSV+10t t 4ǃ$j$؝X@4@@ @ @T@@de[^_ÃEPV^A83EP=t7Z1^HQPl/8CH{4@ PW%@DDDHK C$j PAQSdyOD?K0K(C,K@C<{ PR$9S}S1xb1P8 P$C=C K{(ωǃ1[C K DD|C 88UVuStFk V؍e[^ÍvUSQU ҋEu`tX41҅u Ћ]ÉPjjS'u otЋ]Ívǃ01҉Ћ]эvUS u]u #C,9C(}#C0]ÍvUWVS,EUp E@EԋUUjj PRuPu#Etp]]{K}ȉ}EE9E؉E}.UfZfvG);u-EEE9E|ҋEHy]ce[^_Ívffwà uuuuu EFEEEPufjuPu"EPUȉU M܃EE]s E0vjuUPuD"EHMȉM]܃EE}w EE̋M9ɋuЉ}}7}>SuuuE`1ҍe[^_u uuuKuMa1Ӌ}g_UbN]c=E@EȋUfDPfvrEȋ] }؋UzTz)ЉC\MMVuuuIuu uuu虊Ma ju Ruuݘ }gvUVSUEҋu MXtu#t8M u҉[^Bǃ,-[^ǃ,vUSPEXEM UuU MY1[ǃ,Z[USSE}U Xw@tUE Yغ[ǃ,Z[cǃ,UWVS UEҋXtt $xmth1ɋ 2H(f|QtjHǃ(fyuTjPQPS u̺e[^_ǃ$ǃ(ǃ uf9uǃ $f9Uf(f|q qBU fqDq)ЋU B DqBUTqq)ЋUBf99syǃ $ǃ(1ҍe[^_Ë$S(9r7jjVS Hf9uyFǃ(S(9s9h$~1҉(떋C > juu PS 1eEǃ,lS(딺ǃ$XvUWVSu~(GV0!~(UNU9;F9~~jvǿUtLF( @P‹F 9} DDDDV F,9sF0 F,PWuVe[^_Ív PME藒útPuS E +EPM jRXmEFUWVS u1ۅHHuXt[=wtIt.C>t Pz SΑ1e[^_ÐTDžT\u`Dž\u Dž`d.Džd h$CtRh$jPǃdǃ\`ǃ$$ސƉC1 󫁻t ^FH.FIF %F &F=F8F@-EfE NePuu uOPjjМ@5EPԚUE XH  ǃǃ XLXyt!DL9sL‹T:11ҍGTf3fǃQj虶+ Wjj3GQjP35E t @E@t E P觎vHDž\DžLDžHDždDžTDž`DžX==& e } E1 Phgh(P80<$ (RWjn( $t (PPj(Rj3Gv E=-DžXXHDžX9 VfX} PjhPĜhb1 h$'h&i%j$kl #l"m!n oppqrsttuvwxxyz{||}~hb1u l]O/XShx*h'P48 R3Ҷ Q3谶 @@f@fGG tft Rj3f j  hD ǃɷp=|_rX txUSPEXCu u&]ÉPjs3藱C]ÐUWVS EXCEPEPu Se}ƃt}uQj63 e[^_ÍvRjPujjVSp !@u.Ce[^_ÍvPjs3˰CbPj63谰yUUUUPUPUPPUUPUHQUQUQPUUPUHQUQUQP UUP UH QUQUQPUUPUHQUQUQPUUPHEAEAEAÍvUWVSDE ME EEEAEAEAAEEAEAEAEAAEEAEA EA EA A EEA EA EAEAfAfEEAEAfAfEEAEAQ A'tD[^_ÉAD[^_ft1fDyfEʊEˈDyEʈDyDyEĊELjEƈBEňBEĈBEEÈEˆBEBEBBt;EEEBEBEBEEEBEBEBtAEEEBEBEBEEEBEBEBvGfNf}1ۉfDYfEފE߈DYEވDYDYE؊EۈEڈBEوBE؈BEԊGGBGBEԈBt1gK94;XtE{/E6Et+hV={EPV1҃8IvEPV1҅/&E%=@Uj1jEUu1҉UvUj1jEUu1҉UjjUEtUUu jUEtUÐUWVSjdhP@3 jjhhpxPjttPS$诊Dž\dRVd UUW@UdWt:V\G*hGGVdҊDD9D\\yDž`vWrWdL8VӉ$VDdD:$L`yZ e[^_ËěU҉u(1D@=~BěÐU țtÉ*țÉU$u1$uÍv hCÉ h~뽉UWVSEEE E$!Tp1FȢšƠ؈E}EEEGššš~$ue[^_Ee[^_z~ h=~_UWVS $iBҊššššȊšššššҊšš NJššȈšš ǠȊšӈۢššЈšš ǡ$u"e[^_à h}v h}e[^_ÐUM1@9rÐUE 1҅SMtXw $,hv[ÉAAAAAAAKtA닐UWVSE}EESEXtU 9S t1ۋEuEt5CBCCCe[^_ÉfEu^& ju1҅tj w {uF vU V FU4MqFFF0҉ju1}Pu rW0_ E ]MEU OE I!MOꋇUMÃEEu0E|VPVF Vfft fDBfE6ۉ]؃t<_KF O!Ë00Eu  u~EX@]KoE;C bSfft fDBfEރujCBCBCXCKC C{e[^1_H jjs sW_ x1vF jQv vW_ 1҅^ Vr1US]C E HK}R[ÍvUWVS }1҅t[Í9tMK uCtUtCuTE t9Cu6SPS S8r9u1ҍe[^_Ív뜃 Pr뼉 jPs sW^ t뼐UE SP]QP QPBP@@ @[UWVS\ExG }r!}te[^_ÐEE UZpf99w99]PSu W@tEEEVjSPLM A EjEPEP1E؃ME Uu܋Zf9vS]SuW脁@EȉEEQjSP֕MA EjEPEP軕EMEU r]f}TMSQu WbdEEEUfR}fUvuEELUBM A EEfXfHE)9VFf;EEUAfBf+]fZMf\JӋU BMAEPr2CS褔 U MZq1S荔G(tuU9Gcu"MYAH9EPRju7} N e[^1҉_ÍvPjw7ӖGG(   MMQuu W@Sju7xvQuuuuu uWwV EPj7$fGfO UBU B Ss)9r4\Cu fuwPVu W3|LJVjS7譕1ErLʉMMRjP7|R+EPUMQPRP膒EfXfHUJ!f}LJfLJRjw7EKfOfM6fGf;E@fGLJfEfPMAP0W\CFH9wPVu WztKfG @fG f1ELJzotfLJfG 븐UVSƋBu@Cu 1e[^RjP6ŕɸtCAPjQ6趓ȐRjP6蕕ɸtCAPjQ6膓두UWVSǍ@,UE;EXۉQjp7/tWf[f]UDP0CuJFH>DuVWjse[^_ÉC PWg|@uQjV7貒f^Ãf+UfJtfAf;EsEffJuf^CfFPjV7mU:t6UX1ۅt luW躏tSjR7!1@ EF)RSPEP/UfVEfDFfENfUJf!ff;EsEffFfFF )UWVSUB(tMUDQCCUp B)WSPPvMfqEUf|AJMftff9sfJfuUfZÃf+UfJtfAf9sffJuMfYCUfBMA(tu 9A1ҍe[^_Ë؃ Pu5z@ҋM9BB;Eփ} fE  uTEUBH;EMuUBrMAH;EEUMUfMtMNTC Pumy@ CGfQ;EB1fAPjjjFPPEPus tMSQWE@uUfEuNEEfFEHfEPEPWMuMpuNARjPE0ҐhEUPRWufE"uNPjSM1衎^RjPM1{E@HfEPEPWutuCN룋EfEPjjjSSURuMr EQjSU2PjSE0UWVSEȋU䋚;]uMȃ}u#Mȃ}fEE䋘EDF|0;U䋂f@PjV2̉ jWE0謋u9PjWU2I}  Rj0U2k1҃}EPjVU22 juЋE0U;OPjVE0 jU2E0ԊE\AfM֋U䋂U䋂fUfPE䋘jU;tPjVE0} UREPuTU09GE,EċV҉U0WjVE0(EOXۉVjpU2yfCfQjVE0ӇEȋU䋂;EujEDF|0RjVE0衇 jWU2聉@HfE֋U䋂8fUfPE䃀Mȃ}uPjVU2< jűE0U9HfE֋U䋂USD$L$ 8t@u1[ÐUSQӋRuC1]ÃSPjCC]ÍvUWVS׉} EUEt: }tJ}uȃNt ȃNu w7A0NG[^_ÉȃN0u] t<0tN0ӍvEgfffU܉E؋}܉)ׅtU܉E؋}܉ؙ)׍)‰N0}EtE;Eut ~NUUEB<U끉1u0̈WNETvUWVS UUU:?@9~ÃtAPuLtO v@9|E0Ue[^_à Pr\tPj VugWvUWVSLÉU1UȉUEEEvUG~uA}U;}UvwX$LhCt%utCECBZ$hUEEP TUG;}~tE9t R~[e[^_ËU܋UR  P@[U9EEEU뚋U MEE;EU9U~EEUEBUE-MElE;E%U9U~EEUEBUMEE;EU9U~EEUEBU}MEE;EU9U~EEUEBU `Dž(k Dž(kUȋEU$UȋEyM$\ȃO u%  PIA((Dž(`  P! IA' P IA P PK IA (jj 0(OB X$(CE@EЃ$EQUȋExU$0$|CE@EЃ$E u t1$ BE@EЃ$E Dۅ~n~8$|@$E@EE)ȋ$|YE@]Ѓ$E DL+(;~~-$(qE@uЃ$Ew)Å~4$|BE@E$Ex̋$|X$E@]ЃEUȋEU$UȋExU$UȋETM$gUȋE0M$1EE HPqEEHEEL9(v(u #$ CE@EЃ$EUȋETU$Dž jj VSJ0Ot<t;jj VSσу ÉuPIA \PIA \-eEA0FPSIA \A@ ODžB<VhhXSd SP7IAP(SR PPVRȉƒ EE1ɉP[CLU؉MPLPHPDPQR6( @q @PI[CgEEU @P[CYw 0P&I 1 @;P[C @UPC[C LEE z1(эq@P{IAEE[,$UȋEE$h`Dž(k Dž(kƅ3JEEHEEH EEHEEEEHEEfEEEE0F,1HEEPҋv((,ƅWƅWxDžjƅ pEE%ƅ9- PIA} PIAEEHC PIA EE HX XPqI PIA"UȋE7E$ PIA! P^I PI닋EEDžzL)Љ$|YE@]Ѓ$E (8UȋEH]$UȋE']$9)Éu4Phh`S7wSj4Pj;ƃ1(jj VS0(ADžjj cwOÉP[CEE1EEP[CaEEOP[CPIA~EE EEEE1Pi[C|EE1EE1  PPPE P1EE)DžTEEEE EE7UȋED]$fEEEEEEAEEEE. B @PIAfUȋET]$UȋE+E$EЅuE1UȋEt vPt4IAMEE$EEΉ(эBf1 (tBЋ(ӍBЃ v$Pth[CPtP PPE H,녋EE뚋PҋtEv((, MfI @UfJ @ PPPE iPuEE념UVS$uu'Puu Vá$u4e[^Ív VjPuu Vá$t͐ Vcke[^ÐUEPuuu ukEUÐUEt Puju uà Puju uUEMU tEU M `EU M UEX ܎1ÐUÉUU 1ҋMt}tt1:ÍvUMɋU tw 腃VɸUWVS u]Mt9IE 1tKtBt@IGuM e[^_PSjE 0aƒ҉tߋM +e[^_ËE ÉUWVS u]MtAIU 1t%KtwQFtYIGuߍvU  [^_ËU ۉttwKu [^)_jV븋E 뫐UVS@1ftK4fJu[^ÐUSjR0ItH RjP3G1҉Ћ]ÐUWVS EfӋ}fCfCG 4tmGFfCfCfC4E @ tK@U FC QjC SfCE0Ge[^1_É듍vE 봉UWVS Efփ fFfF0ECF U B< fFf)fFfF0U P7G PCS}CGu,F SjF fFVE0 F1ҍe[^_ËW E9@uvE H fFf)WRfFfF0QSCU C_JvUWVSLEUEEffEҋUffMffEfMfEfE]Cf9EfEEf9E[UB UHMEDA4 ~Ef9EwEDU9EUH9Uf9Ut+MfEfAf)fDQfARSVPAfEDUf9fEr t}tEMfEf9M"]UfCDPfCUBtM]9CEf9EUfEU܋Uf9UfEE֋M|Af]f9]UB HM4 fE֋M fAUf)fDQfARSVP@]fEf9]rU ]fBMf9]ҍHU fBE܍e[^_É MEDA41.toM4Bv]4FX )fEfE]1]EDC4FX U4M MfE֋]f)nUEDB41wfBE܍e[^_fJf;MrAfJf;MsUMAFfM] ]Cf+MfJUWVSǍEUPW?EPW?tmEEFCfCCFfFfCfFUB C F uuSVUU2U e[^_Íe[^1_ÉUWVSEEPu?ƃ1MfFU싂fFGFFG F GuEG9 ECGCfCU싂fCG C Gt2QjP2BEUBQjRE0~@uuVSEE USW=9]tG SE8U 2Ee[^_ÐOfFUfE8U 2e[^_Ív}봃 S1SjVU2?1UWVSLE fEE 8}]SURMQEPU E6ƃvfFf)UfDVfFU 0UBGM Pr2CSy< EXw7Se<U :U,Uu >WMQEPURU EEMA zH1fFUf)fDVfFEDF0PWuS;UCUE 8u-U uu‹E@xPjuċM17> juE0%>U;EXۉMUMĉUVjpM1?fSBfUMA wH"UBЉE̋8 f^V)ʍG9nAfUf9CfFMEA fFf)UfDVfFEDF0EuMȋUMȊAWECuPEȃ PS%:Eȃ@ZP E@HPjuċU2< juM1<WGM Pw7CS9U :]M uuU Ew@/PjuE0A< juU2/<XMqWje[^_Ét zb^fEfDF0UBCfFUf)fDVfFEDFM0ACUWjVE0s;PjuM1`; juE0N;e[^1_ËMAȉEȋ8E tkE@ub^ufvUUBDЋ U܉E؋UȋEԉЃ EЍEPEPщE 9s EuuU EBv)VQPBPR7f^WMQEPURE-\EPT`fEftTDF0EUċCfFUf)fDVfFEDF0EMCIEPTSURMQEPU Euu1+>UWVS ] SRPEUEM1E  E8pPjSM19Epf@fuTG]9tPjWE08PjwU2:U@fBHMfAPQuuuNU9_MfAfmMQ A9t;MQMQ1e[^_Ë9tQjWE088UrՋYRjQU28۸tPjSM19ǃtEf@8|M9t wPjSE07\USS]Cu!U C(SUfSC(]Ív P/C CU C(SUfSC(]UWVSEpF]u_ w"$kvF( w-$kSqe[^_ÉUfEv1t(؍e[^_ÉPjv66F눍vPEPE0V jPuPu EPV !@JEF늍~GEPEVPX4v@B %B\PjR66PjS67u2@)B 7DB\PjR65PjS67uE t P!oPjv6D7ɸ`t0 fEމMfE@Wju653GfGf}A9uYPjQ64۸PjS66ɸfEovPjR64UBHfEGt)GMfGfEqEPEPU fff}t fMYPjQ64۸,WjS65ɸAHfEUWVSEU,JMQjSE05UBfE@ft8fMf4Efp Ruu P~FfuKfuG fuffEUfpDG\8PjW22QjSE04@1e[^_G tUEM  u#f}u GGU9t"MEfUfP MAe[^_ËGtVjwM1F4EtfEESPu uQjWE02EUMAQ EAPjw13EB@HfEPEPu u(u1PjWE01EURjuU21PjuU2|1UWVS|E ]U %=EE@u#UQju hv+e[^_ÉcEEPEPu ut?U E%EE]E% ?EmE]lE} (l8lM0lfE fEEmUmEE@tM}Ew#UmEEuJUE+]O E}EUEUU} vE1ۃ}Ã}~m1ۃ}EE$@lE'}ut@Sju hle%E 3EUVju h l%EE UUUU u)}EE~ }tE} ]EEUM ߉mtt EB nEuUEt2Eu'E~ E \ɋEEMUBR $l]؋Em@Q% lEEEEU EEE]]ME}uUm}fEִ EfE?J]MB0EEA@MLM9MK \E]Em]m֋UR $ɃEUt뗋MɋuEEt,U3EE EEjG5E~E~U9U~uM)M))MEȅ~8Euub6E[_uP 5Yu2] j4U҉E~uP 6E1ۃ}~Et }EE@EEt +EE}mUUU}̅~uu7EM~uu6EUEJEE~Vu6EEۉEEiUEĈMB9MUQjj uS2EE9EePjj u42 Ejj u"2EEuu/&0EY[uu7XZuu97Ë@  S0u}tEu E|"}EUBuz~N}~EtA}~3jub5E^_uPP69Eă}:EMĈ@EvPjj u1EE]Euu%0EĈUBuz~kM9M|}T}t&ju4E[^uP5ME89uU9U%MM99tEE u/Mt+UtM9Mt ui/ u[/ uM/EE@UE tEM Ee[^_ÐSu4ƃ Rjj P/EEk]E荈2 M~^@+M⍈E ‰1RP,$]mm3E}REMMM> +MU몃}+EM)MىME߉}Euu1EVuu3MPjj u.EEEEU Bt/M)MFu EMU:0tBUE6M)M@EEEHɉMMEEEEEE5n]-ً})KU}4ոmfEeش \]EfE6EEU9U.]UmUm֋UR$$B0U]EEBEUuك}~]t}EUE@MU:9uM9MME89tEEE]E ODEE4듃}t }Ex9jjuQ,EPuJ1~M1EAM؋U҉U}REE| lEt뭃 p*UJlj֍  ^_jP/E E}ŸmfEMش K\]EfEEEUmUm֋UR$$E@]uEEB0UEB9EUuEEEEtEMU:0tBUutqى m]t^tEnMB]Eދ]g}9uWU9BUE<0EEE1@EEBEċM@AMEU0X}9tEEPjj u)E)UWVS0EpXuEUM؉]܋}E%->@EȋE؉EЋE܉EVSQw $Xl&vEuWuu EPEPuh ?t:e[^_ÉEÍvE뷍vE뫍vE럍ve[^_ÐUSzÍJt @[19t I<u9u[UWVS ƉӋ}t&~t;v [^_Hu<uD uډ{tӋE ˍvtUWVS4U] EUU EUEډEEMSQw$l%EUEU E le[^_EUEU Ele[^_j%-UMuEEE}E uU܉ÍL@ I9rS99vI99w%U} U<E EtU  UI9se[^_É%ƒ I9wyuЉ]E 0m]Ћ}ԉ%u-EUEU Eve[^_ E{ ?vME|ME|tuPRUWVS@m}MM]EUu ۉE؉U܋}QRP}mw$l8#؋MPju$h lEe[^_؋EWju$hlE%-@Uuf} VÍT0@J9rK99v E؉EJ9щE9wE܃ <;u$;tM$ MJ9se[^_ 0m}E%-B-؋MPju$hv9rE܃EJ9ډEwZ{iO|;KO|;t>uEPR.VWt$ |$L$)9rу_^ʃON_^ÐUP}E 8mÐUUuÁuÍvUSM ÁUu% Ѓ[Áu% Ѓ[ÍvUMEMEEU UuE EÍvUUu UÐUWVS E }@DButaCE ;Fv+jPRFP3C P6CGM1҅CU uE!@!C@U;Bv,PRt7UC@BPs؃ PM1CUBM1ҍe[^_ËE!@ GC F FPVGPC Pu uvE PEuPC Pu tUMcv Pk P[CUBC +vUWVS Ef@fuuJuJ toDBBt? ҍ}tC PPGPRV u*EB E}EWu Íe[^_ÐUWVSEM qx9v ]8]]u@AJu[)^_U[^)‰_UWVSVMQUE x;}vU 8uCAFJu9}E[[^_[[^_ÐUWVS} u]jWEPZ jGPEPHUE9s'RP--txEEU;BvE]9vPSFPW jVU2E)؃Et>F߉ERjuE0iue[^_à Rbe[^1҉_ÍvUWVSUE MEUx&UBPjRM1)twMM]MQutqECCC fCfCu9vPVuCPEwU)uQjSE0ve[^1_Íe[^_UVSu] jSEPv jSEPd ju6ƒҸtFB uSPju6t$)]BERVW9]w1e[^Íe[^PjR6ސUWVSUEσ} x 1҃$XmvM 1]9ʉM@;U| PtEHtU 9v) v2J tt BAt)à ] t]}SEEPua PU Pju$hvJe[^_ÉE Sju$hl׉] Vju$h l뿃EPu!]E% ?EUlELM (lQ8l $0lɍ]5~VHm $}fEִ fEEmUmu1EE@t$MPSE})E؍DEC}w#]mEEuK]E)ʉNEEuEUEUU} vE}~m0ۃ}Ew(E$lmEE UUUU uD |EEP J҉Ut:xt +EE}VNEC}9EݕhhlMEt7Eu.~*E ɋU \UEUɺR $l]؋Um@G % lEEEEE Eua]U҉UE uMUtE9Et u uy؋|U]uEMx }ẺEEuEEtE}uN9u_E)ƋU҉UE EEj EE~E~E]9~؉E)E)E)E}ȅ~K]\~1VuEZYtPXtx]E)( j}E~uPE1ۃ}]uUB҉Ut )ЉEEEEEEM̅~uuEU~uuEEEy}u~uuhEEۉEE S_uEuMu E uEuMv~ }UEMB9MUOPjj u]9]EVjj u Ejj uEEuu 0E^_uujY[uuP ҉ÿPu:ǃEMm?}fEִ EEfEE;E@E \m]m֋UR $MɍB0]EEA@Mu؃ uUE@M E$t]$UE |e[^_EEUUBEEUnEbPmMm]m֋EЃEEEE-Wjj SEEQtBEESjj uEE]Euu0EE9E|ËM}UBME M99u|9]ZME89tEEM9M)MىMEމuEًE؃}EME U:9u|9MM];9tEEuu}MPjj uZEEEEM At$U)(utE}}EQjjuEPu(|E 1EAM}UB@;EEE|+uuu1E]{}Eu,$EWjj u8E[^uPN0EuuAUEBUPjj uM9MuE뗃juE^_uPbERUBHEM];0tC]C~:juqEZYuP_E}:E ]{WEUEBUPuEUE@u $E5}EE9 lEvR2 p UJlj֍  ZYjP^E}9M9AME+EE])‹K@9})ύGE=@M)щMEE |E1C]9E}:E qE]@E C]EKU}4ոmfEeش \]EfE0E6E@;EE]mUm֋UR$$B0U]EEBEUuE@:MY1%؋U}ոmfEMش ]EfE.R$$]B0UEB;EUt$\@MEUmUm֋UЅuEKEE1EMU:0tBU$E|0p}9EE MA1C]uEkYPjj u EDE@USPM1ۃv BC9v S ]ÍvUVS u]u ƒCBCute[^ÍvUEHPJBU UWVSE逋EHEPRUBtMfQ RWuPM)y9uRVuPE)p0)u[ u 6E9RVuPE0$ RVuPaM1 $ USQM I]wʸ Z1[%Z[ÍvUSPM I]wʸ![1[%[[ÍvUU1@~1ÍvUU1@~1ÍvUSQM Iw˸UZ[&%Z[ÐUVSuu Vt e[^Ét VGe[^ÐUj$=u uUWVS ǡ$yhۉK~x$ h$;5h $ S}$hKʋDGD GDG DAC$u e[^1_à h@ 䐃 h@ h9e[^_Ð h@;5h(Chމh h@Wv h@o h@*hۉw` dhUEEEEEEÐUEEE EEEEEÍvUWVS $5hv~O vOxrD3tUt U9T3uE؋D3 E܋D3ED3ED3$uLE؃t\H$t h@Oyv6j$uCe[^_à h@E؃u uU܃띃 h@ h@e[^_UhW|$D$ L$uG_Ð1_ÐUSR]fS ¨uHK0tC@9t QQfS C0CC]Ct=¨u1ҨuSS1]ÍvC؉C1Ck SfS 뱉CfS _ ]ÐUWVSl]fSfҋu }xaEPP=xJU1 Eȅt:CLte[^_É{(xuf̉UVS]C tCCCCe[^ÐEQPEPS1Zu¼tJCECE΀u f s e[^à CP tf s fK tUWǍ@VS)PAEU1t\]G4ËExX3vPjXhS s8hhV XƔOy͋Ee[^_ÉUSS$uY u1ت”XHyu]à h]à h$UVS$`^F f{ tLXHy6u$ 1$05^fC $C8CCCCCfCC0C4CDCH@C8VhjP؍e[^à hb hZ h hr USQn+d~J`t+P~9u~/Lt"$u2$u]à h]à hUh[ÐUWVS }G 1Ҩt6wt/)7uWWPSVWS ~)ƅ1҉e[^_fO @UUt+B uz ɸÐ RkÉE'[vUVS]tt $uZC t" S-$҉u$e[^Ð $Ҿt܃ See[^Ð S똉Ee[^ZUVS$uu# Vá$u0e[^Ív V3 Vwá$tѐ Ve[^ÐUVSu跾ËF89Xt) PQF8XF8@ e[^Ív@ e[^ÉUvUWVS u[ËF819Xt? P te[^_ÐF8XF8@ e[^_É@ e[^_ÍvUSQ]S89BtX[ÍvB ~HB X[B C8@C8EZ[钼UWVSQE9UÉ}/+uECMDC ‹EfC@9E|ڋUSMfSX[^_UWVSMU EE]u u41ҋ EEEtMqEUe[^_9vE؉EEȉuEEEE]fEڋEfE܋EMfEދEUUfEEfM̅ҋMfEfUfEfMEuM}-EUfztEM)MEfxEMUfztuփ vMfqNy+EUBUEMfIفfVwGEvE~3UUuEUEuJ_XEf@fVVEpMIEtPPffXfVPf9XfQfqX 1ptȉlj 9%pOwt 9wڋu1ۅ~RM@EHMq))ډӋ@UfB)N؅Pf fXX)؉ËPftDO1ۋu/UM ADU rDӋMfAN͋PfUMfe^_ÍvQVht,vPVht,ۍvU E EEPhvtuÐUE Phwt@uxUÉUE@(ÐUE@$ÐUEU P(1UEU P$1UE UB(B$1ÐUEP `` a_P@ @!USjh{t ]SEE+@t0 EPjjjjjhzt S1҃JЋ]ÐU jh^t uӹÐUE t&~t;ɸÐHuEEPEPhtu胹ÐEvUVS@] uty#K?e[^Ív߃EPVr@t1D(EtPjEPV@te[1҉^ÐPjhnt Vڸe[‰^Pjhot U uuu jujhÐUUҸvoxoÉUWVS,}uȅt)?t$}1IMEK9E]01IK+C)CPVje[^_ÐUÍvUhy1UhyÐU帲yÉUM tvÉUhy1Uhy1Uhyt1UEy`UÐU1ÐUÍvUÍvUÐ;vk̀rÐ'vj̀rÐvÒrÐvF̀rÐv̀rÐשv̀rÐév̀rÐ鯩v̀rÐ雩v̀rÐ釩v̀rÐsv̀rÐ_vx̀rÐKvỲrÐ7vK̀rÐ#v+̀rÐv̀rÐv̀rÐv̀rÐUWVS MUA u29r}G;G}(UD@BEe[^_@Ee[^_ËG @P;urUBM +AU9։U>M‹M<%EUfFf>;urEtMA;AtMD@AEe[^_ËA @P E EH} ƍ  $ӺU UB뢐UÍvUWVSDEX$S4CLUE} CXjPK(S,KXS\ΉЃ -@BA‰΁?BS\ɉsXM؋C\ȉE܋K4ɍUCȉEC HȉEEEEPjjREP1 HE؋U܉CLC4SPECDECT[GjWPXuWQ 1҅uWe[^_jjREPM1H{h{jge[^1҉_ËC0CHCTrGjWPts@ uWM 1҅e[^_ËUẼE̋WPWR1҅F]ȍUȋGRWP1҅(UB EăEċWPWR1҅E UGRWP1҅OUWVS,E M1҃x Y$t e[^_ËPEЃEԋBjjEEPAP/H7EЍU@E؍sXEԹȉ׉Eu*EC0C4뒃h({j%f1|hT{jUWVS}_$Cs4u_GW{hC`Sd1}щMC`WPEPs-xrC`SdV FFe[^_É hPlPs$pC(P sChx{jTeUh{j=ee[^1_ÍvUVSu^$ 3_XsVC$u0hu>luL S/ue[^ Phtĉ Plt P Sׇue[^ƇUWVS} j(j@shtj$w@@$ǀhǀlǀp@(@,Q7w@hP$ugt VtHQC2C$hl SƆe[^1_Ð1уKAQj%}1эAC XZQj҉C@8E}1QjDz‰C$}1PQuRCC@WPPRC @PusECMrMQVFF $0(u2(","08%4%8&F (^$jVǃpe[^_Ívh{ja Pl P v Pτv P軄v P规vEt}MpC h!g h!"$ FPq'h |hP|j`UChP|vUWVS$uSV t=1щjuuu PVe[^_SVht|jJ`e[^1_UWVS ]td1҈߹щM5ыEL 1ҁv e[^_Ð Su Vh|uKe[^_à EPd1҅u]낉UWVS<uE 1ʋ} щ)ҋL1ҁv e[^_Ð Vu Sh|u蓪e[^_à P詫1҅uXhW} DUSS]菐uQjjS]ÍvRjPSb]ÐUVS] SuVA1҅ttHtH1ҍve[^ÍvPhCPVC1҅tQjCPV~A1҅tRjCPjCPV`A1҃UVSu] PjSV?A1҅u e[^ÐPjCPVA1҅e[^U<ÐUVS0֍URURURURURMQh|P[ ~C1^T؍ @ ڃ~EE֋EEPjFPE։VFP1ҍe[^ÉUWVS ҉~-1Ӑ 47YYt7OZt7E Ku؍e[^_UWVSLUDžDžDžDžDžDžM EB]tu1e[^_Ë]1%,DžQ1t1ې 0"Ph|hP$._+$9_+$r&_+FQG t |1 v 2Ph|hP$^+$9{^+$)h^+FAG t |]DžDžDž1҉=Džq1I19ωvh)t3^uhr&t3]uG ;}ttRDž]tЃRQSSh|PWh|hP1 htX1e[^_ÉjjPjhV表 tDžDžDž@RhkjhjjW  DžjP t P螋t GWP jtjǤtA]3tm= ~@9Љ)9vًU Be[^_Ð1 hP5[z GWPXZQPRShh|QUh|]S 1Pjj:h(.j{<$c jV莆@.<!PjQDž 蓉U|Dž>J)!IDž-1҅n u61҅KDžDžjVjjSPq @ Huʰ PjjSPf$J y T8tDžPPjjRƃ F`[U@tÍv=v@Ív@ÐUWVD}fjhDEPj e^D_ÐU,EEEPURjEEE蘄xEt E@E‰ËEUEM t.~tOt91ÉHuQÉQ׍vƉUWVSjjjhP jjjZ"}jƅif1jIhhɉMEjEVjjjdZYPPjhEPSw tPFjjVPe[^_à S=$5Xt,$ jX\e[^_ÉDž`-M\v \QC XDt9XuCw Sx P+`s 98up\8}a h!{v h!'{`t} `0RXZ\L\B}hpEjQY $u1K h!z14#ˍvUWVS $DžE 5`t7 6luSvYKvu1p WjjjhVjN0 t6ut sSU $e[^_ËF EvrsERvvP;$E̅$`Dž tFUЉ]̉B p9ۋ P҉uȋ $ urEP]1EEEEEEB t$, $PSh1 $u؉CECWjjjhVjE؉E. [u$@ P萶/ h!gxe h!x` h!~x3 h!ixL1 jh@q Ujhh"}PוMDžtV& 8jp P<$PC1t P Cj pljC tACt:t6tKt%F GP[pGC @}]UM h!wU 0pXrpB _po^p oBuJ tlB B o d&1 Po 1EB`RvvP$t h!/vd8`CB`d$ h!u5`1ƋFu 6nXvnXF pnXv nFu*t4G`C` Vnm Psnȉ`CҍvUWVS\]ۋ}E1t-WS'Eu! FVP1e[^_ËEEȋE E̋Ef|Phfj ]S%]؋V55EPhnEPh0jV$FVPXumEe[^_É1v1dUVSP]E1thEE؅ۋE EtaEE }{Phfj ]Sg]V55EPhnEPh0jV$FVPEe[^ÉE }뛍vUWVSCÐ S?HddB tٺ $,ƉuƋd SD jjjxVغ jjjxÃ1xgƅyPjhh"}zW謐1I xQVS8xx S{e[^_à Sn{1e[^_UWVS]DžpDžtDžlDžhMEcEp 9*fEEUrr& h)H EPڋEvp$Cp1pPBhjRPp PEPj pRUE UEUrr&(EEpPEp0EPhmEPh;jp @vtEp $, VUE UȉEE }UEЋBpDžxapDž||VBWj RP]ԅpQBhjRPpBUr2xWh1uVh0j p0ox1tHsEpou(s Ur WuCU9B>[ulWh1$] pBSjRPXZSlqExt'pt pBRPDžpUvpEEԅt= }t PXhle[^_ÃWh1l#pUBEԅuE }pPBhjRPh||u!D|H|pPBWj RPpBUr2tRhLrVh0jp0v upPEPpR}w_|H|xlt lBu1pXr^_PpSpp BRPDžpv EPUEpvfEffEPpPEPjpR$ vUWVS u1t>u u ne[^_Ð h-Ͻe j‰6u STu0 Sq1tG55u hjjhjjWÍ@ v. GWP1e[^_1)uPGVj WP}uEPGVj WPG55u hjjhjjWÃ0|[*UVSEu EtWtD~1t0C55URhLrVh4jSCSPEe[^11ېUVSEE tq1tKj j谊tcC55Vh4U RhLrjS u CSPe[^É V]1C1e[^à CSP1!1ܐUWVS 1E`EpNXxf{ ~ SU ǃXNyEEuύe[^_ÐUWVS EE졼8 =p~3h:uH=te5lh:6,=tI1ۃ~ 5lu4 =tKC9Eththh8&e[^_uh.chԁj@9e[^_MV uuh.chj9e[^_ÉUVSȋ5) P[t[ҍpPR[t#DX1ҍe[^Ív''N5)һ'IPRw[C P0[dvUWVS   EfEUtx E@txUv\g-t!xf`};we[^_Ë tE ) C$`}9;rBL~Љ]UfPJ BJH?`}9~1?5)Ɖ5E)E `uPuLEfFJ B[1xv?t]x ?};5r BEfBBB( hx:`};EU~]P;r1u?~Љ]UfPJ BO h  hlpx x hhA멉tNA x]N?0zxA!x 1U AQ墔UWVSQ5 ;5 =EtEf U@9t4 :~֊`Uf U@9uUǣF;5hZ[^_UÉUM9tBt)PP ÐUUt0BBB@BBBB$;t^UWVS u] V1F Xt"$ u#CP葢~~e[^_ÉS[؍vU PhV85xc$襑UPSÉUWVS u }v|7t e[^1_Ív|7u(tHFC {{CCCCC C$SWe[^_ø;묐UWVS u F}EBt>1B9|D33uS(tCe[^_ø$붸׉UU1:@<uPRgÐUVS(u tVs FCtCuSe[^ÉPJCuSe[^øP$랉USP]tS5]h5ES5j]UWVStOu u |,V] ]5 f ] :~`f @9u5f EfE5 A5P1ۅu!E܅@$M܍@PD QAEU5v5H t  "9MϋEU죬)ЋM` t*1 9}@9}< u@9|w,$|h5|1e[^_ËE+HEU𠔼 A$u!A@$ Q9@59؉׉oA )Kp]Hp5j55ue[^_à 5-1E]P P%t = Pq]E1I9ME=wUD4룍e[^_Íe[^_Íe[^_Íe[^_Íe[^_Íe[^_Íe[^_ËM䋄4\ 5)K1҉]FGB;U|x$]X ~ ~ p*1APJ҉Pxy@ 4@U܈ F9 $t 54붸 p 5:뀋$@ @1ڊ"v 5B5Sj@EPC$B@ @ڊMh0j'2@XUF j M]B9Ⱦt;:~ 4`fЍ@9uf :55؋]Ef 5  5BE5U] 5C]u15@UPIÉUSP]t;tCu![[ΉY[CtvC[[륐U5u5h.ch`j%USP]t( CǃD!P]]Hv]ÍvUh$fh,NÐUSQ"Nt Ћ]Éh`fhNu u 1҉Ћ]à 5,MuhL!jt1҅tP5,TOt SH1룉UWVS,ƉmUzB j.V)J=U ,U ,!t'ʁw u .@uۀx.Pu VWdPhVkE ƀ-E .UE BU RǂBЃUBly@ :1e[^_É=j:V] ,t+ʁw u:t .@uրx.tyPu VWc WhVSjE ƀ-UE BE ǀ@@E BR1:E u uWVhhhPhj!01HtЍe[^_øPhPVlʉ/PPulaU菉yvUWVS EE} u]w@t] uE [^_z@u3 [^_UWVS }u ])w@u~z@tKw@ u] ue[^_SvSV?1҅uʍe[^_諈UWVS }}u ]v@t`t{9uuSVuhhhPh j;0He[^H_y@ue[^_Ãu?t|uOut,WlGaG V=K }6赥r襥/bG%r_KvUS ]u S ]]UuFUSP1҅tPCPSu1҅uډЋ]ÉUSP1҅t@PSu u>1҅uډЋ]USPz1҅t! @PSuu u 1҅uډЋ]ÉU=tPuUt P ÐUSP] ,!u*hhPQ,!E0!]Ð PGE0!]ÉUSQ],!t 0!t]Ív P[ǃ,!]ÐUWVS<Nj,!P,!hPvQ8#tЃh7PRth=S:tPSj+^FPSj^iMDž`踄e[^_ÃhhPP,! w뽍vDžȃIAGG W< t< uFv,,!Gh=VtC1򮋅+9ȉ$RPVcރ< < (;h=VetC1򮋅+9ȉ|AWPV^cʉKFO‚e[^1_ÃBZDž*肂vUVSu] p@% E[^USP1҅t@PS1҅uډЋ]ÍvUWVSE‹U‹Ux0Wj jFEu]F;Eutpu6t<^tu3ittu3Ju WB}e[^_no@ tF0F0XF F]UWVS$E‹U‹U‹U@PjEv jU=Eu(CE܋E9EuًC0E9}uŃ}t" ul}e[^_n@ tӃC0C0XC C뮐UWVS ljZn@ue[^_KVW?B:e[^_ÐUWVSMEDž\X} |t4~} te[^_Ã} uDžT DžTfGhUM fG,,!;|xwHzx )PRV|L N T4t;|$} } }EǠtǀUzM8pA8zhhDždDž`;| TލF ;|] VpM4$bM} l V=M؍|9Љ<lƉhh,;| `x )PRV|J `똋1PӁbPEPڋPM+ V9L} t`} tZ} ;} t7 WZYPu $ jþPuhj% <uE(;t hQV|I  WT;<Ftt1Ӂډˋx)9YMWRkUdtpeidtd~ } !EuU1}ˋx)98,uRjU؉h@ z1 hQV|H " WsI;<1ˋx)9WR jډXpvPxPuQ} } S}7qE9X  dM1ʉЃP;xkE;p\\#Dž@d89@DDžH1)fDƋfl#9htGfd9rċHfM@u~M9~@HdD9Hq@9@@;f}f}f9~)f}f}8DTOy@d렃} Xt-uh`j%<7܋x )PRV|D x] DEtH;<wdueUCt(1Ӂ``d4xڸ.xE(;tvttzppPSVRڀ<wډjԍ UVSutMt8@@ CPSVuU Eu Ѝe[^1@@ u1֐UWVS E‹U‹8@EE WG h0 hPujuY xk=v V0ڸe[^1_uWuu‰É4$0e[^_ÐEV Vv0ڸAt/t륉UWVS,Eƒ:‹‹@b@@SvPPhYVWƃKyShhPRT h`/{ hPj jPS o=j R‰ V/P P RW}@@tg3se[^_d@sډPGPGPGPh`PV `@ tVJBB ^ V.ڸ5O V-<_r'Z V-ڸy벍vUE`@tEuÉ/`HÉc@uÉU ``UWVSEuuo||1Ҹ6EP|07ajjuuE$,E4(x |{ut SUtC P~,CFfCfFCF@QPFPCP79}vbU 4|&{Gs |ntUtujWuaE Ue[^_Ðxu+tME x(Es OE4+u u+X|0ne[^_à VʐUE E EEvUWVSE}]t$Puu u:dd1xU15tM謍衍t V Et d:r1e[^_ÉEGEEEGEEEG ESEPhjw( eXjuo GMЀʀz dŌjjjd~!Ѓ@VE t65v  Gwv  hPda4UE  FFF F 8FxFhFPjj3S0P ЃtYRjQ3nQtt  e[^_Ë ƃ SjhjjSQ Pj뜉ʀ /vG8E   hdx` @  ujS@!"USPEXCu!u&]ÉPjs3;PCz]ÐUWVS EX{u/ $v  V  9RjFPSǺ K(s$uu VPS} E !@CUe[^_þq9s  mVSu)NU 0uCe[^_Ée[^_ÐQjs3NCC(Zs$FVC(s$Nt;jS@zPj73TNUUWVS Ep~Mu E uge[^_9s$  u߃SVu͐RjKSVM Ã۸t ujjSV !@u,Fe[^_ÐSjv6MFFPj36hMȐUWVSE9 1RPfbUMEUMMM 9M։:UPJ҉PE@t.NG$t UZuÃu҅jEPuu+ECU 9Us;ERMEUMMM 9M+1ҍe[^_à R# MvÃTEjPuur*_e[^_PVMPWqM 9MvE e[^_ÐUWVSEEUM 9ʉUE$vUPJ҉PE@t};]txuHM)օf PT"U40OF$p UKsÃuM)ƃEuut}jEPuu(u=CtbEM 9M1e[^_ÍvPRR_Ube[^_à MtÃdE 9EsU 듉UWVS}9s<RP^EU싇 E䋷;u sF;]vtCAJ;]ru:jEPVW'uMF;u r1ҍe[^_à R PPRPQojEPVWf'te[^_Á e[^_ÍvUWVSE EE;u s=9sLډ]C9s;Eu)ЉEjEPVu&u4CF;u rËEe[^1_ËE e[^_Íe[^_ÐUWVS M UDQCtCPuX1@U B3)ÃRSPPDM fqEU f|AJJftff9sfJfuE fXÃE )ȃfJtfAf9sffJuU fZCM fAE1ҍe[^_ÐUWVSjRPXt%R@PSVuQjS6F1ҍe[^_ÐPjS6Fe[^_ÐUVSEXCuuOtNtd賀e[^ÐE t9rJDuԁ Pjs3FC똍vC(tɸtS$JuK$믐UWVS<]{G} 0 ('jjj"rփ ƹG$EEEE!juVURSSu3vQvu,;F:jVEPSStЋu@w$tHjjjq!Ѓ@t(PRS|mu 1ɍe[^_Vjw7DG} vjS9e[^_ÐjW@띍vEEujVURSSvEE؋FERjEP'VB9ujVURSSt$UWVS u^CunjV@tE 1ugu"@ `mt V3@t e[^_ÐPjs3CCCv't n R*uUWVS ]ۋu}t'EC1҅U RTPC!@@;v2 Pt3@P3CPj?G1ҍe[^_Éur jtԉ‰džGC뮃 PPGPCPVq) uvjPa닃PRUUWVS E,UE쉂BE1EPjuU26C@ $@1 ;E wADCf9э4uUUEAfBUv}ur}jQjDC PjSE0@PjuU2BIz}8u"FDCPjSE0V@U;EtqptdRjpU2BtK}uFDC 맋EXE f)UfB Ee[^_DCVjSU2-z8e[^1_ÐUWVSf0ƋJf\Gf)Q2PF<fGUBf)à P2FP<֍؍DfWf7fDWf\We[^_ÉUWVSEEU EUErfщUfDFffE}UfDVNjEHf+};EttLFPE)ȍPSR<];]D^vffBfB;]$fJftffB9fB;]~ffDFUf|VfVGfDVEfEH8UJe[^1_Íve[^_|UfB $UWVS}G EtEu$U ffG fBG fBe[^1_ËEuEw<jO t1RPSBj!Ѓ@Vuu S%U fMu~u f>uuffG fFG fF[M G ..., where is one of: %s: %s not compiled in ۊRRRRRRRRRRRRRR5F%6d stdoutstdinusage: cat [-benstuv] [file ...] benstuvbb bb1bb1bXXusage: chmod [-fhv] [-R [-H | -L | -P]] mode file ... HLPRXfghorstuvwxthe -R and -h options may not be specified together.invalid file mode: %sfts_open: 0%o [%s] -> 0%o [%s]fts_readHLPRfinprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too longdirectory %s does not exist%s is not a directory%s: directory causes a cycle%s%s: name too long (not copied)chmod: %s%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).%s -> %s %sutimes: %schown: %schflags: %sunlink: %smknod: %smkfifo: %sreadlink: %ssymlink: %s%s not overwritten (y/n [n]) overwrite %s? %s%s -> %s %3d%% cp [-R [-H | -L | -P]] [-f | -i | -n] [-pv] source_file ... target_directoryusage: cp [-R [-H | -L | -P]] [-f | -i | -n] [-pv] source_file target_fileBtJP  OȦ9@@U@@S   Z        @p`" P)@007P<B 7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ0123456789fillcharibsifiseekoseeklcasenoerrornotruncoldasciioldebcdicoldibmosyncparevenparnoneparoddparsetsparseswabucaseunblockunable to allocate space for the argument "%s"no value specified for %sunknown operand %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsseek offsets cannot be larger than %jdneed exactly one fill charunknown conversion %s%s: illegal conversion combination%s: illegal numeric valueobs must be between 1 and %jdibs must be between 1 and %jdfiles must be between 1 and %jdcount cannot be negativecbs must be between 1 and %jd%s: short input record%s: seek error creating sparse file%s: end of device%s: short write on tape device%s: short write on character devicefiles is not supported for non-tape devicesinput bufferoutput buffertruncating %s%ju+%ju records in %ju+%ju records out %ju odd length swab %s %ju truncated %s %ju bytes transferred in %.6f secs (%.0f bytes/sec) iseek/skip%s: illegal offsetskip reached end of inputoseek/seek%s: write failureư>_ %6s SizeAvailUsedFilesystem%-*s %-*s %*s %*s Capacityifree %*s %*s %%iused Mounted on%-*s %*jd %*jd %*jd %5.0f%% %*jd %*jd %4.0f%% total %sufsBLOCKSIZE=512BLOCKSIZE=1gBLOCKSIZE=1k-l and -t are mutually exclusive.vfs.conflistsysctl(vfs.conflist)malloc failedBLOCKSIZE=1monly one -t option may be specifiedusage: df [-b | -g | -H | -h | -k | -m | -P] [-aciln] [-t type] [file | filesystem ...] abcgHhiklmnPt:%s stats possibly stale/tmp/df.XXXXXXstrdup failedmkdtemp("%s") failed-n(:%&)*+%-/*+-/:<=>:%&)*+-)/%&)*+-/<=>%&*)<=>/%&)*+-:/&|)+-<=>&)<=>&)+-|<=>&|)&|)<=>&)&)<=>|<=>|<=><=>|&)%&|*+-/|<=>:<=>||%&|*+|-/:<=>%*+-/||:<=>                       !"   B[aim3O (*6BNZfr~malloc() failed|&=<>+-*/%:()syntax errornon-numeric argumentdivision by zeroyacc stack overflowEXPR_COMPATusage: expr [-e] expression %jd unknown signal %s; valid signals: kill -signal_number pid ... kill -signal_name pid ... kill -l [exit_status]usage: kill [-s signal_name] pid ...-l-soption requires an argument -- sillegal signal number: %s--illegal process id: %s%%%%%%%%% %% link source_file target_file ln [-fhinsv] source_file ... target_dirusage: ln [-fhinsv] source_file [target_file]replace %s? not replaced %s %c> %s fhinsv$.8LV?)B"-I1U<aNgve"=\\""ab f n r t vLS_COLWIDTHS %lu : %ld : %lu : %u : %u : %i : %jd : %lu : %lu fflagstostrMAC label for %s/%sCOLUMNSCLICOLOR1ABCFGHLPRSTWZabcdfghiklmnopqrstuwxCLICOLOR_FORCEcolor support not compiled in%*lu , total %lu %e %b %T %Y %b %e %T %Y %e %b %R %b %e %R %e %b %Y %b %e %Y %s %*u %-*s %-*s %-*s %3d, 0x%08x %3d, %3d %*s%*jd %5s ls: %s: %s -> usage: ls [-ABCFHLPRSTWZabcdfghiklmnopqrstuwx1] [file ...] usage: mkdir [-pv] [-m mode] directory_name ... m:pv mv [-f | -i | -n] [-v] source ... directoryusage: mv [-f | -i | -n] [-v] source target%s: set owner/group (was: %lu/%lu)%s: owner/group changed; clearing suid/sgid (mode was 0%03o)%s: set mode (was: 0%03o)%s: set flags (was: 0%07o)%s: set times-PRpv-PRp/bin/cp-rf/bin/rm%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) statusoverride %s%s%s/%s for %s? %scannot resolve %s: %scannot rename a mount pointrename %s to %sfinv%s: destination pathname too long*M+M+*M+G+t*M+M+*"/" may not be removed%s: malloc unlink fileusage: rm [-f | -i] [-dIPRrvW] file ...recursively remove %d dirs and 1 file and %d filesremove %d filesremove %s? %s: -P was specified, but file is not writableoverride %s%s%s/%s %s%sfor %s? %s: is a directory"." and ".." may not be removeddfiIPRrvWPOSIXLY_CORRECTusage: rmdir [-pv] directory ... usage: sleep seconds ReUUU"VunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660vinumraidjfsSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyCCDVinumDOC2KRaid%s is not a valid file or linkcannot get disk geometrydisks with more than 2^32-1 sectors are not supported%s read%s: no valid label foundread mbroffsetverbgeom (to restore label and install boot program) bsdlabel -R -B [-n] [-b boot] [-m machine] disk protofile (to write label and install boot program) bsdlabel -w -B [-n] [-b boot] [-m machine] disk [type] (to install boot program with existing on-disk label) bsdlabel -B [-b boot] [-m machine] disk (to restore label with existing boot program) bsdlabel -R [-n] [-m machine] disk protofile (to edit label) bsdlabel -e [-n] [-m machine] disk (to write label with existing boot program) bsdlabel -w [-n] [-m machine] disk [type] (to read label)usage: bsdlabel disk%s %s %s %s %s %s %s %s %s %s %s %s %s %s # %s: type: %u disk: %.*s label: %.*s removeable ecc badsectbytes/sector: %lu sectors/track: %lu tracks/cylinder: %lu sectors/cylinder: %lu cylinders: %lu sectors/unit: %lu rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %lu # milliseconds track-to-track seek: %ld # milliseconds drivedata: %u partitions: # size offset fstype [fsize bsize bps/cpg] %c: %8lu %8lu %8.8s%8d %5lu %5lu %5.5s %5lu %5lu %5u %5lu %5lu %5d%20.20s # "raw" part, don't editwrite to disk label supressed - label was as follows:/boot/bootcannot open %sread error %sboot code %s is wrong sizecannot open file %s for writing labelwrite labelwrite bootcodewrite %s%s: unknown disk typesector size 0 sectors/track 0 tracks/cylinder 0 cylinders/unit 0 revolutions/minute 0boot block size 0 boot block size %% sector-size != 0number of partitions (%lu) > MAXPARTITIONS (%d)Too many '*' partitions (%c and %c)unknown multiplier suffix '%c' for partition %c (should be K, M, G or T)partition %c not an integer number of sectorstotal percentage %lu is greater than 100 %ld sectors available to give to '*' and '%%' partitions Offset %ld for partition %c overlaps previous partition which ends at %lu Labels with any *'s for offset must be in ascending order by sector Offset %ld for partition %c doesn't match expected value %ldpartition %c: size 0, but offset %lupartition %c: offset past end of unit partition %c: partition extends past end of unit partition %c is not marked as unused!partition %c doesn't start at 0!partition %c doesn't cover the whole unit!An incorrect partition %c may cause problems for standard system utilitiespartitions %c and %c overlap! unused partition %c: size %d offset %luline %d: syntax error Warning, unknown disk typeline %d:%s %lu line %d: %s: bad flag drivedata%lu partitionsline %d: bad # of partitions bytes/sectorline %d: %s: bad sector size sectors/tracksectors/cylindertracks/cylindersectors/unitrpminterleavetrackskewcylinderskewline %d: %s: bad %s headswitchtrack-to-track seekline %d: %s: Unknown disklabel field line %d: partition name out of range a-%c: %s line %d: %s: bad partition size line %d: %s: bad partition offset line %d: missing file system type line %d: Warning, unknown file system type %s line %d: too few numeric fields i386amd64ia64pc98alphaUnsupported architectureABb:efm:nRrs:wa -m option must be specified/dev/can't create %scan't reopen %s for readingEDITOR/usr/bin/viyou have too many processesre-edit the label? [y]: fopen %susage: clri special_device inode_number ... %s: can't read superblockcannot find file system superblock%s is not a valid inode numberclearing %d usage: dmesg [-a] [-M core [-N system]] aM:N:sysctl kern.msgbufkvm_nlist: %s%s: msgbufp not foundkernel message buffer has different magic numberkvm_read: %sPrimary DOS with 12 bit FATXENIX / file systemXENIX /usr file systemPC-UXExtended DOSPrimary 'big' DOS (> 32MB)OS/2 HPFS, QNX or Advanced UNIXAIX file systemAIX boot partition or CoherentOS/2 Boot Manager or OPUSFreeBSD/NetBSD/386BSDVENIX 286DMCP/M or Microport SysV/ATGBSpeedISC UNIX, other System V/386, GNU HURD or MachNovell Netware 2.xxNovell Netware 3.xxPCIXMinixparameters extracted from in-core disklabel are:cylinders=%d heads=%d sectors/track=%d (%d blks/cyl) Figures below won't work with BIOS for partitions not in cyl 1parameters to be used for BIOS calculations are:sysmid %d (%#04x),(%s) start %lu, size %lu (%ju Meg), sid %d beg: cyl %d/ head %d/ sector %d; end: cyl %d/ head %d/ sector %d system Name %.16s Information from DOS bootblock is:can't read fdisk partition tableinvalid fdisk partition table foundwrite PC98%ss%dFailed to write sector zeroSupply a decimal value for "%s" [%d] %s is an invalid decimal number. Try again. %s [n] yesYESThe data for partition %d is: Do you want to change it? The static data for the slice 1 has been reinitialized to:sysmidsyssidsystem nameSupply a string value for "%s" [%s] Explicitly specify beg/end address ?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorAre we happy with this entry? fdisk -f configfile [-itv] [disk] usage: fdisk [-Baistu] [-12345678] [disk] Ba:f:istuv12345678statfs("/")^(/dev/[a-z]+[0-9]+)([sp][0-9]+)?[a-h]?$regcomp() failed (%d)mounted root fs resource doesn't match expectations (regexec returned %d)can't get file status of %sdevice %s is not character specialcan't open device %scan't get disk parameters on %scannot open disk %sread_s0%s: %d cyl %d hd %d sec StartPart %11s %11s SID %4d: %11u %11u 0x%02x ******* Working on device %s ******* Do you want to change our idea of what BIOS thinks ?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choiceMedia sector size is %d Warning: BIOS sector numbering starts with sector 1Partition %d is marked active Active partition number must be in range 1-8. Try again.Do you want to change the active partition?active partitionDo you want to change the boot code? We haven't changed the partition table yet. This is your last chance.Should we write new partition table? -t flag specified -- partition table not written.usage: mknod name [b | c] major minor [owner:group] %s: illegal %s namenode must be type 'b' or 'c'%s: non-numeric major number%s: non-numeric minor numbermajor or minor number too largegroup must be specified when the owner isowner must be specified when the group issetting ownership on %sasynchronousNFS exportednoatimenoexecnosuidnosymfollowwith quotasunionnoclusterrnoclusterwsuiddirsoft-updatesmultilabelaclsffsext2fs%s on %s (%s, mounted by , writes: sync %ju async %ju, reads: sync %ju async %ju, fsid %s,%s-oasync%s %s %s %s %u %u 1 1 2 2 0 0forceupdatemsdosexec: mount_%s/sbin:/usr/sbinexec mount_%s not found in %sstatfs %sno mount [-dfpruvw] [-o options] [-t ufs | external_type] special node mount [-dfpruvw] special | nodeusage: mount [-adfpruvw] [-F fstab] [-o options] [-t ufs | external_type]noroadF:fo:prwt:uvgetmntinforqnoautonot currently mounted %s%s: unknown special file or file system%s has unknown file system type/var/run/mountd.pidsignal mountduserquotagroupquotadevrdonlyusage: mount_ufs [-o options] special node %s on %s: mount table full%s on %s: specified device does not match mounted device%s on %s: incorrect super block-o %s: option not supported%s: not a directoryextattgensrripstrictjolietusage: mount_cd9660 [-begjrv] [-C charset] [-o options] [-s startsector] special node cd9660_iconvcannot find or load "cd9660_iconv" kernel moduleUTF-16BEbegjo:rs:vC:could not determine starting sector, using very first sessionusing starting sector %d shortnameslongnamesnowin95 [-W table] special node [-M mask] [-m mask] [-o options] [-u uid]usage: mount_msdosfs [-9ls] [-D DOS_codepage] [-g gid] [-L locale]msdosfs_iconvcannot find or load "msdosfs_iconv" kernel moduleunknown user id: %sunknown group id: %siso22dosiso72doskoi2dosKOI8-Rkoi8u2dosKOI8-Usl9u:g:m:M:o:L:D:W:malloc()stat %sE~~~~~~NX~a~nwvm.stats.vm.v_swappgsinhaltusage: %s [-%slnpq] [-k kernel] dk:lnpqcannot dump (-d) when halting; must reboot instead/boot/nextboot.confnextboot_enable="YES" kernel="???halted by %srebooted by %sshutdownSIGTSTP initSIGTERM processesWARNING: some process(es) wouldn't die (can't restart init): NħئħħħħħħħħħħħħħħħħZħħħħħħBħħħħZħ . E?*ssR7RR79r-rzns?b[-b blocksize] [-f file | -P pipecommand] [-s fileno]restore -x [-dhmNuvy]restore -t [-dhNuvy]restore -r [-dNuvy]restore -R [-dNuvy]restore -i [-dhmNuvy]usage: %s %s %s %s %s %s %s %s %s %s %s %s option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0-P and -f options are mutually exclusive%c and %c options are mutually exclusiveillegal dump number -- %sdump number must be greater than 0b:df:himNP:Rrs:tuvxynone of i, R, r, t or x options specified/dev/sa0Begin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c ./canonname: not enough buffer space Warning: undefined file type %d restore > %s: out of memory %s %s: no such file or directory %s: not a directory %s: not on extraction list extract directory is used If no `arg' is supplied, the current help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sls: out of memory directory reopen failed %s%s: name exceeds %d char %*d verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continuedir %10d %s %s: not on the tape ./%uMark entries to be removed. Delete whiteouts %s: REMOVE |ONTAPE|INOFND|NAMEFND|MODECHGcorrupted symbol table name/inode conflict, mktempname %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: %s [%s] %s: Extraneous name %s: (inode %d) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %d: bad first %s: not found on tape expected next file %d, got %d unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %d type should be LEAFMangled directory: reclen not multiple of 4 reclen less than DIRSIZ (%d < %d) bad seek pointer to rst_seekdir %ld error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s Set directory mode, owner, and times. TMPDIR/tmp/%s/rstmode%dmodefile not defined fopen: %s cannot open mode file %s directory mode, owner, and times not set set owner/mode for '.'cannot find directory inode %d error setting directory modes Cannot find directory inode %d named %s write error extracting inode %d, name %s read: %s Extract directories from tape %s/rstdir%d-XXXXXX%s - cannot create directory temporary fopen%s - cannot create modefile fopenopendirfile: %s Root directory is not on tape no memory directory table addino: out of range %d duplicate inumdeleteino: out of range %d deleteino: %d not found %s is not a directory %s: pathname too long cannot find entry in parent listnot marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundbad name no space for string table cannot move ROOTno memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry Check pointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Cannot allocate space for tape buffer /dev/ttycannot open %s: %s /dev/nullCannot allocate space for magtape buffer Dump date: %sthe epoch Dumped from: %sLevel %ld dump of %s on %s:%s Label: %s End-of-input encountered while extractingWarning: %s %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s write error extracting inode %d, name %s write: %s seek error extracting inode %d, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s hole in map Unknown conversion character: %c Format of dump tape is too old. Must use a version of restore from before 2002. Note: Doing Byte swapping Checksum error %o, inode %d file %s 8l4s1q8l2q17l2l4qgethead: unknown inode type %d Volume header begins with record %qdDumped inodes map headerUsed inodes map headerFile header, ino %dFile continuation header, ino %dEnd of tape header; predicted %ld blocks, got %ld blocksChanging volumes on pipe input? Otherwise, begin with volume 1. have no further files to extract. can quickly skip tapes that and work towards the first; restore start with the last volume If you are extracting just a few files,You have not read any tapes yet. You have read volumes%s%ldSpecify next volume #: Volume numbers are positive numerics Mount tape volume %ld Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) none RESTORE_VOLUMECannot set $RESTORE_VOLUME: %s Cannot open %s header read failed at %ld blocks tape is not dump tape Wrong volume (%ld) Wrong dump date got: %s wanted: %slast rec %qd, tape starts with %qd Skipping %ld duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %ld should be %ld Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %d continuation failed: %s End-of-tape encountered partial block read: %d should be %d unexpected tape header unknown tape header type %d resync restore, skipped %ld blocks ran off end of tape not at beginning of a file Missing address (header) block for %s at %ld blocks %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract fifo %s %s: cannot create fifo: %s extract special file %s %s: cannot create special file: %s %s: cannot create file: %s Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%d) Tape block size is %ld Tape is not a dump tape cannot stat .: %s bad block size %ld Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list maxino = %d no memory for active inode map Cannot find file dump list no memory for file dump list warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump corebad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s NODEentry type: %s inode number: %lu flags: %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s removeleaf: not a leafwarning: %s: %s Remove leaf %s removenode: not a noderemovenode: non-empty directoryRemove node %s newnode: not a nodeMake node %s not on ino listRSTTMP%s%ld%lumktempname: called with TMPNAMEwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d symbolichardCreate %s link %s->%s Lost connection to remote host. on %s: %s%stcpshell/tcp: unknown service who are you? invalid user name %s RMT/etc/rmtlogin to %s as %s failed. Connection to %s established. IP_TOS:IPTOS_THROUGHPUT setsockoptTCP_NODELAY setsockoptW%d Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). I%d %d ioctlL%d %d R%d C O%.226s %d %s: device already in use%s: NSWAPDEV limit reachedusage: %s -a | file ... [-AhklsU] [-a file ... | -d file ...] swapoffAadlhksUswremov%s: %sing %s as swap device vm.swap_infosysctlnametomib()%ld-blocksUsed:Device:%-13s %*s %*s xswdev version mismatch/dev/%-8s %*lld %*lld sysctl()Total: %*lld %*lld callocstrdupcan't get net id for hostFSID:%d:%dunmount of %s failedretrying using path instead of file system ID%s: unmount from %s udpRPCPROG_MNTRPCMNT_UMOUNTcannot remove mounttab entry %s:%s%s:%.*s%s: statfs%s/..%s: stat%s: not a file system root directory%s: unknown file systemfstab reading failure umount -a | -A [-F fstab] [-fv] [-h host] [-t type]usage: umount [-fv] special | node | fsidAaF:fh:t:v/var/db/mounttab%ld %s %s bad mounttab %s field '%s'can't open %s can't write to %swrite mounttab entry %s:%scan't remove %s by hostdelete mounttab entry%s %s:%stoggle verbose modesend new user informationshow command usageunset an optionget (set) umask on remote sideset file transfer typetoggle packet tracingset tenex file transfer typeshow remote system typetoggle store unique on remote machineset file transfer structureshow current statusshow size of remote filesend site specific command to remote server Try "rhelp site" or "site help" for more informationset or display optionstoggle use of PORT/LPRT cmd for each data connectiontoggle store unique for local filesshow status of remote machineremove directory on the remote machineget help from remote serverrestart file transfer at bytecountclear queued command repliesrename fileshow or set options for remote commandsget file restarting at end of local fileset socket send/receive buffer sizeset transfer rate limit (in bytes/second)send arbitrary ftp commandprint working directory on remote machinesend one fileissue command on alternate connectionforce interactive prompting on multiple commandstoggle transfer progress metertoggle preservation of modification time of retrieved fileslist contents of remote directory in a machine parsable form through your pagerlist contents of remote path through your pagertoggle use of passive transfer modeset translation table for default file name mappingset templates for default file name mappingget file if remote file is newer than local file get multiple files restarting at end of local filesend multiple filesshow last modification time of remote fileset file transfer modelist remote path in a machine parsable formlist contents of remote directory in a machine parsable formmake directory on the remote machineget multiple fileslist contents of multiple remote directoriesdelete multiple filesdefine a macroprint local working directoryview a local file through your pagerview a remote file through your pagerchange local working directoryget (set) idle timer on remote sideprint local help informationtoggle printing `#' marks; specify number to set sizetoggle metacharacter expansion of local file namesreceive filetoggle gate-ftp; specify host[:port] to change proxyconnect to remote ftp serverset file transfer formatget files using a localfile as a source of namesshow FEATures supported by remote systemtoggle use of EPSV/EPRT on IPv4 ftptoggle command line editinglist contents of remote pathdelete remote filetoggle/set debugging modetoggle carriage return stripping on ascii getsterminate ftp sessionchange file permissions of remote filechange remote working directory to parent directorychange remote working directorytoggle mget upper/lower case id mappingterminate ftp session and exitset binary transfer typebeep when command completedset ascii transfer typeappend to a filesend account command to remote serverexecute macroescape to the shellABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/ht )Dr KMGTP***************************************************************************************************************************************************************************************************************************************tenex%s %s [anpqy?]? EOF received; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list usage: %s [ | Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.usage: %s usage: %s mode-name We only support %s mode, sorry. usage: %s format We only support %s format, sorry. usage: %s struct-mode We only support %s structure, sorry. nmap: unbalanced brackets. local-fileremote-fileusage: %s local-file [remote-file] APPESTOUSTORContinue withlocal-filesusage: %s local-files mput%s: not foundusage: %s remote-file [local-file] Restart is not supported by the remote server. local: %sRETRr+remote-filesusage: %s remote-files mregetSkipping non-relative filename `%s' mgetusage: %s localfile Cannot open source file %s and logged inConnected %sto %s. Not connected. Connected for proxy commands to %s. No proxy connection. (none)Gate ftp: %s, server %s, port %s. Passive mode: %s; fallback to active mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Get transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. Socket buffer sizes: send %d, receive %d. Use of PORT cmds: %s. (disabled for this connection)Use of EPSV/EPRT cmds for IPv4: %s%s. Command line editing: %s. Macros: 20050514NetBSD-ftpVersion: %s %s usage: %s [ on | off ] %s %s. Bell modeEditing modePacket tracingusage: %s [ on | off | bytecount ] mark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [port] ] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD command not recognized, trying XCWD. XCWD %susage: %s [local-directory] lcd %sLocal directory now: %s Unable to determine local directory usage: %s remote-file DELE %susage: %s [remote-files] mdeletefrom-nameto-nameusage: %s from-name to-name RNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTLISTusage: %s [remote-path] usage: %s [remote-path [local-file]] pagermoreoutput to local-file:usage: %s remote-files local-file mlsusage: %s [command [args]] SHELL/bin/sh-cTry again laterusernameusage: %s username [password [account]] USER %sPassword: PASS %sAccount: EOF received; login aborted. ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameusage: %s directory-name MKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %sarguments to SITE commandusage: %s line-to-send SITE command line to sendusage: %s mode remote-file SITE CHMOD %s %susage: %s [umask] SITE UMASKSITE UMASK %susage: %s [seconds] SITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:usage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingusage: %s [inchars [outchars]] Ntrans off. Nmap off. mapoutusage: %s [mapin mapout] usage: %s [ on | off | auto ] EPSV/EPRT on IPv4Store uniqueReceive uniqueusage: %s (all|get|put),maximum-bytes[,increment-bytes]] usage: %s (all|get|put) [maximum-bytes [increment-bytes]] CDUPCDUP command not recognized, trying XCUP. XCUPusage: %s [restart-point] restart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %susage: %s [remote-file] STATSTAT %sLocal file "%s" is newer than remote file "%s". usage: %s local-file usage: %s size sndbufrcvbufxferbuf%s: size must be positive. usage: %s [option value] %-*s %s No such option `%s'. Setting `%s' to `%s'. usage: %s option Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %susage: %s command [options] OPTS is not supported by the remote server. OPTS %sOPTS %s %sanonpassftp_proxyhttp_proxyno_proxyrpromptaccountbyecdupnrdisconnectepsv4featuresfgetglobhashidlelcdlpagelpwdmacdefmlstmodtimemsendnewerntranspassivepdirplspmlsdpreservequoterecvremoptsrhelprstatusruniquesendportsitestructsuniquethrottletraceumaskunset Must be logged in to complete. unknown complete type `%c'usage: %s macro_name [args] '%s' macro not found. parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'parse_url: user `%s' pass `%s' host %s port %s(%d) path `%s' HTTP fetch aborted. Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'fetch_ftp: user `%s' pass `%s' host %s port %s path `%s' dir `%s' file `%s' *?[]{}Can't connect or login to host `%s'fetch_ftp: unknown transfer type %ddir `%s', nextpart `%s' ftp: The `CWD ' command (without a directory), which is required by RFC 1738 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'no file after directory (you must specify an output file) `%s'savefile `%s' copiedCannot open file `%s'Can't lseek to restart `%s'Copying %s (restarting at %lld)retrievedproxy URLMalformed proxy URL `%s'Scoped address notation `%s' disallowed via web proxyTrying %s... Can't create socketConnect to address `%s'Can't connect to %sRequesting %s (%svia %s:%sGET %s HTTP/1.0 Pragma: no-cache GET %s HTTP/1.1 Host: [%s]Host: %s:%uAccept: */* Connection: close Range: bytes=%lld- restarting at %lldCache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestReceiving HTTP replyreceived `%s' Content-Length:parsed len as: %lld Content-Range:bytesparsed range as: %lld-%lld/%lld Received unexpected Content-Range headerLast-Modified:%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %Yparsed date as: %sLocation:parsed location as `%s' Transfer-Encoding:Bogus transfer encoding - `binary' (fetching anyway)chunkedusing chunked encoding Proxy-Authenticate:WWW-Authenticate:Basicskipping unknown auth scheme `%s' parsed auth as `%s' Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s No authentication challenge provided by serverAuthorization failed. Retry (y/n)? auth_url: challenge `%s' realm="Unsupported authentication challenge - `%s'Username for `%s': Error retrieving file - `%s'Unknown error retrieving fileCan't run `%s'already done Size of `%s' differs from save file `%s'Can't open `%s'got chunksize of %lld Reading fileCan't change modification time to %sUnsupported transfer encoding - `%s'Unexpected EOF reading chunksizeUnexpected data following chunksizeWriting `%s'Unexpected data following chunkImproper response from `%s'about:tnftpThis version of ftp has been enhanced by Luke Mewburn for the NetBSD project. Execute `man ftp' for more details. lukemLuke Mewburn is the author of most of the enhancements in this ftp client. Please email feedback to . netbsdNetBSD is a freely available and redistributable UNIX-like operating system. For more information, see http://www.NetBSD.org/ versionVersion: %s %s%s `%s' is an interesting topic. auto_put: target `%s' auto_put: URL `%s' argv[2] `%s' %c%c%c421 Service not available, remote server timed out. Connection closed 421 Service not available, user interrupt. Connection closed. 421 Service not available, remote server has closed connection. %s:---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command.connect to address %sgetsocknameIPTOS_LOWDELAYsetsockopt %s (ignored)fdopen failed.Connected to %s. SO_OOBINLINE receive sendabortxfer called with unknown direction `%s' aborted. Waiting for remote to finish abort. runique: can't find unique file name. use of scoped address can be troublesomeSO_DEBUGEPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! %c%c%c%d%cparse error! connect for data channelSO_REUSEADDRsetsockopt %slistenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dIPTOS_THROUGHPUTpoll waiting before acceptpoll timeout waiting before accept remote abort aborted; closing connection. Lost control connection for abort.%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s sentlocal: %s %s: not a plain file. netoutreceivednetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %susage: %s [-46AadefginpRtvV] [-N netrc] [-o outfile] [-P port] [-q quittime] [-r retry] [-T dir,max[,inc][[user@]host [port]]] [host:path[/]] [file:///file] [ftp://[user[:pass]@]host[:port]/path[/]] [http://[user[:pass]@]host[:port]/path] [...] %s -u URL file [...] no such option `prompt'ftp> no such option `rprompt'Sorry, input line is too long. usage: %s [command [...]] Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue() invoked with NULL namegetoptionvalue() invoked with unknown option `%s'setupoption()FTPSERVERPORThttpftpgateNETRC$NETRC `%s': %scan't create socketunable to get default rcvbuf sizeunable to get default sndbuf sizeFTPMODEactiveunknown $FTPMODE '%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbbad quit value: %sbad retry value: %s-Tbad throttle value: %s46AadefginN:o:pP:q:r:RtT:u:vVHOMEanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTFTPRPROMPTRetrying in %d seconds... %lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %cB/s) ETA: %02d:%02d (stalled)xsignal_restart called with signal %d %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %c%c %3lld.%02d %cB/s --:-- ETA - stalled -%02d:%02d ETApasswordpasswdmachineMissing macdef name argument. 4K macro buffer exceeded. Unknown .netrc keyword %sError: .netrc file is readable by others.Remove account or make file unreadable by others.Macro definition missing null line terminator. Remove password or make file unreadable by others.MDTMREST STREAMTVFSRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. features[FEAT_FEAT] = %d features[FEAT_MDTM] = %d features[FEAT_MLST] = %d features[FEAT_REST_STREAM] = %d features[FEAT_SIZE] = %d features[FEAT_TVFS] = %d sorry, arguments too long. (%s) PWDgot remotecwd as `%s' ftpXXXXXXXXXXunable to create temporary file %scan't find list of remote files, oops. can't find list of remote files, oops.SIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %04d%02d%02d%02d%02d%02dCan't parse time `%s'. got localcwd as `%s' Unable to determine real path of `%s'crankrate invoked with unknown signal: %demacsContext sensitive argument completionftp-complete^Iunable to set sndbuf size %dunable to set rcvbuf size %disipv6addr: got %d for %s Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistxstrdup() called with NULL argumentUnable to allocate memory for string copyUnknown port `%s', using port %dftp_login: user `%s' pass `%s' host `%s' Name (%s:%s): Name (%s): Password:Login failed.$initAlready connected to %s, use close first. usage: %s host-name [port] gateserver not defined (shouldn't happen)Connecting via pass-through server %s non-printstream$tIwwwwwwwwwwwwwwwwrrrѓTTTTTTT%ݘbgTTTtȣD>ppppppp.ŢԢ=s/6!(Define an environment variableundefineUndefine an environment variableMark an environment variable for automatic exportunexportDon't mark an environment variable for automatic exportSend an environment variableList the current environment variablesPrint help informationUse local special character definitionsimportUse remote special character definitionscheckVerify remote special character definitionscrmodlogouttoggleslcenvironopieautoflushflushing of output when sending interrupt charactersflush output when sending interrupt charactersautosynchautomatic sending of interrupt characters in urgent modesend interrupt characters in urgent modeskiprcdon't read ~/.telnetrc fileskip reading of ~/.telnetrc filesending and receiving of binary datainbinaryoutbinarysending of binary datacrlfsending carriage returns as telnet mapping of received carriage returnsmap carriage return on outputlocalcharslocal recognition of certain control charactersrecognize certain control charactersturn on socket level debuggingnetdataprinting of hexadecimal network data (debugging)print hexadecimal representation of network trafficprettydumpoutput of "netdata" to user readable format (debugging)print user readable output for "netdata"viewing of options processing (debugging)show option processingtermdata(debugging) toggle printing of hexadecimal terminal dataprint hexadecimal representation of terminal trafficcharacter to toggle local echoing on/offcharacter to escape back to telnet command moderloginrlogin escape charactertracefilefile to write trace information toThe following need 'localchars' to be toggled trueflushoutputcharacter to cause an Abort Outputinterruptcharacter to cause an Interrupt Processcharacter to cause an Abort processcharacter to cause an EOF The following are for local editing in linemodecharacter to use to erase a charactercharacter to use to erase a linelnextcharacter to use for literal nextcharacter to cause a Suspend Processcharacter to use for line reprintworderasecharacter to use to erase a wordcharacter to use for XONcharacter to use for XOFFforw1alternate end of line characterforw2aytalternate AYT characteraoSend Telnet Abort outputSend Telnet 'Are You There'Send Telnet BreakbreakSend Telnet Erase CharacterSend Telnet Erase LineSend current escape characterSend Telnet 'Go Ahead' sequenceSend Telnet Interrupt ProcessintpintrnopSend Telnet 'No operation'eorSend Telnet 'End of Record'Send Telnet 'Abort Process'Send Telnet 'Suspend Process'Send Telnet End of File CharacterPerform Telnet 'Synch operation'getstatusSend request for STATUSDisplay send optionsdontwillwontDisable LINEMODE option(or disable obsolete line-by-line mode)Enable LINEMODE option(or enable obsolete line-by-line mode)These require the LINEMODE option to be enabledEnable signal trapping+isig-isigDisable signal trappingEnable character editing+edit-editDisable character editingEnable tab expansion+softtabs-softtabsEnable literal character echo+litecho-litechoDisable literal character echokludgeline%s sequence challenge /usr/bin/opiekey^?%-15s %s usage: send %s "value" must be from 0 to 255Valid options are: '%s': ambiguous argument ('send %s ?' for help). '%s': unknown argument ('send %s ?' for help). '%s': bad value ('send %s ?' for help). ?Need to be connected first.setsockopt (SO_DEBUG)Will send carriage returns as telnet .Will send carriage returns as telnet .Already operating in binary mode with remote host.Negotiating binary mode with remote host.Already in network ascii mode with remote host.Negotiating network ascii mode with remote host.Already receiving in binary mode.Negotiating binary mode on input.Already receiving in network ascii mode.Negotiating network ascii mode on input.Already transmitting in binary mode.Negotiating binary mode on output.Already transmitting in network ascii mode.Negotiating network ascii mode on output.%-15s toggle %s display help informationenabledisable%-15s %s %s Need an argument to 'toggle' command. 'toggle ?' for help. '%s': ambiguous argument ('toggle ?' for help). '%s': unknown argument ('toggle ?' for help). WillWon'tTelnet rlogin escape character is '%s'. Telnet escape character is '%s'. '%s': unknown argument ('set ?' for help). Format is 'set togglename [on|off]' 'set ?' for help.Format is 'set Name Value' 'set ?' for help.'%s': ambiguous argument ('set ?' for help). %s set to "%s". %s character is '%s'. Need an argument to 'unset' command. 'unset ?' for help. '%s': unknown argument ('unset ?' for help). '%s': ambiguous argument ('unset ?' for help). %s reset to "%s". ?Need to have LINEMODE option enabled first.'mode ?' for help.format is: 'mode Mode', where 'Mode' is one of: 'mode' command requires an argumentUnknown mode '%s' ('mode ?' for help). Ambiguous mode '%s' ('mode ?' for help). won't%-15s [%s] %-15s "%s" ?Ambiguous argument '%s'. ?Unknown argument '%s'. Deprecated usage - please use 'set escape%s%s' in the future. new escape character: Deprecated usage - please use 'toggle crmod' in the future.%s map carriage return on output. Fork failed ExeclConnection closed.fromquitNeed an argument to 'slc' command. 'slc ?' for help. '%s': unknown argument ('slc ?' for help). '%s': ambiguous argument ('slc ?' for help). Need an argument to 'environ' command. 'environ ?' for help. '%s': unknown argument ('environ ?' for help). '%s': ambiguous argument ('environ ?' for help). only Need %s%d argument%s to 'environ %s' command. 'environ ?' for help. DISPLAYunix:USERLOGNAMEPRINTERCannot send '%s': Telnet ENVIRON option not enabled Cannot send '%s': variable not defined %c %-20s %s notmuchOperating with LINEMODE optionLocalNo%s line editing %s catching of signals Operating in obsolete linemodeOperating in single character modeCatching signals locallyRemote%s character echo %s flow control No connection.Escape character is '%s'. need at least one argument for 'send' commandNeed %d argument%s to 'send %s' command. 'send %s ?' for help. 'send ?' for helpThere is not enough room in the buffer TO the networkto process your request. Nothing will be done.('send synch' will throw away most data in the networkbuffer, if this might help.)Unknown send argument '%s' 'send ?' for help. Ambiguous send argument '%s' 'send ?' for help. Telnet 'send' error - argument disappeared! SENT%s> ?Ambiguous command?Invalid commandCommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s ?Already connected to %s (to) -ausage: %s [-l user] [-a] [-s src_addr] host-name [port] hostname too long for unix domain socket: %sBad source route option: %s setsockopt (source route)telnet: setsockopt (IP_TOS) (ignored)Unable to connect to remote host/.telnetrc?Ambiguous command: %s ?Invalid command: %s ?Need to be connected first for %s. telnet: socketConnection closed by foreign host. [host-name [port]][-r] [-s src_addr] [-u] [-e char] [-l user] [-n tracefile] [-4] [-6] [-8] [-E] [-L] [-N] [-S tos] [-c] [-d]usage: %s %s%s%s%s rlog; will try to use default TOS: Bad TOS argument '%s: Warning: -f ignored, no Kerberos V5 support. %s: Warning: -F ignored, no Kerberos V5 support. %s: Warning: -k ignored, no Kerberos V4 support. %s: Warning: -x ignored, no ENCRYPT support. %s: Warning: -y ignored, no ENCRYPT support. 468EKLNS:X:acde:fFk:l:n:rs:uxySetSockOptsleep(5) from telnet, after select: %s UNKNOWNlm_will: no command!!!lm_will: not enough room in bufferlm_wont: no command!!!lm_do: no command!!!lm_do: not enough room in bufferlm_dont: no command!!!lm_mode: not enough room in bufferslc_import: not enough roomremote defaultremoteSpecial characters are %s values slc_end_reply: not enough roomenv_opt_start: malloc()/realloc() failed!!!SYSTEMTYPEJOBACCTenv_opt_add: realloc() failed!!!%c%c%c%c%s%c%cNo room in buffer for terminal type. %c%c%c%c%ld,%ld%c%cz Remote side does not support STATUS optionIn SUBOPTION processing, RCVDclose SYNCHBRKIPAOAYTEORABORTSUSPRPLNEXTFORW1FORW2MCLMCRMCWLMCWRMCBOLMCEOLINSRTOVERECREWREBOLEEOLBINARYRCPSUPPRESS GO AHEADTIMING MARKRCTENAOLNAOPNAOCRDNAOHTSNAOHTDNAOFFDNAOVTSNAOVTDNAOLFDEXTEND ASCIILOGOUTBYTE MACRODATA ENTRY TERMINALSUPDUPSUPDUP OUTPUTSEND LOCATIONTERMINAL TYPEEND OF RECORDTACACS UIDOUTPUT MARKINGTTYLOC3270 REGIMEX.3 PADNAWSTSPEEDLFLOWLINEMODEXDISPLOCOLD-ENVIRONAUTHENTICATIONENCRYPTNEW-ENVIRONTN3270ECHARSETCOM-PORTKERMITNOPDMARKGASBWILLWONTDONTIACCannot open %s. (standard output)%c 0x%x %c%.2x%s IAC %s%s IAC %d%s %s EXOPL%s %d %dresp DO_DONT %s: %d resp DO_DONT %d: %d want DO %s want DO %d want DONT %s want DONT %d DO %s DO %d resp WILL_WONT %s: %d resp WILL_WONT %d: %d want WILL %s want WILL %d want WONT %s want WONT %d WILL %s WILL %d %s IAC SB (terminated by %d , not IAC SE!) (Empty suboption???)TERMINAL-TYPE TERMINAL-SPEED (empty suboption???) IS SEND %d (unknown) ?%d?TOGGLE-FLOW-CONTROL OFF ON RESTART-ANY RESTART-XON %d %d (%d)LINEMODE WILL WONT DO DONT (no option???)Forward Mask %xSLC NOSUPPORT CANTCHANGE VARIABLE DEFAULT|FLUSHOUT|FLUSHIN|ACK %d;(no mode???)|LIT_ECHO|SOFT_TAB|TRAPSIG|EDIT (0x%x) ?0x%x? IS IS %s %d SEX-DISPLAY-LOCATION IS "%.*s"- unknown qualifier %d (0x%x).NEW-ENVIRON SEND INFO " VALUE " VAR " ESC " USERVAR " %03o %s (unknown) %02x!'++1+5;+?E+IkNZ!Q+`drwyQ.Ķ+Q+жԶֶn?+5+0123456789abcdef01234567Y`gnu|nnn6h  i i i i  (!"!1"c"1"!""444444$.:FQ[gr{8;;;;|;^%=*_+3@KVOK= Bx<??INIKLsM5l] (Q; B*@1l;Ly; B` Qj1ж +! +."Z^Yo B ,m36N BzYW p2MHphM ,! 33:kHL z 1x B 4At% Vx Br2 A .H 5:Iz|\` W ` ( q /Sa8 4(fq8 4(ZP /@)? qQZp05\ sM] 1(/ 5" "2<1T`h{ (] ( 7, .A2 Y\u6 ; 6*< #-c< F-o BS n qm ye m  &f -9J 4(NX @ *( 3]p ]h !p 3 ;K} }  O~ } Z} } } } } Z}      " + 4 K S [     &    ( 1      p "@Te   8;[  pzh    |  D h D&0| FI HDZdh D% D| ¡  @  , 58# OYB mp   @   D   ,AbШ  = D8 "@D g (C "@D,5 "@DKTh HDmv֜  D% HD "@)  @v;? VoX  D}  ,  , "@   3;  MV*  Dlu '  DQ  F  HE2;v EKT  {4   E E "@ b  A  +5 Y  nwE  F  #  D i+  8Ik|.   @D  @D  D @D" "B  )l*  D@Ix  [y̝  &  D  F|  D  7@h DXa% Dw  DD h "@ L      *=  Rc  F{  )j#  D*  +  ., @Wzp "@DB  D "@D  y ~       ! % ) -             ] ]   o       z   d              ]  P Y b r { {   H  ,  G/ y/ y/ [/ / l/ / / / / / / ;A YA ; JC A |/-\|smcupError: move: l(%u) c(%u) o(%u)xterm]0;%susage: ex [-eFRrSsv] [-c command] [-t tag] [-w size] [file ...] usage: vi [-eFlRrSv] [-c command] [-t tag] [-w size] [file ...] signal-resettcgetattr%s: No terminal database found %s: %s: unknown terminal type lines=%lucolumns=%lurmsotcsetattr016|Vi's standard input and output must be a terminalLINES%s: unknown terminal typekcud1jakcub1hakcuu1kakcuf1lakil1insert linekdch1keldelete to eolkindscroll downkllgo to eolkendkhomego to solkich1insert at cursorkdl1delete lineknppage downkpppage upkriscroll updelete to end of screenkf%d233|This terminal has no %s keyfunction key %dstderr046|messages not turned on: %s045|messages not turned off: %stigetnum: linestigetnum: cols002|Line length overflow/tmp240|%s: remove241|%s: close242|%s: remove243|%s: remove265|File is a temporary; exit will discard modifications264|File modified since last complete write; write or use ! to override244|Read-only file, not written; use ! to override245|Read-only file, not written246|%s exists, not written; use ! to override247|%s exists, not written248|Partial file, not written; use ! to override249|Partial file, not written250|%s: file modified more recently than this copy; use ! to override251|%s: file modified more recently than this copy258|%s expanded into too many file names259|%s: not a regular file260|%s: not owned by you261|%s: accessible by a user other than the owner252|%s: write lock was unavailable254|%s: WARNING: FILE TRUNCATED256|%s: new file: %lu lines, %lu characters315|%s: appended: %lu lines, %lu characters257|%s: %lu lines, %lu characters266|File readonly, modifications not auto-written262|File modified since last complete write; write or use ! to override263|File modified since last complete write; write or use :edit! to override%s/vi.XXXXXXXXXX237|Unable to create temporary file238|Warning: %s is not a regular file239|%s already locked, session is read-only-c option276|Unexpected character event277|Unexpected end-of-file event279|Unexpected interrupt event280|Unexpected quit event281|Unexpected repaint event285|Unexpected string event286|Unexpected timeout event316|Unexpected resize event287|Unexpected write event008|Error: unable to retrieve line %lu007|unable to get last line006|unable to store line %lu005|unable to insert at line %lu004|unable to append to line %lu003|unable to delete line %lu009|Log file015|%s/%d: log put error267|Log restarted013|Logging not being performed, roll-forward not possible014|No changes to re-do/usr/src/usr.bin/vi/../../contrib/nvi/common/log.c012|Logging not being performed, undo not possible010|Logging not being performed, undo not possible011|No changes to undoex/vi: %s%.*snviewc:eFGlRrSst:vw:-s option is only applicable to ex.window=%sonly one -c command may be specified.only one of -r and -t may be specified.only one tag file may be specified.017|Mark %s: not set018|Mark %s: the line was deleted019|Mark %s: cursor position no longer exists268|confirm? [ynq]269|Press any key to continue: 270|Press any key to continue [: to enter more ex commands]: 161|Press Enter to continue: 275| cont?271|Press any key to continue [q to quit]: 317|%d files to edit021|new file022|name changed023|modified024|unmodified025|UNLOCKED026|readonly028|empty file027|line %lu of %lu [%lu%%]029|line %lu293|added294|changed295|deleted296|joined297|moved298|shifted299|yanked300|line301|lines020|Error: , %d: LC_MESSAGESLANGVI_MESSAGE_CATALOG030|The file %s is not a message catalogaltweraseautoindentautoprintautowritebackupbeautifycdpathceditcommentedcompatibleescapetimeerrorbellsextendedfilecflashgtagsmodehardtabsiclowerignorecasekeytimeleftrightlispmagicmatchtimemodelinemsgcatnoprintoctaloptimizeparagraphsrecdirredrawremapreportrulersearchincrsectionssecureshellmetashiftwidthshowmatchshowmodesidescrollslowopensourceanytabstoptaglengthtersetildeoptimeoutttywerasew1200w300w9600warnwindownamewraplenwrapmarginwrapscanwriteanyaibfcolimodelinesnuparaslowsmsmdttytypewawiwlwm033|set: no %s option: 'set all' gives all option values305|No %s edit option specified%s=%ld%s="%s"set %s set no%s set %s=%-3ld set 032|Usage: %s291|set: the %s option may not be turned off313|set: the %s option may never be turned on034|set: [no]%s option doesn't take a value035|set: %s option isn't a boolean036|set: %s option: %s037|set: %s option: %s: value overflow038|set: %s option: %s is an illegal number314|set: the %s option may never be set to 0039|set: %s option isn't a booleanCDPATHcdpath=%sdirectory=%sescapetime=6keytime=6matchtime=7/usr/share/vi/catalog/msgcat=%sreport=5paragraphs=IPLPPPQPP LIpplpipbp/var/tmp/vi.recoverrecdir=%ssections=NHSHH HUnhshshell=%sshellmeta=~{[*?$`'"\shiftwidth=8sidescroll=16tabstop=8tags=%sscroll=%ldwindow=%lu031|Unable to set default %s option040|Screen columns too small, less than %d041|Screen columns too large, greater than %d042|Screen lines too small, less than %d043|Screen lines too large, greater than %d044|The lisp option is not implemented048|The paragraph option must be in two character groups049|The section option must be in two character groups053|The default buffer is empty054|Buffer %s is empty078|Searching...072|File empty; nothing to search073|Reached end-of-file without finding the pattern074|No previous search pattern075|Pattern not found076|Reached top-of-file without finding the pattern077|Search wrappedrecdir: %sX-vi-recover-file: X-vi-recover-path: 066|%s: malformed recovery file%.24s: %s vi: no files to recover.067|%s: malformed recovery file068|No files named %s, readable by you, to recover069|There are older versions of this file for you to recover070|There are other files for you to recover055|Files with newlines in the name are unrecoverable%s/vi.XXXXXX056|Modifications not recoverable if the session fails/usr/sbin/sendmail071|not sending email: %s%s -t < %s062|Information on user id %u not found%s/recover.XXXXXX063|Unable to lock recovery filePrecedence: bulkSubject: Nvi saved the file To: From: root (Nvi recovery program)Reply-To: root%s%s %s%s %s %s %s%s %s%s %s -r : to this file using the -r option to You can recover most, if not all, of the changes , when it was saved for recovery. on the machine was editing a file named , the user On %s%.24s%s%s%s%s%s%s%s%s%s%s%s%s%s%s 064|Recovery file buffer overrun065|Recovery file060|File backup failed: %s061|Copying file for recovery...057|Copying file for recovery...058|Preservation failed: %s059|Modifications not recoverable if the session fails099|Address value overflow100|Address value underflow101|Illegal address combination102|Illegal address: only %lu lines in the file103|Illegal address: the file is empty104|The %s command doesn't permit an address of 0$0123456789'\/?.+-^095|No mark name supplied096|\ not followed by / or ?097|Reference to a line number less than 0094|The second address is smaller than the first!#&*<=>@~080|Unknown command name1bca1098|The %s command is unknown082|%s: command not available in ex mode085|Internal syntax table error (%s: %s)086|Usage: %s088|Flag offset to before line 1089|Flag offset past end-of-file090|@ with range running when the file/screen changed091|Global/v command running when the file/screen changed083|Count may not be zero084|%s: bad line specification092|Ex command failed: pending commands discarded093|Ex command failed: mapped keys discardedscript170|Interrupted105|No abbreviations to display106|Abbreviations must end with a "word" character107|Abbreviations may not contain tabs or spaces108|Abbreviations may not mix word/non-word characters, except at the end109|"%s" is not an abbreviation273|Entering ex input mode.111|No more files to edit112|No previous files to edit113|No previous files to rewind114|No file list to display115|No previous command to replace "!"116|No filename to substitute for %%117|No filename to substitute for #289|Shell expansions not supported when the secure edit option is setfdopenvfork118|Error: execl: %s119|I/O error: %s304|Shell expansion failed!%s 303|File modified since last write.120|File modified since last complete write; write or use ! to override121|Unable to find home directory location122|New current directory: %sscroll lines[line [,line]] ! commandfilter lines through commands or run commands[line [,line]] # [count] [l]display numbered lines[line [,line]] & [cgr] [count] [#lp]repeat the last subsitution* [buffer]execute a buffer[line [,line]] <[<...] [count] [flags]shift lines left[line] = [flags]display line number[line [,line]] >[>...] [count] [flags]shift lines right@ [buffer][line] a[ppend][!]append input to a lineab[brev] [word replace]specify an input abbreviationargsar[gs]display file argument listbgput a foreground screen into the background!ca[line [,line]] c[hange][!] [count]change lines to input!f1ocd[!] [directory]change the current directorychdirchd[ir][!] [directory][line [,line]] co[py] line [flags]copy lines elsewhere in the filecscope!scs[cope] command [args]create a set of tags using a cscope command[line [,line]] d[elete][flags] [buffer] [count] [flags]delete lines from the filedisplay b[uffers] | c[onnections] | s[creens] | t[ags]display buffers, connections, screens or tags[Ee][dit][!] [+cmd] [file]begin editing another file[Ee]x[!] [+cmd] [file]exusage[exu]sage [command]display ex command usage statementf[ile] [name]display (and optionally set) file namefg[Ff]g [file]bring a backgrounded screen into the foregroundglobal[line [,line]] g[lobal][!] [;/]RE[;/] [commands]execute a global command on lines matching an REhe[lp]display help statement[line] i[nsert][!]insert input before a line!ca1[line [,line]] j[oin][!] [count] [flags]join lines into a single line[line] k keymark a line position[line [,line]] l[ist] [count] [#]display lines in an unambiguous form[line [,line]] m[ove] linemove lines elsewhere in the file[line] ma[rk] key!Wmap[!] [keys replace]map input or commands to one or more keysmkexrc!f1rmkexrc[!] filewrite a .exrc file!fN[Nn][ext][!] [+cmd] [file ...]edit (and optionally specify) the next file[line [,line]] nu[mber] [count] [l]change display to number lines[line] o[pen] [/RE/] [flags]enter "open" mode (not implemented)[line [,line]] p[rint] [count] [#l]display linesperlpe[rl] cmdrun the perl interpreter with the commandperldoperld[o] cmdrun the perl interpreter with the command, on each linepre[serve]preserve an edit session for recovery[Pp]rev[ious][!]edit the previous file in the file argument list[line] pu[t] [buffer]append a cut buffer to the lineq[uit][!]exit ex/vi[line] r[ead] [!cmd | [file]]append input from a command or file to the linerecover[!] filerecover a saved fileresizec+resize [+-]rowsgrow or shrink the current screenrew[ind][!]re-edit all the files in the file argument listrtag!w1o[Rr]ta[g][!] [string]edit the file containing the tag[line [,line]] s [[/;]RE[/;]repl[/;] [cgr] [count] [#lp]]substitute on lines matching an REsc[ript][!] [file]run a shell in a screenwNse[t] [option[=[value]]...] [nooption ...] [option? ...] [all]set options (use ":set all" to see all options)sh[ell]suspend editing and run a shellsourceso[urce] fileread a file of ex commandsst[op][!]suspend the edit sessionsu[spend][!][line [,line]] t line [flags][Tt]a[g][!] [string]tagnexttagn[ext][!]move to the next tagtagpoptagp[op][!] [number | file]return to the previous group of tagstagprevtagpr[ev][!]move to the previous tagtagtoptagt[op][!]discard all tagstcltc[l] cmdrun the tcl interpreter with the commandu[ndo]undo the most recent changeunabbreviateuna[bbrev] worddelete an abbreviation!w1runm[ap][!] worddelete an input or command map[line [,line]] v [;/]RE[;/] [commands]execute a global command on lines NOT matching an REdisplay the program version informationvisual2c11[line] vi[sual] [-|.|+|^] [window_size] [flags]enter visual (vi) mode from ex mode[Vv]i[sual][!] [+cmd] [file]edit another file (from vi mode only)viusage[viu]sage [key]display vi key usage statement[line [,line]] w[rite][!] [ !cmd | [>>] [file]]write the file[line [,line]] wn[!] [>>] [file]write the file and switch to the next filewq[line [,line]] wq[!] [>>] [file]write the file and exit[line [,line]] x[it][!] [file]bca[line [,line]] ya[nk] [buffer] [count]copy lines to a cut buffer3c01[line] z [-|.|+|^|=] [count] [flags]display different screens of the file[line [,line]] ~ [cgr] [count] [#lp]replace previous RE with previous replacement string,Add a new cscope databaseadd file | directoryQuery the databases for a patternfind c|d|e|f|g|i|s|t buffer|pattern c: find callers of name d: find all function calls made from name e: find pattern f: find files with name as substring g: find definition of name i: find files #including name s: find all uses of name t: find assignments to nameShow help for cscope commandshelp [command]Kill a cscope connectionkill numberDiscard all current cscope connectionscd '%s' && exec cscope -dl -f %s312|%d: no such cscope sessionNo cscope connections. %2d %s (process %lu) %s doesn't match any cscope command Command: %s (%s) cscope commands: %*s: %s cscope.outcscope.tpathCSCOPE_DIRS :309|Use "cscope help" for help310|No cscope connections runningsgdct efi311|%s: unknown search type: use one of %s%d%s cscope: %d lines%1[ ]%s: "%s" 278|No matches for query (line mode) (character mode)********** %s%s buffers123|No cut buffers to displaydefault bufferfilterfilter readparent-writer124|The %s command can't be used as part of a global or v command125|%s/%s: not sourced: not owned by you or root126|%s/%s: not sourced: not owned by you127|%s/%s: not sourced: writeable by a user other than the owner128|%s: not sourced: not owned by you or root129|%s: not sourced: not owned by you130|%s: not sourced: writeable by a user other than the owner/etc/vi.exrcNEXINIT.nexrc131|No following lines to join.?!132|No input map entries133|No command map entries134|The %s character may not be remapped135|"%s" isn't currently mapped136|Mark names must be a single character137|%s exists, not written; use ! to overrideabbreviate map map! 138|New exrc file: %s139|Destination line is inside move range140|The open command requires that the open option be set141|The open command is not yet implemented142|Preservation of this file not possible143|File preserved %6lu TOOBIG 147|Reading...148|%s: %lu lines, %lu characters145|Only regular files and named pipes may be read146|%s: read lock was unavailable149|No background screens to display151|No command to executescript-shell150|The script command is only available in vi modepqrs0123456789abcdefemacs:TERMCAPEMACSError: timed outError: shell: EOFAbort trapAlarm clockBus errorChild exitedContinuedEMT trapFloating point exceptionHangupIllegal instructionInformation requestInterruptI/O possibleIOT trapKilledBroken pipeProfiling timer expiredQuitSegmentation faultSuspended (signal)Bad system callTerminatedTrace/BPT trapSuspendedStopped (tty input)Stopped (tty output)Urgent I/O conditionUser defined signal 1User defined signal 2Virtual timer expiredWindow size changesCputime limit exceededFilesize limit exceededUnknown signal: %d; core dumped%.*s%s: received signal: %s%s%.*s%s: exited with status %d%s -i152|shiftwidth option set to 0RE error: %s([ ]|/\*([^*]|\*/)*\*/)*\^.[]$*+?()|{}^.[]$*[[:<:]][[:>:]]153|Count overflow154|Count underflow156|The #, l and p flags may not be combined with the c flag in vi mode169|Confirm change? [n]157|No match found155|Regular expression specified; r flag meaningless164|%s: the tag's line number is past the end of the file165|The tags stack is empty166|%s: search pattern not found159|Less than %s entries on the tags stack; use :display t[ags]160|No file %s on the tags stack to return to; use :display t[ags]292|Display too small.%2d ... %*.*s %*.*s255|Already at the first tag of this group282|Already at the last tag of this group158|No previous tag enteredrxglobal -%s '%s'162|%s: tag not found163|%s: corrupted tag in %smunmapTo see the list of vi commands, enter ":viusage" To see the list of ex commands, enter ":exusage" For an ex command usage statement enter ":exusage [cmd]" For a vi key usage statement enter ":viusage [key]" To exit, enter ":q!" The %.*s command is unknown Command: %s Usage: %s The %s key has no current meaning Key:%s%s Usage: %s 167|%d more files to edit168|Buffer %s is empty144|%s: expanded into too many file names283|The %s command requires the ex terminal interface272|That form of %s requires the ex terminal interface274|Command failed, no file read in yet.173|The %s command requires that a file have already been read in171|No previous buffer to execute172|No previous regular expression230|This screen may not be suspended290|The %s command is not supported when the secure edit option is set284|That form of %s is not supported when the secure edit option is set174|Usage: %sVersion 1.79 (10/23/96) The CSRG, University of California, Berkeley.175|The visual command requires that the open option be set%luz%c%lu%luz%c253|Writing...---------------------------------------- 302|Vi was not loaded with a Tcl interpreter306|Vi was not loaded with a Perl interpreter177|Empty file178|No previous F, f, T or t search179|%s not found[count]^A^A search forward for cursor word[count]^B^B scroll up by screens^C^C interrupt an operation (e.g. read, write, search)[count]^D^D scroll down by half screens (setting count)[count]^E^E scroll down by lines[count]^F^F scroll down by screens^G^G file status[count]^H^H move left by characters[count]^J^J move down by lines^L^L redraw screen[count]^M^M move down by lines (to first non-blank)[count]^N^N move down by lines[count]^P^P move up by lines^R^R redraw screen^T^T tag pop[count]^U^U half page up (set count)^V^V input a literal character^W^W move to next screen[count]^Y^Y page up by lines^Z^Z suspend editor^[ ^[ exit input mode, cancel partial commands^\ ^\ switch to ex mode^]^] tag push cursor word^^^^ switch to previous file[count]' ' move right by columns[count]![count]motion command(s) ! filter through command(s) to motion[count]# +|-|# # number increment/decrement [count]$ $ move to last column % move to match & repeat substitution'['a-z] ' move to mark (to first non-blank)[count]( ( move back sentence[count]) ) move forward sentence[count]+ + move down by lines (to first non-blank)[count], , reverse last F, f, T or t search[count]- - move up by lines (to first non-blank) . repeat the last command/RE[/ offset] / search forward 0 move to first character:command [| command] ... : ex command[count]; ; repeat last F, f, T or t search[count]<[count]motion < shift lines left to motion[count]>[count]motion > shift lines right to motion?RE[? offset] ? search backward@buffer @ execute buffer[count]A A append to the line[count]B B move back bigword[buffer][count]C C change to end-of-line[buffer]D D delete to end-of-line[count]E E move to end of bigword[count]F character F character in line backward search[count]G G move to line[count]H H move to count lines from screen top[count]I I insert before first nonblank[count]J J join lines[count]L L move to screen bottom M move to screen middle N reverse last search[count]O O insert above line[buffer]P P insert before cursor from buffer Q switch to ex mode[count]R R replace characters[buffer][count]S S substitute for the line(s)[count]T character T before character in line backward search U Restore the current line[count]W W move to next bigword[buffer][count]X X delete character before cursor[buffer][count]Y Y copy lineZZZZ save file and exit[[[[ move back section]] move forward section ^ move to first non-blank _ move to first non-blank`[`a-z] ` move to mark[count]a a append after cursor[count]b b move back word[buffer][count]c[count]motion c change to motion[buffer][count]d[count]motion d delete to motion[count]e e move to end of word[count]f character f character in line forward search[count]h h move left by columns[count]i i insert before cursor[count]j j move down by lines[count]k k move up by lines[count]l l move right by columnsm[a-z] m set mark n repeat last search[count]o o append after line[buffer]p p insert after cursor from buffer[count]r character r replace character[buffer][count]s s substitute character[count]t character t before character in line forward search u undo last change[count]w w move to next word[buffer][count]x x delete character[buffer][count]y[count]motion y copy text to motion into a cut buffer[line]z[window_size][-|.|+|^|] z reposition the screen[count]{ { move back paragraph[count]| | move to column[count]} } move forward paragraph[count]~ ~ reverse case207|The Q command requires the ex terminal interface180|No previous file to edit307|No ex command to execute%+ld0X%0*lX0x%0*lx%#0*lo182|Resulting number too large183|Resulting number too smallabcdefABCDEF181|Cursor not in a number184|No match character on this line185|Matching character not found186|No characters to replace308|Enter to execute a command, :q to exit187|No other screen to switch to190|Search wrapped to original position189|No previous search pattern188|Characters after search string, line offset and/or z command194|No more characters to erase193|Already at the beginning of the insert191|Abbreviation exceeded expansion limit: characters discarded192|Illegal character; quote to enterUnmatched %s201|Buffers should be specified before the command209|The file is empty202|Already at end-of-file203|Already at end-of-line204|%s isn't a vi commandWindow resize interrupted text input mode205|Usage: %s195|Movement past the end-of-file196|Movement past the end-of-line197|No cursor movement made198|Already at the beginning of the file199|Movement past the beginning of the file200|Already in the first column206|No characters to delete[count]~[count]motion ~ change case to motion235|Number larger than %lu234|Only one buffer may be specified208|No command to repeat210|%s may not be used as a motion command212|Cursor not in a word211|Already in command mode214|Windows option value is too large, max is %u110|Vi command failed: mapped keys discarded231|Interrupted: mapped keys discarded236|Interrupted%d screens backgrounded; use :display to list them%7lu +=+=+=+=+=+=+=+215|Append216|Change217|Command218|Insert219|Replace%lu,%lu220|Movement past the end-of-screen221|Movement past the beginning-of-screen222|Screen must be larger than %d lines to split225|You may not background your only displayed screen228|The screen cannot grow227|The screen cannot shrink226|The screen can only shrink to %d rows223|There are no background screens224|There's no background screen editing a file named %s q q  q q B q q B q g g you are not a member of group %s chown [-fhv] [-R [-H | -L | -P]] :group file ...usage: chown [-fhv] [-R [-H | -L | -P]] owner[:group] file ...usage: chgrp [-fhv] [-R [-H | -L | -P]] group file ...HLPRfhvthe -R%c and -h options may not be specified together: %ju:%ju -> %ju:%ju: %ju -> %juusage: chroot [-g group] [-G group,group,...] [-u user] newroot [command] G:g:u:no such group `%s'too many supplementary groups providedno such user `%s'setgroupssetgidsetuid(@ (@-G"'H" """"% ( W 0 H ($ ( (2 (((((( (@((((() )))) ")))@0)6)>)E)K)" R)@X)_)j)u)}|)L~)))))@)@) ))) ))){05P X^/n )@)E*4 4@Iz)y)s%q)*#*3*E*H*:{U*k*9KXH*7n***Y*< *****~\* +++-+N~E+OQ+r~b+t+++++++++U+g++X,,x",8,WF,V,d,g,{t,{,,,,,?L,,, - -"H@   !G=@" "" """   !"G""""0""" ""> I"""""TRZeS"""Y98O< AP^"F""VN"X\`b"Jd""" D"7Q;?BK"E "U"M"W[_aCLc""]":""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""2 ' "("   !-.60""("""""""""""""""""""""""""""""$""""""""""""""""""""""""#&"1"""""/"""""5"%""""""""#&"1"""""/""""""5"%""""""-M:+-NP:9-O:J-QW-t-J:-L--::-;--F,;-W\;.X.).[;<.\O.i.<z..E..7;.8<.?..A(<.B`< /a/'/=<7/e<?/@<S/H=b/GX=t/Z//Y//U=/V=/K=/P> 0_H>0`t>*0S>>0T>R0I[0y0b00]00d00c00>(? 191+1^H?>1CJ1g1Dp?w1R?1'?1&?16$@1-H@1.t@1%@1*@11 A150A2#lA2/A&2222I2)Z2w24A20B234B2$22+2 3,hB 3(B43C3;4X3r3B333 33 B3 C34C 4 |C4C'4C44CE4DN4`4{4"444444 5&555H5W5m5!4D5 55 55B5TD556D6D36DC6S6q6D64E6666660 h ) 8 د  ,  X  \  \  , ر H p P  d1 `    l       Я ȯ   ( @      0 0 t       Ժ Է  HA A $G > ? @ t F A LC A 0B G TI (A ? C |C E = D H> =  = 8= D = J E DE 8D dD @ X@  D D @ @ F 0G D D B tF F F C  7 7@7777@ 7@77 7a7@ 7777    d d d d d d d   ղ  l %-15s-> %s                                                                       /.editrc%s %d ) N N N N N r N N r N N N r r N N N N N N N N N N ) N N N ) N ) N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N N r N N N N ) N N N N ) N N N ) [1~[4~OAOBOCODOHOF b b b  b b b b b   b b b b b   b b  " $ b" " $ $  # -% $ $ fwdbck/ + / + / + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + / + + / / tty_stty7 w7 m7 c7 \7 R7 H7 `6 `6 >7 47 *7  7 7  7 7 6 6 6 `6 `6 `6 `6 6 6 P9 8 8 9 9 9 9 9 9 9 9 9 P9 : q: {: 8 ?; "; ; : : echotctelltcsettcsettyignbrkbrkintignparparmrkinpckistripinlcrigncricrnlixonixanyixoffimaxbelopostonlcrocrnlonocronoeotonlretxtabscignorecstopbcreadparenbhupclclocalccts_oflowcrts_iflowmdmbuficanonechoeechokechonlnoflshtostopechoctlechoprtechokeflushopendiniextennokerninfoextproceol2erase2discardminhas automatic marginshas physical tabsNumber of linesNumber of columnskmHas meta keyTab chars destructivexnadd new blank lineblaudible bellclear to bottomclear to end of linecursor to horiz posclear screendelete a characterdelete a linestart delete modeend delete modeeiend insert modecursor from status linehome cursorinsert characterstart insert modeinsert paddingkdsends cursor downklsends cursor leftkrsends cursor rightkusends cursor upbegin boldend attributesnon destructive spaceend standoutbegin standoutcursor to status linecursor up onebegin underlineend underlinevbvisible belldelete multiple charscursor down multipleinsert multiple charscursor left multipleRIcursor right multiplecursor up multiplekhsend cursor home@7send cursor endvi-paste-nextvi-paste-prevvi-prev-big-wordvi-prev-wordVi move to the previous wordvi-next-big-wordvi-next-wordVi move to the next wordvi-change-casevi-change-metaVi change prefix commandvi-insert-at-bolvi-replace-charvi-replace-modeVi enter replace modevi-substitute-charvi-substitute-lineVi substitute entire linevi-change-to-eolVi change to end of linevi-insertVi enter insert modevi-addvi-add-at-eolvi-delete-metaVi delete prefix commandvi-end-big-wordvi-end-wordvi-undoVi undo last changevi-command-modevi-zerovi-delete-prev-charvi-list-or-eofvi-kill-line-prevvi-search-prevVi search history previousvi-search-nextVi search history nextvi-repeat-search-nextvi-repeat-search-prevvi-next-charvi-prev-charvi-to-next-charvi-to-prev-charvi-repeat-next-charvi-repeat-prev-charvi-matchVi go to matching () {} or []vi-undo-lineVi undo all changes to linevi-to-columnVi go to specified columnvi-yank-endVi yank to end of linevi-yankVi yankvi-comment-outvi-aliasVi include shell aliasvi-to-history-linevi-histeditVi edit history line with vivi-history-wordvi-redoem-delete-or-listem-delete-next-wordem-yankem-kill-lineem-kill-regionem-copy-regionem-gosmacs-transposeem-next-wordem-upper-caseem-capitol-caseem-lower-caseem-set-markSet the mark at cursorem-exchange-markExchange the cursor and markem-universal-argumentem-meta-nextem-toggle-overwriteem-copy-prev-wordCopy current word to cursorem-inc-search-nextEmacs incremental next searchem-inc-search-prevem-delete-prev-chared-end-of-fileIndicate end of fileAdd character to the lineed-delete-prev-worded-delete-next-charDelete character under cursored-kill-lineCut to the end of lineed-move-to-ended-move-to-beged-transpose-charsed-next-chared-prev-worded-prev-chared-quoted-inserted-digited-argument-digitDigit that starts argumented-unassignedIndicates unbound charactered-tty-sigintTty interrupt charactered-tty-dsuspTty delayed suspend charactered-tty-flush-outputTty flush output charactersed-tty-sigquitTty quit charactered-tty-sigtstpTty suspend charactered-tty-stop-outputed-tty-start-outputTty allow output charactersed-newlineExecute commanded-delete-prev-chared-clear-screened-redisplayRedisplay everythinged-start-overed-sequence-lead-ined-prev-historyed-next-historyMove to the next history lineed-search-prev-historyed-search-next-historyed-prev-lineMove up one lineed-next-lineMove down one lineed-commandEditline extended commandiflag:oflag:cflag:lflag:chars:*?_-.[]~=%d %s""no input "%s..." Unbound extended key "%s" %-4s to %-7s-> %s %-15s-> is undefined %-15s-> %s Out of termcap string space. settc: Bad value `%s'. baud%s: Invalid switch `%c'. Standard key bindings Alternative key bindings Multi-character bindings Arrow key bindings %s %s %s: Invalid command `%s'. %s -> %s Your terminal has the following characteristics: It has %s meta key not It can%suse tabs hasdoes not have It %s automatic margins It %s magic margins (empty) %25s (%s) == %s ^D / ? : *[]?edit: Bad value `%s'. %c%s %s: Invalid argument `%s'. %*sc-- != 0/usr/src/lib/libedit/tty.cc != -1%s: Unknown switch `%c'. ()[]{}/tmp/histedit.XXXXXXXXXXnewline ignored at right marginVi paste previous deletion to the right of the cursorVi paste previous deletion to the left of the cursorVi move to the previous space delimited wordVi move to the next space delimited wordVi change case of character under the cursor and advance one characterVi enter insert mode at the beginning of lineVi replace character under the cursor with the next character typedVi replace character under the cursor and enter insert modeVi enter insert mode after the cursorVi enter insert mode at end of lineVi move to the end of the current space delimited wordVi move to the end of the current wordVi enter command mode (use alternative key bindings)Vi move to the beginning of lineVi move to previous character (backspace)Vi list choices for completion or indicate end of file if empty lineVi cut from beginning of line to cursorVi repeat current search in the same search directionVi repeat current search in the opposite search directionVi move to the character specified nextVi move to the character specified previousVi move up to the character specified nextVi move up to the character specified previousVi repeat current character search in the same search directionVi repeat current character search in the opposite search directionVi comment out current commandVi go to specified history file line.Vi append word from previous input lineVi redo last non-motion commandDelete character under cursor or list completions if at end of lineCut from cursor to end of current wordPaste cut buffer at cursor positionCut the entire line and save in cut bufferCut area between mark and cursor and save in cut bufferCopy area between mark and cursor to cut bufferExchange the two characters before the cursorMove next to end of current wordUppercase the characters from cursor to end of current wordCapitalize the characters from cursor to end of current wordLowercase the characters from cursor to end of current wordUniversal argument (argument times 4)Add 8th bit to next character typedSwitch from insert to overwrite mode or vice versaEmacs incremental reverse searchDelete the character to the left of the cursorDelete from beginning of current word to cursorMove cursor to the end of lineMove cursor to the beginning of lineExchange the character to the left of the cursor with the one under itMove to the right one characterMove to the beginning of the current wordMove to the left one characterAdd the next character typed verbatimAdds to argument or enters a digitTty disallow output charactersClear screen leaving current line at the topErase current line and start from scratchFirst character in a bound sequenceMove to the previous history lineSearch previous in history for a line matching the currentSearch next in history for a line matching the currentkey_add: sequence-lead-in command not allowed key_add: Null extended-key not allowed. key_delete: Null extended-key not allowed. Some extended keys too long for internal print bufferechotc: Warning: Too many required arguments (%d). echotc: Warning: Missing argument. echotc: Termcap parameter `%s' not found. echotc: Warning: unknown termcap %% `%c'. echotc: Bad value `%s' for rows. echotc: Bad value `%s' for cols. echotc: Warning: Extra argument `%s'. %s: Invalid \ or ^ in instring. %s: Invalid \ or ^ in outstring. using dumb terminal settings. No entry for terminal type "%s"; Cannot read termcap database; It has %d columns and %d lines unknown errorfirst event not foundlast event not foundempty listno next eventno previous eventcurrent event is invalidcan't read history from filecan't write historyhistory size negativebad parametersrequired parameter(s) not suppliedfunction not allowed with other history-functions-set the default)H'H=HRH]HkH}HBHHHHHIH_HiStOrY_V2_ U U YU IU 9U )U U  U {W sW W U W W W T T }S Q Q Q Q |Q  H\ [ [ \ (\ P^ [ A^ $^ [ \ ]] P] \ [ ^ ] [ \ [ ^ [ ] \ [ g^ _^ _^ ] ^ Dump of gctl request at %p: error: NULL param: "%s" (%d) [%s%s%d] = error: "%s" %d] = "%s"0] = %pDump of gctl request at NULL Could not allocate memoryNULL request pointer/dev/geom.ctlcan't allocate %u bytes: %s/dev/mem/dev/kmemexec file name too longbad flags arginvalid address (%x)short readkvm_readkvm_writekvm_write not implemented for dead kernelscannot mmap corefilekernbaseCannot read PDPTcannot read PDPTcannot read IdlePDPTcannot allocate vmcannot read IdlePTDbad namelistcannot read PTDvatop called in live kernel!_kvm_vatop_pae: lseekinvalid address (0x%lx)_kvm_vatop: lseek_kvm_vatop: pde not valid_kvm_vatop: pdpe_pa not found_kvm_vatop: pde_pa not found_kvm_vatop: read_kvm_vatop_pae: read_kvm_vatop_pae: pte not valid_kvm_kvatop: pte not valid_kvm_vatop: address not in dump_kvm_kvatop_pae: pde not valid_kvm_vatop_pae: pdpe_pa not found_kvm_vatop: bootstrap data not in dump_kvm_vatop_pae: bootstrap data not in dump_kvm_vatop_pae: pde_pa not found_kvm_vatop_pae: address not in dump%03dw  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v v  v  v  v  v  v tv  v  v }v  v  v  v u v  v  v  v  v  v  v  v  v  v  v v  v  v  v v  v Kw  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v  v 6w  v  v  v  v @w  v  v  v  v w  v  v  v %w CCCMvshdtimhmkmraei1i3kbkCktkDkLkMkEkSk0k1k;k2k3k4k5k6k7k8k9kIkAkHkNkPkFkRkTl0l3l4l5l6l7l8l9monwSFSRpkpxpfpouciPK1K3K2K4K5pOrPkBSXRXSARAXNXFeALOLF@1@2@3@4@5@6@8@9@0%1%2%3%4%5%6%7%8%9%0&1&2&3&4&5&6&7&8&9&0*1*2*3*4*5*6*7*8*9*0#1#2#3#4%a%b%e%f%g%h%i%j!1!2!3RFF1F2F3F4F5F6F7F8F9FAFBFCFEFGFHFIFJFKFMFNFPFQFUFVFWFXFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFrcbMCMLMRLfDKCWWGHUQDTOPUfhPAWAu0u2u3u4u5u6u7u8u9IcIpSfSbZAZBZCZDZFZGZHZIZJZKZLZMZNZOZPZQZRZSZTZUZVZWZXZYZaZbZcZdZeZfZgZhZiZjZkZlZmZnZoZpZqZrZsZtZuZvZwZxZyKmMiRQGmdvciXyZzYvYwYxYyYzYZS5S6S7S8XhXlXoXrXtXvsAsLbxNllhlwMWCoNCYaYbYcYdYeYfYgYhYiYjYkYlYmYnBTYoYpbwxbxshcdamimshzxonxHCNRNPhlYAYBYCYDYEYFYG q*(FI< YP}N~d1wPmPxP8[hUP~\Pr~P~PWQPg+Xd,P;PO7P<PPPP+PPPPPPPPPPPPPP,PP+PPP+PPP+PF)PQQQ Q QQQ}zQx{{{Qi,Q?LQ{{!Qty$Q'Q(.4bykPz.xWwx*Q-Q0Q3Q6Q9QRARVDRGRMX{JRMRPRSRX`VRYR\R_RbReRhRkRnRqRtRwRzR}RRRRRRRRRRRaRcgRRRRRRRRRR8RRRRRRRRzRRRRRRRR/RRRRRRSSS S SSSSSSS"S%S(S+S.S1S4S7S:S=S@SCSFSISLSOSRSUSXS[S^SaSdSgSjSmSpSsSvSyS|SS~SSqyzzRKXSSSSSSSSqmieSSSSSSSSSSSSejSl}4B)~sSSSSS~SSSSSSSSSSSSSSTTT TA T%qTTk*TE*JuT:TTb:{!T=$T'Tx*T-T0TSx!(3T6T9T%t9%e%p1%d%;m[3%p1%dm[3%?%p1%{8}%>%t9%e%p1%d%;m A8 !   L  x2d2d2dJ2d<2d,2d2d  Out of memoryl. 4. 4. l. 4. 4. 4. 4. 4. 4. 4. 4. 4. . / 4. 4. 4. 4. 4. 4. 4. 4. 4. 4. 4. w/ 4. 4. 4. 4. 4. 4. 4. 4. 4. 4. 4. 4. 4. 4. 4. 4. 4. 4. 4. 4. 4. 4. 4. 4. 4. 4. 4. 4. 4. f/ 4. 4. 4. 4. 4. 4. 4. 4. 4. 4. f/ f/ 4. 4. 4. 4. 4. 4. 4. 4. 4. 4. f/ 4. 4. 4. f/ 4. 4. 4. 4. f/ / / / / / / 0 / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / 0 / / / / / / / / / / / / / / / / / / / / / / 0 / F0 / / &0 / / / - / / &0 / / / / / / / / / / / 1 0 0 1 0 0 0 0 0 0 0 0 0 1 2 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 0 0 0 0 0 0 1 0 0 0 1 0 0 0 0 1 : 2 2 2 : 8 L8 2 2 ; 9 2 \; 2 6 2 2 2 2 2 2 2 2 2 2 2 2 M: 9 ; 2 2 7 2 2 2 2 2 2 2 2 2 2 2 2 2 @9 8 2 2 2 2 2 2 2 =2 2 2 2 2 2 4 2 2 2 2 =2 =2 @4 2 7 2 q7 2 2 u5 4 2 =2 7 2 2 6 3 2 2 2 =2 2 2 Z3 3 2 2 NCURSES_NO_SETBUF'%s': unknown terminal type. terminals database is inaccessible TERM environment must be <= %d characters. '%s': I need something more specific. TERM environment variable not set. Not enough memory to create terminal structure. '%s': I can't handle hardcopy terminals. TERMPATH/usr/share/misc/termcap|:.termcap /usr/share/misc/termcap2Kn,X   `  %Kterminal names must start with letter or digitset_color_pair but no initialize_pairenter_underline_mode but no exit_underline_modeexit_standout_mode but no enter_standout_mode``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~display_clock but no remove_clockenter_alt_charset_mode but no exit_alt_charset_modeexit_alt_charset_mode but no enter_alt_charset_modeenter_bold_mode but no exit_attribute_modeenter_blink_mode but no exit_attribute_modeexit_alt_charset_mode but no acs_charsenter_alt_charset_mode but no acs_charsremove_clock but no display_clockenter_am_mode but no exit_am_modeexit_am_mode but no enter_am_modeenter_xon_mode but no exit_xon_modeexit_xon_mode but no enter_xon_modesave_cursor but no restore_cursorrestore_cursor but no save_cursorfrom_status_line but no to_status_lineto_status_line but no from_status_lineenter_reverse_mode but no exit_attribute_modeenter_protected_mode but no exit_attribute_modeenter_secure_mode but no exit_attribute_modeenter_insert_mode but no exit_insert_modeexit_insert_mode but no enter_insert_modeenter_dim_mode but no exit_attribute_modeenter_delete_mode but no exit_delete_modeexit_delete_mode but no enter_delete_modeexit_ca_mode but no enter_ca_modeenter_ca_mode but no exit_ca_modeexit_underline_mode but no enter_underline_modeenter_standout_mode but no exit_standout_moderesolution of use=%s failedName collision between %slabel_off but no label_onprtr_on but no prtr_offprtr_off but no prtr_onmeta_off but no meta_onmeta_on but no meta_off/usr/share/misc/terminfoTERMINFO%c/%.*sTERMINFO_DIRS7I qqYn< ` qIzZ!+qN~Or~qw+?qxW!qw5  kcbtkclrkrmirkICkentkhtsprimary name%s `%.*s' may be too longnumericunknown capability '%s'%s$<%d>unknown token typeno value for ko capability %sextended capability '%s'wrong type used for %s capability '%s'acsc string synthesized from XENIX capabilitieshardware tabs with a width other than 8: %dunknown capability `%.*s' in ko string%s (%s) already has an explicit value %s, ignoring koacsc string synthesized from AIX capabilitiesko translation table is invalid, I give up%s (%s termcap extension) aliased to %s%s (%s terminfo extension) ignoredEntry does not start with terminal names in column one%s (%s terminfo extension) aliased to %s%s (%s termcap extension) ignoredhardware tabs with a non-^I tab string %s%s/.terminfoVery long string found. Missing separator?Non-octal digit `%c' in \ sequenceIllegal character %s in \ sequenceCan't backspace off beginning of lineIllegal character (expected alphanumeric or %s) - %sMissing separator after `%s', have %swhitespace in name or alias fielddubious character `%c' in name or alias fieldslashes aren't allowed in names or aliasesSeparator inconsistent with syntaxIllegal ^ character - %sAllow ^? as synonym for \177Premature EOFIllegal character - %sempty longname field$[]!*?no value given for `%s'Missing separatorpremature EOFĽ { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { { ( { { { { { { { { { { { { {  { { { { { { { { { {  { { { { { { { { { { { { { { { { { { { { { {  {  { {   { {   { { { { {  {  { { {  ؿ п @%&*!#font0s0dsIBMfont1s1dsfont2s2dsfont3s3dskbtabkselksltBOAT&TCICVXSEEXENIXGSCFCOHMLDPNPSG6G7G8GrGuGdGhGvGcGGkqIRISKATekKBKCKDKEKFBCxsbxhpxenlmsgresloknxonmc5ichtsnrrmcnpcndscrcccbcehlsxhpacrxmdaisyxvpasamcpixlpixxmcwslnlabwnumncvbufszspinvspinhmaddrmjumpmcsnpinsorcorlorhiorvicpswidcsbtnsbitwinbitypecsrcmdchcivismrcupcnormcvvisdslsmacsblinksmdcdimsmirinvisprotsmulechrmacssgr0rmdcrmulfslis1is2is3kbsktbckctabkf0kf1kf10kf2kf3kf4kf5kf6kf7kf8kf9rmkxsmkxlf0lf1lf10lf2lf3lf4lf5lf6lf7lf8lf9rmmsmmpadindnrinpfkeypflocpfxmc0mc4mc5rs1rs2rs3tsliprogka1ka3kb2kc1kc3mc5prmpacscplnsmxonrmxonsmamrmamxoncxoffcenacssmlnrmlnkbegkcankclokcmdkcpykcrtkextkfndkhlpkmrkkmsgkmovknxtkopnkprvkprtkrdokrefkrfrkrplkrstkresksavkspdkundkBEGkCANkCMDkCPYkCRTkDCkDLkENDkEOLkEXTkFNDkHLPkHOMkLFTkMSGkMOVkNXTkOPTkPRVkPRTkRDOkRPLkRITkRESkSAVkSPDkUNDrfikf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63el1mgcsmglsmgrflnsclkdclkrmclkcwinwingohupqdialpulsewaitinitcinitpscpsetfsetbcpilpichrcvrdefcswidmsdrfqsitmslmsmicmsnlqsnrmqsshmssubmssupmsumrwidmritmrlmrmicmrshmrsubmrsupmrummhpamcud1mcub1mcuf1mvpamcuu1pordermcudmcubmcufmcuuscssmgbsmgbpsmglpsmgrpsmgtsmgtpsbimscsdrbimrcsdsubcssupcsdocrzeromcsnmkmousreqmpgetmsetafsetabpfxldevtcsinsmglrsmgtbbirepbinelbicrcolornmdefbiendbisetcolorslinesdispcsmpchrmpchsmscrmscpctrmscescscesaehhlmelhlmelohlmerhlmethlmevhlmsgr1slengthOTi2OTrsOTugOTbsOTnsOTncOTdCOTdNOTnlOTbcOTMTOTNLOTdBOTdTOTknOTkoOTmaOTptOTxrOTG2OTG3OTG1OTG4OTGROTGLOTGUOTGDOTGHOTGVOTGCmemlmemubox1xxxx$xx)x/xx4x:xx?xqxExJxxxpOxPRxWxd1RxZxRx[BPRx,R`QRx]QRx]xPRx`xPcx:`Pcxix8cxlxd1cxoxcx -cxrx,cxuxPcx|Pcxxx'Qcx{x$QcxRPcx{uQcx?L+cx~xcxxcxF!cxxcxxcxxcxxcxxcxxcxxcxxcxxcxx~QxPxxPxxRxx RxxRxxRxxRxxRx)RRx\$LԠpĕD,h`$Lt|,̢t4lDЧ4@̨D h <L0ԣ\PxĒ|`ؙЛH0xPЕ048phH`ܡP(ؖ$TXTH`8 ĘXPĤ P@4t t,\T0x`X<H\ 4$ВlT8ĞXl<\@|l؜̟40dHDИlħ̥lФ,ب\ܧ|(88xdH̓hDL`lDxО<hX HȦġ ,@ȠxXl ؟|@<@p`xT |Pܘ(,08(إ$ԗܤ0  ܛ8xPdh@\$ȣ̜D0pTؓt$|ܕȚܞ(d<T$آС@ T%qTTk*TE*J u T : T Tb:{!T=$T'Tx*T-T0TSx!(3T6T9TP?P@PAPBPCPDPEPFPGPHPIPJPK,LPMPN+OPPPQPR+SPTPUPV+WXYPZ[F\#)]P^Q_Q`Qa Qb QcQdQe}zfxQgxh{i{j{klQmino,poQq?LrQs{{t!Qutyv$Qw'Qxy(z.{4|}by~kPz.xWwx*Q-Q0Q3Q6Q9QR<AR=V>DR?GR@MXAB{DJREMRPRSRX`VRYR\R_RbReRhRkRnR^qRtRwRzR}RRR R R R R RRRRaRcgRRRRRRRRRR8 R!R"R#R$R%R&R'R()z*R+R,-R.R/R0R1R2R3/4R50R6R7R8R9R:S;S<S= S> S?S@SASBSCSDgSE"SFh%SG(SHI+SJ.SK1SL4SM7SN:SO=SP@SQCSRFSSISTLSUOSVRSWUSXXSY[SZ^S[aS\dS]gS^jS_mS`pSasSbvScySd|SeSfgh~iSjSkqlymCznzoRpUKXqSrSsStSuSvSwSxSyqzm{i|e}eS~fSgShSiSSSSSSSSejA!t%y&~'"#KX()$%&{*+S |``$htDh4 @Ld,\,Ĺ4X` 8(0p@Tdxl<Ll H Hh0Pp0|H غp<PPH($xLtйl8\X T84l\DPxdTȾ(8@|xXH,̽DtD|\pxd4pd$TtlĿ\ ļ$@ P<0l8 XLtԾ8D\PL| <T8<`0<h @$$H,`п$ ܼ,<d0,Hl x@ T%qxxxTE*J u T : q xx:{!T=(xxxxxxxxxyy y y!y"y#y$l}4#yB)~'y+yS S  0y j 5y9y.?yEyKyQyWyG[yayeyiynysywy}yyy D q(yz~y y I" - y ,yy@m6y[yPyy+yyyy y!p/" #y$y%y&y'w(y)q*+y,e-.y/y0z1;z2L34J56 z7 z8 q9bz:Z;<!=q>`?n@zAzB zC%zD)zE-zF1zG=5zH9zI=zJAzKLMIN+OPжQR?SrT7Ui!qV5WQEzXJzYOzZSz[Wz\\z]`z^!dz_hz`lzapzbtzc^xzd|zezf~gzhij-~k<lzmVn2~o7~pzq<~rzs3ztzuzvzwzx~yzzz{z|~}by~~z%xx>Hz*Qzzzzzzzzzzqzzzzz{ {{{{{${){.{3{6q8{={B{G{FL{Q{V{[{'`{e{j{o{t{y{~{P{{{{{{{e{{{{Jx{{{{{{ q{H{{{{{{{{|| |||| |%|*|/|4|9|+>|C|H|M|R|W| \|!a|"f|#k|$p|%u|&z||(|)|*|+|,|-|.|/|0||2|3|4|5|6|7|8|9|:||<|=|>|?|@|A}B}C }D}} F} G} H$} I)} -}1}O6}L;}?}D}I}O}%T}Z}^}d}j}R8 R!R"R#R$R%R&R'R()z*o}+u},{}-}.E}/}0}1}2}3}4}5}6}7}8}9}:};}<N}=}>}?}@}A}B}C}Dp}E}F}G~H~I~J~K5~L~M/%~N,~O1~P6~Q;~R@~SD~TI~UO~VU~W[~X`~Yf~Zk~[Xp~\u~]z~^|~_~`~a~b[~ctd~e~fW~g~h~i~j~kxl$xm/xnm:xo~p~q~r~s~t~u~v~w~x~ytz {|}R~%+17=DJPV[chm!r%w&|'"# ()$%&*+<yI'm confused%'%{%{127}%^string too complex to convert%{96}%^string may not be optimal%Pa%ga$</>%2d%3dsaw %%r twice in %ssaw %%n twice in %ssaw %%m twice in %s%-%c%+%c%\%{2}%*%-%{10}%/%{16}%*%{10}%m%+%?%>%t%+%;%/\%03o%>%%?%%{%d}%%>%%t%%{%d}%%+%%;%%?%%{%d}%%>%%t%%'%c'%%+%%;%%?%%'%c'%%>%%t%%{%d}%%+%%;%%?%%'%c'%%>%%t%%'%c'%%+%%;%%{%d}%%+%%c%%'%c'%%+%%c%n%B%D%.doxX.%runknown %% code %s (%#x) in %se M M M M M  M b  M ; M s  M M M M 4 M M M M M  M M M M M 4 M M M M M M M M M M M M M M M M M M M M M M M * M M M M   M  M  M M : M M M   M M M  I   _  _ i _ _ _ _ _ _ _ _ _ _ _ _ _ : x                                                               V                ^@^K^O^Q^S^X^[^_`~@~A~B~C~D~E~F~G~H~I~J~K~L~M~N~O~P~Q~R~S~T~U~V~W~X~Y~Z~[~\~]~^~_ 8wn-Fa5Vm!g)Vjag9(jE9vlqRQQXbQ,H9 Wt9O\aoS9Rj{k5Uxk |XWR=a"$QQvfgQQQQQQaJ MJ(o)*S~&),/258;>ADGJMPSVY\_behknqtwz}   "$&(*,.02468:<>@BD(null)(cancelled)\%03lo, line %d, col %d, terminal '%s'back_tabchange_scroll_regionclear_all_tabsclear_screenclr_eoscommand_charactercursor_addresscursor_downcursor_homecursor_invisiblecursor_leftcursor_mem_addresscursor_normalcursor_rightcursor_to_llcursor_upcursor_visibledelete_characterdis_status_linedown_half_lineenter_alt_charset_modeenter_blink_modeenter_bold_modeenter_ca_modeenter_delete_modeenter_dim_modeenter_insert_modeenter_secure_modeenter_protected_modeenter_reverse_modeenter_standout_modeenter_underline_modeerase_charsexit_alt_charset_modeexit_attribute_modeexit_ca_modeexit_delete_modeexit_insert_modeexit_standout_modeexit_underline_modeflash_screenform_feedfrom_status_lineinit_1stringinit_2stringinit_3stringinit_fileinsert_characterinsert_paddingkey_backspacekey_catabkey_clearkey_ctabkey_dckey_dlkey_downkey_eickey_eolkey_eoskey_f0key_f1key_f10key_f2key_f3key_f4key_f5key_f6key_f7key_f8key_f9key_homekey_ickey_ilkey_leftkey_llkey_npagekey_ppagekey_rightkey_sfkey_srkey_stabkey_upkeypad_localkeypad_xmitlab_f0lab_f1lab_f10lab_f2lab_f3lab_f4lab_f5lab_f6lab_f7lab_f8lab_f9parm_dchparm_delete_lineparm_down_cursorparm_ichparm_indexparm_insert_lineparm_left_cursorparm_right_cursorparm_rindexparm_up_cursorpkey_keypkey_localpkey_xmitprint_screenrepeat_charreset_1stringreset_2stringreset_3stringreset_filerestore_cursorsave_cursorscroll_forwardscroll_reverseset_attributesset_tabset_windowto_status_lineunderline_charup_half_lineinit_progkey_a1key_a3key_b2key_c1key_c3prtr_nonchar_paddingacs_charsplab_normkey_btabenter_xon_modeexit_xon_modeenter_am_modeexit_am_modexon_characterxoff_characterena_acslabel_offkey_begkey_cancelkey_closekey_commandkey_copykey_createkey_endkey_enterkey_exitkey_findkey_helpkey_markkey_messagekey_movekey_nextkey_openkey_optionskey_previouskey_printkey_redokey_referencekey_refreshkey_replacekey_restartkey_resumekey_savekey_suspendkey_undokey_sbegkey_scancelkey_scommandkey_scopykey_screatekey_sdckey_sdlkey_selectkey_sendkey_seolkey_sexitkey_sfindkey_shelpkey_shomekey_sickey_sleftkey_smessagekey_smovekey_snextkey_soptionskey_spreviouskey_sprintkey_sredokey_sreplacekey_srightkey_srsumekey_ssavekey_ssuspendkey_sundoreq_for_inputkey_f11key_f12key_f13key_f14key_f15key_f16key_f17key_f18key_f19key_f20key_f21key_f22key_f23key_f24key_f25key_f26key_f27key_f28key_f29key_f30key_f31key_f32key_f33key_f34key_f35key_f36key_f37key_f38key_f39key_f40key_f41key_f42key_f43key_f44key_f45key_f46key_f47key_f48key_f49key_f50key_f51key_f52key_f53key_f54key_f55key_f56key_f57key_f58key_f59key_f60key_f61key_f62key_f63clr_bolclear_marginsset_left_marginset_right_marginlabel_formatset_clockdisplay_clockremove_clockcreate_windowgoto_windowhangupdial_phonequick_dialflash_hookfixed_pausewait_toneuser0user1user2user3user4user5user6user7user8user9orig_pairorig_colorsinitialize_colorinitialize_pairset_color_pairset_foregroundset_backgroundchange_char_pitchchange_line_pitchchange_res_horzchange_res_vertdefine_charenter_doublewide_modeenter_draft_qualityenter_italics_modeenter_leftward_modeenter_micro_modeenter_near_letter_qualityenter_normal_qualityenter_shadow_modeenter_subscript_modeenter_superscript_modeenter_upward_modeexit_doublewide_modeexit_italics_modeexit_leftward_modeexit_micro_modeexit_shadow_modeexit_subscript_modeexit_superscript_modeexit_upward_modemicro_column_addressmicro_downmicro_leftmicro_rightmicro_row_addressmicro_uporder_of_pinsparm_down_microparm_left_microparm_right_microparm_up_microselect_char_setset_bottom_marginset_bottom_margin_parmset_left_margin_parmset_right_margin_parmset_top_marginset_top_margin_parmstart_bit_imagestart_char_set_defstop_bit_imagestop_char_set_defsubscript_characterssuperscript_charactersthese_cause_crzero_motionchar_set_nameskey_mousemouse_inforeq_mouse_posget_mouseset_a_foregroundset_a_backgroundpkey_plabdevice_typecode_set_initset0_des_seqset1_des_seqset2_des_seqset3_des_seqset_lr_marginset_tb_marginbit_image_repeatbit_image_newlinebit_image_carriage_returncolor_namesdefine_bit_image_regionend_bit_image_regionset_color_bandset_page_lengthdisplay_pc_charenter_pc_charset_modeexit_pc_charset_modeenter_scancode_modeexit_scancode_modepc_term_optionsscancode_escapealt_scancode_escenter_horizontal_hl_modeenter_left_hl_modeenter_low_hl_modeenter_right_hl_modeenter_top_hl_modeenter_vertical_hl_modeset_a_attributesset_pglen_inchtermcap_init2termcap_resetlinefeed_if_not_lfbackspace_if_not_bsother_non_function_keysarrow_key_mapacs_ulcorneracs_llcorneracs_urcorneracs_lrcorneracs_lteeacs_rteeacs_bteeacs_tteeacs_hlineacs_vlineacs_plusmemory_lockmemory_unlockbox_chars_1init_tabslines_of_memorymagic_cookie_glitchpadding_baud_ratevirtual_terminalwidth_status_linenum_labelslabel_heightlabel_widthmax_attributesmaximum_windowsmax_colorsmax_pairsno_color_videobuffer_capacitydot_vert_spacingdot_horz_spacingmax_micro_addressmax_micro_jumpmicro_col_sizemicro_line_sizenumber_of_pinsoutput_res_charoutput_res_lineoutput_res_horz_inchoutput_res_vert_inchprint_ratewide_char_sizebuttonsbit_image_entwiningbit_image_typemagic_cookie_glitch_ulcarriage_return_delaynew_line_delaybackspace_delayhorizontal_tab_delaynumber_of_function_keysauto_left_marginno_esc_ctlcceol_standout_glitcheat_newline_glitcherase_overstrikegeneric_typehard_copyhas_status_lineinsert_null_glitchmemory_abovememory_belowmove_insert_modemove_standout_modeover_strikestatus_line_esc_okdest_tabs_magic_smsotilde_glitchtransparent_underlineneeds_xon_xoffprtr_silenthard_cursornon_rev_rmcupno_pad_charnon_dest_scroll_regioncan_changeback_color_erasehue_lightness_saturationcol_addr_glitchcr_cancels_micro_modehas_print_wheelrow_addr_glitchsemi_auto_right_margincpi_changes_reslpi_changes_resbackspaces_with_bscrt_no_scrollingno_correctly_working_crgnu_has_meta_keylinefeed_is_newlinehas_hardware_tabsreturn_does_clr_eol*6 )5HVcpz 2DYl !.8IVcpzP &-4;BKRYbis}kk5 &7@K\mikk!0?NVap $2AQkIS[fp|'3?KV_kt}  *4AOZdq|&.6>FNV^fnv~&.6>FNV^ftd} %+17=CIOU[eq%9L`q*:K_u%5G^s+7FP[is ,FRj 1J]o'5BO\ir{ q(yz~yy"-y,yy@m6y[yPyy+yyyyyp/ yyyywyqyeyyzzJ z z qzZ!q`nzz z%z)z-z1z5z9z=zAzI+ж?r!q5EzJzOzSzWz\z`zdzhzlzpztzxz|zz~z-~<zV2~7~z<~zzzzzz~zzzby~z%xx>Hz*Qzzzzzzzzzzqzzzzz{ {{{{{${){.{3{q8{={B{G{L{Q{V{[{'`{e{j{o{t{y{~{{{{{{{{{{{{Jx{{{{{{q{{{{{{{{{|| |||| |%|*|/|4|9|>|C|H|M|R|W|\|a|f|k|p|u|z|||||||||||||||||||||||||||}} }}}}}$})}-}1}6};}?}D}I}O}T}Z}^}d}j}R8RRRRRRRRzo}u}{}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~%~,~1~6~;~@~D~I~O~U~[~`~f~k~p~u~z~~~~~~t~~~~~~~x$x/x:x~~~~~~~~~~ %+17=DJPV[ch=*!3>KWfv +;Pep l}4#yB)~'y+ySS0yj5y9y?yEyKyQyWyG[yayeyiynysywy}yyym# 4@Uhy%2NHWco} 2BRev T%qxxxTE*JuT:qxx:{!T=(xxxxxxxxxyy yyyyyrw|/var/log/wtmpinvalid hostnamehumanize_numberBkMGTPEBKMGTPEKMGTPEkMGTPE%lld%s%s%s%d%s%d%s%s%sscale >= 0suffix != NULLbuf != NULL/usr/src/lib/libutil/humanize_number.c\\#0123456789%s: illegal option -- %c %s: option requires an argument -- %c %Y-%m-%d%m/%d/%y%H:%M%H:%M:%S                                                                   ' 7          J     o J                             G       A 0  REG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEtrailing backslash (\)REG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTREG_EMPTYempty (sub)expressionREG_ASSERTREG_INVARGREG_ILLSEQillegal byte sequenceREG_0x%xrepetition-operator operand invalid"can't happen" -- you found a buginvalid argument to regex routine*** unknown regexp error code ***/etc/mac.confMAC_CONFFILEdefault_labelsdefault_ifnet_labelsdefault_file_labelsifnetdefault_process_labelspacket.=security.mac.security.macconnect to address %s: RSHrcmd: socket: %s rcmd: too many files rcmd: getaddrinfo: %s rcmd: %s: %s rcmd: accept: %s .rhosts fstat failed/etc/hosts.equiv.rhosts lstat failed.rhosts not regular filebad .rhosts ownerrcmd: socket: All ports in use rcmd: write (setting up stderr): %s rcmd: select (setting up stderr): %s socket: protocol failure in circuit setup. select: protocol failure in circuit setup .rhosts writeable by other than ownerPOSIXUS-ASCIIF F F F ~F nF ^F PF PF PF PF PF PF PF BF BF BF BF BF BF BF 4F 4F 4F 4F 4F 4F 4F 4F 4F 4F 4F 4F #F #F #F #F #F #F #F #F #F #F #F #F E E E E E F SG GG 7G 'G G oE G 0%XK PJ PJ PJ PJ PJ PJ K |K oK bK UK HK ;K PJ PJ PJ PJ PJ PJ PJ PJ PJ PJ PJ PJ PJ PJ PJ PJ PJ PJ .K &O kN ON BN -N N M 9M O [O [O [O [O [O [O [O [O [O [O [O [O [O [O [O [O [O [O [O [O [O [O [O [O [O O [O [O [O [O [O [O [O [O [O [O [O O O O O O O O O [O [O [O [O [O [O [O [O [O [O [O [O [O O [O [O [O [O [O [O [O O [O [O [O [O [O [O [O [O [O [O [O [O [O [O O [O aN [O [O O O [O [O [O O [O [O [O [O [O [O [O P [O [O [O P  P P [O O __libc_allocate_tlstcbsize >= 2*sizeof(Elf_Addr)/usr/src/lib/libc/gen/tls.cnosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenosunlnknosunlinknosnapshotnouappndnouappendnouchgnouchangenouimmutablenodumpnoopaquenouunlnknouunlink , @4z` w9_koL'>@Z}405INRXVZ_´c*R5glqv{~VSignal 0abrtemtfpebussegvsysurgcontchldttinttouioxcpuxfszvtalrmprofwinchusr1usr2H^ d\ d\ d\ d\ d\ d\ d\ d\ d\ d\ d\ d\ d\ d\ ] d\ d\ d\ d\ d\ d\ d\ ] d\ d\ <^ ^ ] ] d\ ] \ BLOCKSIZE%ld%s-blocksminimum blocksize is 512%s: unknown blocksizemaximum blocksize is %ldG/boot/kernel/kernelnfs4/etc/fstabfstab: PATH_FSTAB/etc/disktabremovabledtsusimulated#NODEV#%c:%d:0x%xkern.devname_COMPAT_FreeBSD_4/etc/compat-FreeBSD-4-util%04d%4d%e-%b-%Ystrftime format "%s" all localesthe current localeNULL strftime format some locales                                                                 ! L r    O  "    Y  n       O  R 2        a      O   > W o             P f CHECK_STRFTIME_FORMATS_FOR_TWO_DIGIT_YEARSyields only two digits of years in shut up gccNULSOHSTXETXEOTENQBELalertBSHTVTvertical-tabform-feedcarriage-returnSODC1DC2DC3DC4NAKSYNETBEMSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfivesixsevenninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELUTF-8d<<<<p<p<p<p<p<g<==p<p<p<p<p<p<==@>>>?>c?c?>>j?>>>>>>>>>>>>>>>>c?>>>>>>>>>>>>>>>>>>>>>>>>>>>W?>?>?>>>>>>>>>>>>>>>>>>>>>>>>>>>>t>?rcmdsh: dup2 failed/usr/bin/rshrcmdsh: setuid(%u): %s rcmdsh: socketpairrcmdsh: getaddrinfo: %s rcmdsh: fork failedrcmdsh: unknown user: %s rcmdsh: execlp %s failed: %s rcmdsh: fork to lose parent failedInvalid value for ai_flagsai_family not supportedMemory allocation failureai_socktype not supportedInvalid value for hintsResolved protocol is unknownUnknown errorAddress family for hostname not supportedTemporary failure in name resolutionNon-recoverable failure in name resolutionNo address associated with hostnamehostname nor servname provided, or not knownservname not supported for ai_socktypeSystem error returned in errnoalnumcntrlpunctupperxdigitideogramphonogramruneH4q ,@ LC_ALLLC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_TIMEPATH_LOCALE/usr/share/localel[/\(\!\\\[^[yY]^[nN] hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh%s.dbexecvP: : path too long /usr/bin:/binyywyyyyxyyyyxyyyyyyywyyyyyxyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyywwJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturday%a %b %e %H:%M:%S %YPM%a %b %e %H:%M:%S %Z %Y%I:%M:%S %p$(,048<@DHLPT\ek4qv{qk  T\ek4qv{U+ NONEEUCGB18030GB2312GBKBIG5MSKanjiRuneMag1 error: warning: freelist is destroyed modified (chunk-) pointer pointer to wrong page chunk is already free modified (page-) pointer page is already free /etc/malloc.confMALLOC_OPTIONSrecursive call mmap(2) failed, check limits in malloc(): in free(): in realloc():junk pointer, too high to make sense junk pointer, too low to make sense unknown char in MALLOC_OPTIONS malloc() has never been called rfn^N>.ެά~Internal ypbind errorDomain not boundUnknown ypbind error: #%d /var/yp/binding%s/%s.%dclntudp_createclnttcp_createfcntl: F_SETFDyp_match: clnt_callyp_first: clnt_callyp_next: clnt_callyp_all: clnt_callclnttcp_create failedyp_order: clnt_callyp_master: clnt_callyp_maplist: clnt_callYP unknown error %d Database is busyAccess violationServer data base is badLocal domain name not setCan't communicate with ypservCan't communicate with ypbindYP server errorNo such key in mapRPC failureRequest arguments badSystem resource allocation failureYP: server for domain %s not responding, retrying YP server version mismatch - server can't supply service.Can't communicate with portmapperNo more records in map databaseLocal resource allocation failureNo such map in server's domainCan't bind to server which serves this domain\UNG@92+$RPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Unknown protocolAuthentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)RPC: (unknown error code); s1 = %u, s2 = %u; why = ; errno = %srpch != NULL - RPC: Incompatible versions of RPCRPC: Server can't decode argumentsRPC: Failed (unspecified error); low version = %u, high version = %u/usr/src/lib/libc/rpc/clnt_perror.c(unknown authentication error - %d)'''''( *$(>(W(u(D*((((h*())2)M)e)~)))clnt_sperrorclnt_perrorclnt_spcreateerrorclnt_pcreateerrorCould not get %s transportloopbacksvc%s_create: could not open connectionout of memoryunsupported transport sizecan't get protocol infocan't find appropriate transport%s: %srpc_reg: %s couldn't register prog %u vers %u for %s%s can't reassign procedure number %u%s cant find suitable transport for %srpc: rpc_reg: never registered prog %u vers %urpc: rpc_reg trouble replying to prog %u vers %unetpathsvc_sendreply failedsvc_tli_create: bad service typesvc_tli_create: could not get transport informationsvc_tli_create: could not bind to requested addresssvc_tli_create: could not bind to anonymous portsvc_tli_create: could not open connection for %ssvc_tli_create: invalid netconfigsvc_tp_create: Could not register prog %u vers %u on %ssvc_tp_create: invalid netconfig structure for prog %u vers %usvc_create: could not register prog %u vers %u on %ssvc_create: no memorysvc_create: unknown protocolcould not allocate cache cache already enabledsvc_enablecache: %s %sout of memory transport does not support data transfercould not get transport informationsvc_dg_create: %scould not allocate new rpc buffervictim alloc failedvictim not foundcache_set: %sfifo<pmap_getportaddress != NULL/usr/src/lib/libc/rpc/pmap_getport.cclntraw_create - Fatal header serialization error./usr/src/lib/libc/rpc/clnt_raw.cclnt_raw_callsunrpcff02::202datagram_nclnt_bcast: cannot sendbroadcast packetclnt_bcast: Cannot send broadcast packetclnt_bcast: Cannot receive reply to broadcastsvc_vc_destroyread_vcwrite_vcsvc_vc_statsvc_vc_recvsvc_vc_getargssvc_vc_freeargssvc_vc_replymakefd_xprtsvc_fd_createrendezvous_requestxprt != NULLfd != -1svc_vc_create: out of memory/usr/src/lib/libc/rpc/svc_vc.csvc_vc: makefd_xprt: out of memorysvc_tcp: makefd_xprt: out of memorysvc_fd_create: no mem for local addrsvc_fd_create: could not retrieve remote addrsvc_fd_create: could not retrieve local addrsvc_vc_create: could not retrieve local addrsvc_vc_create: no mem for local addrxprt_register__xprt_do_unregistersvc_findsvc_registersvc_sendreplysvcerr_noprocsvcerr_decodesvcerr_systemerrsvcerr_authsvcerr_weakauthsvcerr_noprogsvcerr_progverssvc_getreqset/usr/src/lib/libc/rpc/svc.cprev != NULLdispatch != NULLreadfds != NULLxdr_callmsgxdrs != NULLcmsg != NULL/usr/src/lib/libc/rpc/rpc_callmsg.cpmap_rmtcallxdr_rmtcall_argsxdr_rmtcallresport_ptr != NULLaddr != NULLcap != NULLcrp != NULL/usr/src/lib/libc/rpc/pmap_rmt.cxdr_pmapregs != NULL/usr/src/lib/libc/rpc/pmap_prot.c0.0.0.0.%d.%dxdr_reference: out of memorywindow verifier mismatchtimestamp before last seensvcauth_des: %s decryptsessionkeybad nicknamegetpublickeyreplayed credentialtimestamp expiredinvalid usecsdecryption failureencryption failureinvalid nicknameunknown netnamemissed ucred cache/etc/publickey # publickey.bynameBad record in %s -- %sBad record in %s val problem - %s_svcauth_unixrqst != NULL/usr/src/lib/libc/rpc/svc_auth_unix.cbad auth_len gid %ld str %ld auth %u authunix_marshalmarshal_new_authauthunix_validateauthunix_refreshauthunix_destroyauth != NULLverf != NULL/usr/src/lib/libc/rpc/auth_unix.cauth_none.c - Fatal marshalling problemauthunix_create: out of memoryunixnetid.byname/etc/netid ,getnetconfig: %scould not close() fd %d; mem & fd leakinetclnt_dg_create: out of memory؄ Ѓ/rȄxdr_authunix_parms/usr/src/lib/libc/rpc/authunix_prot.cdnsnissetpwentendpwentgetpwuid_rgetpwnam_rgetpwent_r/etc/spwd.db/etc/pwd.dbVERSIONpasswd_compatmaster.passwd.by%s##passwd.adjunct.bynamepasswd-%ld:9\:::9\:::9\:::9Ԓ::D:9Ԓ::D:9Ԓ::D:::D::::Unsupported password database version %dgetpwent memory allocation failure, /etc/netgroupnetgroup.byhost*.**.%s%s.%s%s.*netgroup.byusersetgrentendgrentgetgrent_rgetgrnam_rgetgrgid_r/etc/groupgroup_compatgroup.bynamegroup.bygidgroup-%ld:9x::`:9x::`:9x::`:9::\:9::\:9::\::::`::\:getgrent memory allocation failureout of memoryclnt_vc_create%s : %sclnt_vc_createclnt_vc_callclnt_vc_geterrclnt_vc_freeresclnt_vc_controlAAAFRAAkzAclnt_vc_destroyvc_cv != (cond_t *) NULLvc_cv == (cond_t *) NULLcl != NULLerrp != NULL/usr/src/lib/libc/rpc/clnt_vc.cauthnone_marshal/usr/src/lib/libc/rpc/auth_none.croot uid should be 0no uid for user %scorrupted entry%s uid is incorrect%s gid is incorrectPW_SCAN_BIG_IDS%s > max uid value (%lu)no gid for user %s%s > max gid value (%lu)warning, unknown root shell%s > recommended max uid value (%u)%s > recommended max gid value (%u)/bin/csh/etc/shellsshells-XXXXXshells-%dinitshellsGC9:: $t@xdrrec_create: out of memory,TP,|udp6tcp6circuit_vdatagram_vcircuit_ninet6%s.%u.%u)r&dDiD-nDxDD2r&)  z z z   z z DD0O9X]rpc: failed to open /etc/netconfigxdr_opaque_authxdr_des_blockxdr_accepted_replyxdr_rejected_replyxdr_replymsgxdr_callhdr_seterr_replyacceptedrejectedaVK@5*blkp != NULLar != NULLrr != NULLrmsg != NULLerror != NULL/usr/src/lib/libc/rpc/rpc_prot.cNFINITYf#}#}#}#}#}#}#}#}#}#}#!!!!!q#> |!!!!!!!!! O   r c E /  |m#+O(&%.p.-1K1{100i00'0''/F0F0F0F0F0F0F0 3 3'''''''222222'''''''''''''''''2''''''''222222'''''''''''''''''2/etc/hesiod.conflhsrhsHESIOD_CONFIGHES_DOMAINclassesrhs-extensionstringlist: %mMNMMMNMؗҜ<3#I9=D2[%Cod(NNNNNNNNNOOOOONNNNNNNNNNNNNNNNNNONNNNNNNNNNsNNiNAA5?55?5?@?xdr_array: out of memoryxdr_bytes: out of memoryxdr_string: out of memory1.0 1.2 __collate_strdup__collate_substitute~~~~~~~~~<||\|<NETPATHNetconfig database not foundNot enough memoryNot initialized/etc/netconfigtpi_cots_ordtpi_cotstpi_cltstpi_rawin /etc/netconfig. or run mergemaster(8). Continuing in 10 seconds Netconfig database has invalid formatNetid not found in netconfig databaseUnknown network selection errorThe local transport is called "unix" Please change this to "local" manually See UPDATING entry 20021216 for details. This warning will be removed 20030301 PLmLL M4MÌres_send: %s ([%s].%s): %s res_send: %s: %s ;; res_send() ;; old answer (unexpected): ;; old answer: s out-of-bounds;; wrong query name: sendto;; not our server: keventread failedrecvfrom;; response truncated ;; timeout ;; undersized: %d ;; truncated answer server rejected query: read(vc);; got answer: socket(dg)write failedsocket(vc)connect/vckqueueconnect(dg);; Querying server (# %d) address = %s ghbynameghbyaddr/etc/hostsip6.arpa9:9:d:9<::8# 0123456789abcdef;; res_query(%s, %d, %d) ;; rcode = %d, ancount=%d ;; res_query: mkquery failed;; res_query: send errorHOSTALIASES;; res_querydomain(%s, %s, %d, %d) ;; res_mkquery(%d, %s, %d, %d) /&ndots:timeout:attempts:insecure1insecure2no_tld_queryedns0;; ndots=%d ;; timeout=%d ;; retry=%d ;; debug/etc/resolv.confdomainnameserversortlistRES_OPTIONSenvLOCALDOMAIN;; res_setoptions("%s", "%s")... ;; res_setoptions("%s", "%s").. GAIgetaddrinfoipnodes.bynamehosts.byname;; rcode = %u, ancount=%u ;; res_querydomain(%s, %s) )r&)r&)r&,UUUU9:gethostby*.getanswer: asked for "%s", got "%s"9::gethostby*.getanswer: asked for "%s %s %s", got type "%s"services.byname/etc/services,/%d/%sservices.byportname servermail destination (deprecated)MFmail forwarder (deprecated)CNAMEcanonical nameSOAstart of authorityMBmailboxMGmail group membermail renameWKSdomain name pointerHINFOhost informationmailbox informationMXmail exchangerTXTtextresponsible personAFSDBDCE or AFS serverX25X25 addressISDNISDN addressrouterNSAPnsap addressNSAP_PTRsignatureKEYPXmapping informationGPOSAAAAIPv6 addressEIDNIMLOCSRVserver selectionATMAATM address (unimplemented)IXFRincremental zone transferAXFRMAILBMAILAmail agent (deprecated)NAPTRURN Naming Authority"any"ZONEPREREQUISITEUPDATEADDITIONALANSWERAUTHORITYCHAOSHESIODdefnamusevcdnsrch?0x%lx?igntcprimry(unimpl)no-tld-querystyopnnoaliasesaaonly(unimpl)recurs;; res options:;; %s, type = %s, class = %s ;; ns_parserr: %s ;; %s SECTION: ;; ns_sprintrr: %s ; flags:; %s: %d, %s: %d;; ns_initparse: %s qr aa tc rd ra ?? ad cd%ld.%.2ldwell-known service (deprecated)geographical position (withdrawn)next valid name (unimplemented)endpoint identifier (unimplemented)NIMROD locator (unimplemented)mailbox-related data (deprecated);; ->>HEADER<<- opcode: %s, status: %s, id: %d ; error: unknown LOC RR version%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %smWsWAV{MVkVnVVVVVVVVV RV `A  VY vXV VWkW%W(W7W;W@WSWYWkWoW{WW{WWWWV^WWWWWZWWW{@ZW`Z WZ!WW" XX,X1XKX=XPXZVX\X#tXzXXXXXX>`XXX#SXX(!B B B B B B B B BB B B B BB B B BB B B B B B B B B B B B B BB B B B B B B B BB B B B BB B B BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBPREREQUISITESNOERRORFORMERRSERVFAILNXDOMAINNOTIMPREFUSEDYXDOMAINYXRRSETNXRRSETNOTAUTHZONEERRNOCHANGEIQUERYCQUERYMCQUERYUNOTIFYZONEINITZONEREFaddlenQd^[QQ[@S[[[QY[FT^T_^TTFTTDUQ{UXZQkY]_[QQ\Q\len <= *buflen "\@ unknown RR type\#( ; %s%02x ( RR format error %s %d %lu 0x%04x %u %u ) %u ( %u %u %u ; serial ; refresh ; retry ; expiry ; minimum /usr/src/lib/libc/net/ns_print.cABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Assertion failed: (%s), function %s, file %s, line %d. Assertion failed: (%s), file %s, line %d. ppppppppppppppppppppnss_%s.so.%dnss_module_registerNSSWITCH(%s): %s, %s/etc/nsswitch.conf9vector_appendnss_load_modulenss_method_lookupNSSWITCH(%s): memory allocation failureNSSWITCH(%s): %s, registration failedNSSWITCH(%s): %s, %s, %s, not foundhosts.byaddripnodes.byaddr/var/run/logpriv/var/run/log/dev/log%.15s /dev/console[%d]syslog: unknown facility/priority: %xmnUTC/usr/share/zoneinfo/etc/localtimeposixrules,M4.1.0,M10.5.0TZSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec%.3s %.3s%3d %02d:%02d:%02d %d 01234567890123456789abcdef0123456789ABCDEF%u.%u.%u.%u`ffffdffddddddddddddddunionfs/usr/bin:/bin:/usr/sbin:/sbin:0@8H%$sniglet^&%s/bt.XXXXXXXXXX0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz/dev/urandom888888w8i8SSTSTSTSSNTTSTSTNTSSSTTSVTSiS,U,UiS,U,U,UiS,U,U ViS,UiSV,UiSoVoVoVoVoVoVoVoVoV,U,U,U,U,U,U,UU,UTTU,UU,U,U,U,UV,U,U T,U,U,UXT,U T,U,UT,U,U,U,U,U,U,U,UU,UTTUUUUT?@ACDEFGHJKMOQSS   9876543210/.-,+*)('&%$#"! :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::;<;53210/-,+*)('&%$#"!  ::::::::::::::::::::::::    DEAE216+-.99+&%/ /E!()*!!# E*`]]],bbbbaaa3a#aaC`9`bad buffer in yy_scan_bytes()input in flex scanner failedout of dynamic memory in yy_scan_buffer()out of dynamic memory in yy_scan_bytes()out of dynamic memory in yy_create_buffer()fatal flex scanner internal error--no action foundinput buffer overflow, can't enlarge buffer because scanner uses REJECTfatal flex scanner internal error--end of buffer missedNSSWITCH(nslexer): memory allocation failureNSSWITCH(nslexer): %s line %d: %s at '%s'gethostbynamegethostbyaddr9:9q:}:9r:~:Єgethostby*.gethostanswer: asked for "%s", got "%s"gethostby*.gethostanswer: asked for "%s %s %s", got type "%s"Impossible condition (type=%d) static buffer is too small (%d) Too many addresses (%d) size (%d) too big res_search failed (%d) %x.%x.%u.%u.%u.%u.in-addr.arpares_query failed (%d) |4ЈHASH: Out of overflow pages. Increase page size M\\ \\&\$FreeBSD: src/lib/csu/i386-elf/crtn.S,v 1.6 2005/05/19 07:31:06 dfr Exp $lJp. PL~`SLX<}4]c f.lT0P1r1{1`dLgzϼH|Dp$Ǽμ,C-ռ@d1Hܼt t ġ <hhP.| /tmp/EdDk.XXXXXXXXXXDKPZdmtbH9H9H9H9H9unknown _msgbufpD !"# - = \qvv@PQRVacdeu@@Vcpx@ ~W @ =GrRz@V @O@xP~=GrRz@V @~-49D>=GrRz@V @xP~bmw##.'aWGuoSoS9<jOOOOGOO99#S99LyO99F\j9q6|990*`99FGuG990O(99[ 99V^Y8yKO89cJ`8OY/89[(89u^R79J 7L7cHOO/89[W 79GO`79+a,(99[O 79fmO6xA691C69>[g`69I*@S6c?>O 69JJP59cGH5tP59ZG990 PF5+L 5 jP4iP49V7cHOP495eF4QMg`4>QS@E4>] 4QUP3HO#P3mk39Z1(P@3gG 5 j?3j98'@2>0P3j986P2h5G7cHO`297_P 5 jCP191`KP1HOPP1HOTP@1HOZP19iJs09HO09HU`0vf\?J0q6P 09HV05(99[cP/9Y /9oc5N/9/kiPS6c?>(@@/cq>nP/9bnV.ONW.9dC.9 dvPg.91[f@.W|P.hP-9a_J0q6P-9H-M lP -9.Yg,Rg.N/9/k,9OBP,91P,9`az,9d<],91P/9ocPG,9DG'a0,9.P,9aZP,Ml5+t=+9T +9rH{ssssHSH9LhW?O@NiAB CD  !"#$%E &'()*+,-./F 0123456789G :;<=>?@ABCH D E F GIJKjkLMKNIOP[lmcnoQRpqRSrZstuvwxSyz{|}~TPUQVTW5C6G7E8M9V:R;\<k=w>?@[\\]^^__`&{1{D|R}^}r~x'*B<`\vCCCCCCCܝ  999`X  kh545@ÿ? d'@Bʚ;H9X_XX_____` ```$`,`|=!C4`>`=`D`L`T`XXbQ|=![`d`x   @ Q88WILDABBR0123456789<8 0000000000000000܎ X@ÿ?RuneMagiNONEBBBBB@(((((((((((((((          (((((((    ((((((    ((((  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ }lPPxd`Pxd PPxdl,o(Hoaoo9<_hashXXXXXX.shstrtab.init.text.fini.rodata.data.eh_frame.ctors.dtors.jcr.bss ttf;; <b %T +d5d<dCeH  e  eMa  }n}{>9xs61 T O v nobody*Unprivileged user/nonexistent/usr/sbin/nologin3nobody*Unprivileged user/nonexistent/usr/sbin/nologinCpop*DPost Office Owner/nonexistent/usr/sbin/nologin1poppop*DPost Office Owner/nonexistent/usr/sbin/nologinApopbind*55Bind Sandbox//usr/sbin/nologin35bind*55Bind Sandbox//usr/sbin/nologin2bind*55Bind Sandbox//usr/sbin/nologinC5bind*55Bind Sandbox//usr/sbin/nologinBkmem*KMem Sandbox//usr/sbin/nologin3kmem*KMem Sandbox//usr/sbin/nologinCtty*Tty Sandbox//usr/sbin/nologin2tty*Tty Sandbox//usr/sbin/nologinB|w*%rl  V Q r proxy*>>Packet Filter pseudo-user/nonexistent/usr/sbin/nologin3>proxy*>>Packet Filter pseudo-user/nonexistent/usr/sbin/nologin2proxy*>>Packet Filter pseudo-user/nonexistent/usr/sbin/nologinC>proxy*>>Packet Filter pseudo-user/nonexistent/usr/sbin/nologinBsmmsp*Sendmail Submission User/var/spool/clientmqueue/usr/sbin/nologin1smmspsmmsp*Sendmail Submission User/var/spool/clientmqueue/usr/sbin/nologinAsmmspsshd*Secure Shell Daemon/var/empty/usr/sbin/nologin3sshd*Secure Shell Daemon/var/empty/usr/sbin/nologinCkmem*KMem Sandbox//usr/sbin/nologin2kmem*KMem Sandbox//usr/sbin/nologinB`\!@; I D _pflogd*@@pflogd privsep user/var/empty/usr/sbin/nologin2_pflogd*@@pflogd privsep user/var/empty/usr/sbin/nologinBgames* Games pseudo-user/usr/games/usr/sbin/nologin3games* Games pseudo-user/usr/games/usr/sbin/nologin2games* Games pseudo-user/usr/games/usr/sbin/nologinCgames* Games pseudo-user/usr/games/usr/sbin/nologinBtty*Tty Sandbox//usr/sbin/nologin1ttytty*Tty Sandbox//usr/sbin/nologinAttybin*Binaries Commands and Source//usr/sbin/nologin1binbin*Binaries Commands and Source//usr/sbin/nologinAbin(UPTO  6 1 , ' } 5 0 @ @ www*PPWorld Wide Web Owner/nonexistent/usr/sbin/nologin3Pwww*PPWorld Wide Web Owner/nonexistent/usr/sbin/nologinCP_dhcp*AAdhcp programs/var/empty/usr/sbin/nologin2_dhcp*AAdhcp programs/var/empty/usr/sbin/nologinB_pflogd*@@pflogd privsep user/var/empty/usr/sbin/nologin3@_pflogd*@@pflogd privsep user/var/empty/usr/sbin/nologinC@proxy*>>Packet Filter pseudo-user/nonexistent/usr/sbin/nologin1proxyproxy*>>Packet Filter pseudo-user/nonexistent/usr/sbin/nologinAproxysshd*Secure Shell Daemon/var/empty/usr/sbin/nologin1sshdsshd*Secure Shell Daemon/var/empty/usr/sbin/nologinAsshdnews*News Subsystem//usr/sbin/nologin3news*News Subsystem//usr/sbin/nologin2 news*News Subsystem//usr/sbin/nologinCnews*News Subsystem//usr/sbin/nologinB kmem*KMem Sandbox//usr/sbin/nologin1kmemkmem*KMem Sandbox//usr/sbin/nologinAkmemrootCharlie &/root/bin/csh3rootCharlie &/root/bin/csh2rootCharlie &/root/bin/cshCrootCharlie &/root/bin/cshB$}(#|w*% !  d \  r m  N G nobody*Unprivileged user/nonexistent/usr/sbin/nologin1nobodynobody*Unprivileged user/nonexistent/usr/sbin/nologinAnobodyuucp*BBUUCP pseudo-user/var/spool/uucppublic/usr/local/libexec/uucp/uucico2uucp*BBUUCP pseudo-user/var/spool/uucppublic/usr/local/libexec/uucp/uucicoB_dhcp*AAdhcp programs/var/empty/usr/sbin/nologin3A_dhcp*AAdhcp programs/var/empty/usr/sbin/nologinCA_pflogd*@@pflogd privsep user/var/empty/usr/sbin/nologin1_pflogd_pflogd*@@pflogd privsep user/var/empty/usr/sbin/nologinA_pflogdsmmsp*Sendmail Submission User/var/spool/clientmqueue/usr/sbin/nologin3smmsp*Sendmail Submission User/var/spool/clientmqueue/usr/sbin/nologinCman* Mister Man Pages/usr/share/man/usr/sbin/nologin3 man* Mister Man Pages/usr/share/man/usr/sbin/nologin2 man* Mister Man Pages/usr/share/man/usr/sbin/nologinC man* Mister Man Pages/usr/share/man/usr/sbin/nologinB daemon*Owner of many system processes/root/usr/sbin/nologin3daemon*Owner of many system processes/root/usr/sbin/nologinCtoor*Bourne-again Superuser/root2toor*Bourne-again Superuser/rootB.FAQJ U P  : 6 E @  h c   pop*DPost Office Owner/nonexistent/usr/sbin/nologin2pop*DPost Office Owner/nonexistent/usr/sbin/nologinBuucp*BBUUCP pseudo-user/var/spool/uucppublic/usr/local/libexec/uucp/uucico3Buucp*BBUUCP pseudo-user/var/spool/uucppublic/usr/local/libexec/uucp/uucicoCBmailnull*Sendmail Default User/var/spool/mqueue/usr/sbin/nologin3mailnull*Sendmail Default User/var/spool/mqueue/usr/sbin/nologinCsshd*Secure Shell Daemon/var/empty/usr/sbin/nologin2 sshd*Secure Shell Daemon/var/empty/usr/sbin/nologinB man* Mister Man Pages/usr/share/man/usr/sbin/nologin1manman* Mister Man Pages/usr/share/man/usr/sbin/nologinAmanoperator*System &//usr/sbin/nologin3operator*System &//usr/sbin/nologin1operatoroperator*System &//usr/sbin/nologinCoperator*System &//usr/sbin/nologinAoperatordaemon*Owner of many system processes/root/usr/sbin/nologin2daemon*Owner of many system processes/root/usr/sbin/nologin1daemondaemon*Owner of many system processes/root/usr/sbin/nologinBdaemon*Owner of many system processes/root/usr/sbin/nologinAdaemontoor*Bourne-again Superuser/root1toortoor*Bourne-again Superuser/rootAtoorrootCharlie &/root/bin/csh1rootrootCharlie &/root/bin/cshArootVERSION$|w+&61 I D ` [ ? : D D www*PPWorld Wide Web Owner/nonexistent/usr/sbin/nologin2www*PPWorld Wide Web Owner/nonexistent/usr/sbin/nologin1wwwwww*PPWorld Wide Web Owner/nonexistent/usr/sbin/nologinBwww*PPWorld Wide Web Owner/nonexistent/usr/sbin/nologinAwwwuucp*BBUUCP pseudo-user/var/spool/uucppublic/usr/local/libexec/uucp/uucico1uucpuucp*BBUUCP pseudo-user/var/spool/uucppublic/usr/local/libexec/uucp/uucicoAuucpbind*55Bind Sandbox//usr/sbin/nologin1bindbind*55Bind Sandbox//usr/sbin/nologinAbindsmmsp*Sendmail Submission User/var/spool/clientmqueue/usr/sbin/nologin2 smmsp*Sendmail Submission User/var/spool/clientmqueue/usr/sbin/nologinB news*News Subsystem//usr/sbin/nologin1newsnews*News Subsystem//usr/sbin/nologinAnewsgames* Games pseudo-user/usr/games/usr/sbin/nologin1gamesgames* Games pseudo-user/usr/games/usr/sbin/nologinAgamesbin*Binaries Commands and Source//usr/sbin/nologin3bin*Binaries Commands and Source//usr/sbin/nologinCoperator*System &//usr/sbin/nologin2operator*System &//usr/sbin/nologinB^Y{v Z T  m h   t 6 t nobody*Unprivileged user/nonexistent/usr/sbin/nologin2nobody*Unprivileged user/nonexistent/usr/sbin/nologinBpop*DPost Office Owner/nonexistent/usr/sbin/nologin3Dpop*DPost Office Owner/nonexistent/usr/sbin/nologinCD_dhcp*AAdhcp programs/var/empty/usr/sbin/nologin1_dhcp_dhcp*AAdhcp programs/var/empty/usr/sbin/nologinA_dhcpmailnull*Sendmail Default User/var/spool/mqueue/usr/sbin/nologin2 mailnull*Sendmail Default User/var/spool/mqueue/usr/sbin/nologin1mailnullmailnull*Sendmail Default User/var/spool/mqueue/usr/sbin/nologinB mailnull*Sendmail Default User/var/spool/mqueue/usr/sbin/nologinAmailnulltty*Tty Sandbox//usr/sbin/nologin3tty*Tty Sandbox//usr/sbin/nologinCbin*Binaries Commands and Source//usr/sbin/nologin2bin*Binaries Commands and Source//usr/sbin/nologinB# # Network services, Internet style # # Stripped-down version. # # $FreeBSD: src/release/fixit.services,v 1.4 1999/08/28 01:33:10 peter Exp $ # # WELL KNOWN PORT NUMBERS # echo 7/tcp echo 7/udp discard 9/tcp sink null discard 9/udp sink null systat 11/tcp users #Active Users systat 11/udp users #Active Users daytime 13/tcp daytime 13/udp chargen 19/tcp ttytst source #Character Generator chargen 19/udp ttytst source #Character Generator ftp-data 20/tcp #File Transfer [Default Data] ftp-data 20/udp #File Transfer [Default Data] ftp 21/tcp #File Transfer [Control] ftp 21/udp #File Transfer [Control] ssh 22/tcp #Secure Shell Login ssh 22/udp #Secure Shell Login telnet 23/tcp telnet 23/udp # 24/tcp any private mail system # 24/udp any private mail system smtp 25/tcp mail #Simple Mail Transfer smtp 25/udp mail #Simple Mail Transfer time 37/tcp timserver time 37/udp timserver domain 53/tcp #Domain Name Server domain 53/udp #Domain Name Server bootps 67/tcp dhcps #Bootstrap Protocol Server bootps 67/udp dhcps #Bootstrap Protocol Server bootpc 68/tcp dhcpc #Bootstrap Protocol Client bootpc 68/udp dhcpc #Bootstrap Protocol Client tftp 69/tcp #Trivial File Transfer tftp 69/udp #Trivial File Transfer gopher 70/tcp gopher 70/udp finger 79/tcp finger 79/udp http 80/tcp www www-http #World Wide Web HTTP http 80/udp www www-http #World Wide Web HTTP sunrpc 111/tcp rpcbind #SUN Remote Procedure Call sunrpc 111/udp rpcbind #SUN Remote Procedure Call auth 113/tcp ident tap #Authentication Service auth 113/udp ident tap #Authentication Service nntp 119/tcp usenet #Network News Transfer Protocol nntp 119/udp usenet #Network News Transfer Protocol rmt 411/tcp #Remote MT Protocol rmt 411/udp #Remote MT Protocol https 443/tcp https 443/udp # # Berkeley-specific services # exec 512/tcp #remote process execution; # authentication performed using # passwords and UNIX loppgin names biff 512/udp comsat #used by mail system to notify users # of new mail received; currently # receives messages only from # processes on the same machine login 513/tcp #remote login a la telnet; # automatic authentication performed # based on priviledged port numbers # and distributed data bases which # identify "authentication domains" who 513/udp whod #maintains data bases showing who's # logged in to machines on a local # net and the load average of the # machine cmd 514/tcp shell #like exec, but automatic # authentication is performed as for # login server syslog 514/udp printer 515/tcp spooler printer 515/udp spooler talk 517/tcp #like tenex link, but across # machine - unfortunately, doesn't # use link protocol (this is actually # just a rendezvous port from which a # tcp connection is established) talk 517/udp #like tenex link, but across # machine - unfortunately, doesn't # use link protocol (this is actually # just a rendezvous port from which a # tcp connection is established) ntalk 518/tcp ntalk 518/udp utime 519/tcp unixtime utime 519/udp unixtime efs 520/tcp #extended file name server router 520/udp route routed #local routing process (on site); # uses variant of Xerox NS routing # information protocol uucp 540/tcp uucpd uucp 540/udp uucpd uucp-rlogin 541/tcp uucp-rlogin 541/udp klogin 543/tcp # Kerberos (v4/v5) klogin 543/udp # Kerberos (v4/v5) kshell 544/tcp krcmd # Kerberos (v4/v5) kshell 544/udp krcmd # Kerberos (v4/v5) ...! . .." fixit_crunchX" cat"chmodN" cp" dd" df"echoN"exprN"killN" ln" ls"mkdirN" mv" rm"rmdirN"sleepN"syncN"bsdlabely`"clriN"dmesgN"fdiskN"mknodN"mountN" mount_cd9660X" mount_msdosfsX"reboot"restore"swapon"umount" disklabel`"rrestorey`" ftp"telnet" vi"viewN" ex"chownN"chroot"chgrpN# ...$ ...% . ..&misc& .% ..' scsi_modes    ( 0 8 X`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx 0x0a "Control Mode Page" { {Reserved} *t7 {RLEC} t1 {Queue Algorithm Modifier} t4 {Reserved} *t2 {QErr} t1 {DQue} t1 {EECA} t1 {Reserved} *t4 {RAENP} t1 {UAAENP} t1 {EAENP} t1 {Reserved} *i1 {Ready AEN Holdoff Period} i2 } 0x02 "Disconnect-Reconnect Page" { {Buffer Full Ratio} i1 {Buffer Empty Ratio} i1 {Bus Inactivity Limit} i2 {Disconnect Time Limit} i2 {Connect Time Limit} i2 {Maximum Burst Size} i2 {Reserved} *t6 {DTDC} t2 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 } 0x09 "Peripheral Device Page" { {Interface Identifier} i2 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 } 0x1a "Power Control" { {Reserved} *i1 {Reserved} *t6 {Idle} t1 {Standby} t1 {Idle Condition Timer} i4 {Standby Condition Timer} i4 } 0x08 "Caching Page" { {IC} t1 {ABPF} t1 {CAP} t1 {DISC} t1 {SIZE} t1 {WCE} t1 {MF} t1 {RCD} t1 {Demand Retention Priority} t4 {Write Retention Priority} t4 {Disable Pre-fetch Transfer Length} i2 {Minimum Pre-fetch} i2 {Maximum Pre-fetch} i2 {Maximum Pre-fetch Ceiling} i2 } 0x05 "Flexible Disk Page" { {Transfer rate} i2 {Number of heads} i1 {Sectors per track} i1 {Data bytes per sector} i2 {Number of cylinders} i2 {Starting cylinder-write precompensation} i2 {Starting cylinder-reduced write current} i2 {Drive step rate} i2 {Drive step pulse width} i1 {Head settle delay} i2 {Motor on delay} i1 {Motor off delay} i1 {TRDY} t1 {SSN} t1 {MO} t1 {Reserved} *t5 {Reserved} *t4 {SPC} t4 {Write Compensation} i1 {Head load delay} i1 {Head unload delay} i1 {Pin 34} t4 {Pin 2} t4 {Pin 4} t4 {Pin 1} t4 {Medium rotation rate} i2 {Reserved} *i1 {Reserved} *i1 } 0x03 "Format Device Page" { {Tracks per Zone} i2 {Alternate Sectors per Zone} i2 {Alternate Tracks per Zone} i2 {Alternate Tracks per Logical Unit} i2 {Sectors per Track} i2 {Data Bytes per Physical Sector} i2 {Interleave} i2 {Track Skew Factor} i2 {Cylinder Skew Factor} i2 {SSEC} t1 {HSEC} t1 {RMB} t1 {SURF} t1 {Reserved} *t4 } 0x0b "Medium Types Supported Page" { {Reserved} *i1 {Reserved} *i1 {Medium type one supported} i1 {Medium type two supported} i1 {Medium type three supported} i1 {Medium type four supported} i1 } 0x0c "Notch and Partition Page"; 0x01 "Read-Write Error Recovery Page" { {AWRE (Auto Write Reallocation Enbld)} t1 {ARRE (Auto Read Reallocation Enbld)} t1 {TB (Transfer Block)} t1 {RC (Read Continuous)} t1 {EER (Enable Early Recovery)} t1 {PER (Post Error)} t1 {DTE (Disable Transfer on Error)} t1 {DCR (Disable Correction)} t1 {Read Retry Count} i1 {Correction Span} i1 {Head Offset Count} i1 {Data Strobe Offset Count} i1 {Reserved} *i1 {Write Retry Count} i1 {Reserved} *i1 {Recovery Time Limit} i2 } 0x04 "Rigid Disk Drive Geometry Page" { {Number of Cylinders} i3 {Number of Heads} i1 {Starting Cylinder-Write Precompensation} i3 {Starting Cylinder-Reduced Write Current} i3 {Drive Step Rate} i2 {Landing Zone Cylinder} i3 {Reserved} *t6 {RPL} t2 {Rotational Offset} i1 {Reserved} *i1 {Medium Rotation Rate} i2 {Reserved} *i1 {Reserved} *i1 } 0x07 "Verify Error Recovery Page" { {Reserved} *t4 {EER} t1 {PER} t1 {DTE} t1 {DCR} t1 {Verify Retry Count} i1 {Verify Correction Span} i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Verify Recovery Time Limit} i2 } 0x0E "CD-ROM Audio Control Parameters Page" { {Reserved} *t5 {Immed} t1 {SOTC} t1 {Reserved} *t1 {Reserved} *i2 {APRVal} t1 {Reserved} *t3 {Format of LBAs / sec.} t4 {Logical Blocks per Second of Audio Playback} i2 {Reserved} *t4 {Output Port 0 Channel Selection} t4 {Output Port 0 Volume} i1 {Reserved} *t4 {Output Port 1 Channel Selection} t4 {Output Port 1 Volume} i1 {Reserved} *t4 {Output Port 2 Channel Selection} t4 {Output Port 2 Volume} i1 {Reserved} *t4 {Output Port 3 Channel Selection} t4 {Output Port 3 Volume} i1 } 0x10 "Device Configuration Page" { {Reserved} *t1 {Change Active Partition} t1 {Change Active Format} t1 {Active Format} t5 08@hC@ <   hC7 i@  [> [>hC@ @@@<@TU hC  @@S,0hCAhChChC VAhChChC m'PgĒhCĒhChCh p x @ ;X\AhChChC cAhChChC CgAhChChC !AhChChC !\48hChChC  {Active Partition} i1 {Write Buffer Full Ratio} i1 {Write Buffer Empty Ratio} i1 {Write Delay Time} i2 {Data Buffer Recovery} t1 {Block Identifiers Support} t1 {Report Setmarks} t1 {Automatic Velocity Control} t1 {Stop on Consecutive Filemarks} t2 {Recover Buffer Order} t1 {Report Early-Warning} t1 {Gap Size} i1 {EOD Defined} t3 {Enable EOD Generation} t1 {Synchronize at Early-Warning} t1 {Reserved} *t3 {Buffer Size at Early-Warning} i3 {Select Data Compression Algorithm} i1 {Reserved} *t5 {SCSI-3 Associated Write Protect} t1 {SCSI-3 Persistent Write Protect} t1 {SCSI-3 Permanent Write Protect} t1 } 0x0f "Data Compression Page" { {Data Compression Enabled} t1 {Date Compression Capable} t1 {Reserved} *t6 {Data Decompression Capable} t1 {Data Decompression Report on Exception} t2 {Reserved} *t5 {Compression Algorithm} i4 {Decompression Algorithm} i4 {Reserved} *i4 } 0x1b "Removable Block Access Capacities Page" { {System Floppy Type Device} t1 {Supports Reporting Format Progress} t1 {Reserved} *t6 {Non CD Optical Device} t1 {Single or Multiple LUN Supported} t1 {Reserved} *t3 {Total Logical Units Supported} t3 {Reserved} *i8 } 0x2a "CD capabilities and mechanical status page" { {Reserved} *t4 {Method 2} t1 {CD-RW Read} t1 {CD-R Read} t1 {Reserved} *t4 {Test Write} t1 {CD-RW Write} t1 {CD-R Write} t1 {Reserved} *t1 {Multi Session} t1 {Mode 2 Form 2} t1 {Mode 2 Form 1} t1 {Digital Port (2)} t1 {Digital Port (1)} t1 {Composite} t1 {Audio Play} t1 {Read Bar Code} t1 {UPC} t1 {ISRC} t1 {C2 Pointers are supported} t1 {R-W De-interleaved & corrected} t1 {R-W Supported} t1 {CD-DA Stream is Accurate} t1 {CD-DA Commands Supported} t1 {Loading Mechanism Type} t3 {Reserved} *t1 {Eject} t1 {Prevent Jumper} t1 {Lock State} t1 {Lock} t1 {Reserved} *t4 {S/W Slot Selection} t1 {Changer Supports Disc Present reporting} t1 {Separate Channel Mute Supported} t1 {Separate volume levels per channel} t1 {Maximum Read Speed Supported (kBps)} i2 {Number of Volume Leves Supported} i2 {Buffer Size supported by Drive (KB)} i2 {Current Read Speed Selected (kBps)} i2 {Reserved} *i1 {Reserved} *t2 {Length} t2 {LSBF} t1 {RCK} t1 {BCK} t1 {Reserved} *t1 {Maximum Write Speed Supported (kBps)} i2 {Current Write Speed Supported (kBps)} i2 }; 0x00 "Vendor-Specific"; ELF 4pe4 ( bbUm : UWVS ]׍t ۉ50~$Ett Wn hnPVEPSPkщǐU= t8vҡut h~ ÐUth$hw~tt hU~ÐUVSj/]S ^Zt p& = t3Vx ZYt݃;1e[^UWVSPPhh5x< 1 = tN1MUUO~5xj +< Yu_3h5x< ;5xj ; jijUWVSWWEE} EEt8uGj/7 [^Xu = t66Sw ZYt>>tEEE} ENe[^_Shh25x; e[^_UWVSu] }N}] u[^_,U>UWVSRR;u;=$u@ Pe_t!=$u f` 5蠟[EE n =`t u}KEE=\tO=Xt tFEuh5|: =$u |@ @5| Y u]=T=$u,|BHBy;B| $]Rj$Q 5|j$* _@Z8 =H"=$u)|BHBy;B| ^ Rj^Q 5|j^ Z@Y]=$u*|BHBy;B| IRjI5|jI=DÀv S^ _ D4%=$u)|BHBy;B| M RjMP 5|jM Z@Y=$u)|BHBy;B| - Rj-~P 5|j- Y@_Mv S=^ Z D4%=$u)|BHBy;B| ^ Rj^ P 5|j^E Y@_=$u7?tك@|BHBy ;B| t GRQI5|?t؃@P?=$u/|BHBy ;B| t RSfO 5|S _Z@t:߃=$uFHFyV'{ @ Vx YÃZ=$uF @ V Zt35PhMs [=$L_uff V蕛Y=$u |@ @5|u Zt hj e[^_UWVS Džth(j2r ZYu1PjRP{6 ^XN8-jjjuV,u jjj2 x`jhEPE@K gv?5PVS2 y S5 [jS1 @ZYuj X؉Džy!hM _XL:t3u)hWu Sw =$u |@ 5|y ^=@$P30 Y[t5PhMj d=sP<2% Z@u6h"1@SP4 y hj )u5<5@W4 }5PhM [^LtWg4 Yt0 e[^_UVShju] n vbw~$L\XzDTd\X`LDH6j5|O XZ%D5xh2 ^XjhԽSV) Ip=Xu-=Tu$=\u=`u=Hu =Dt1҉75|u [t hj 5LaUU5xh1 j`UWVSLu} EEEEwg1PtgHtGLtRXt| RtZftYur}\htNotR|vtrxrDEEeEEELECE:E1pL9-u<A9u4yu.Cp$EhGWVv p)N<}t0}t hXj }t}t}t EL EL 7VEZu Vhj jSWn EE\htG4H ws$ܽ}7jWui Cw $wh* E1w $wh* E }G<@Pu‰EG<@%[9^uwUZYt}uwhMh ^_Et}tnwhM& Y}[~QuVG<@P]tSG<@% EPtSG<@% EPVG<@Ph& $j 趒Zuq DžX聂8t hþj` u u]UUWVSDu1f$Lts HtQPtpRpinrv1DžDž1DžDžDž_)/h̾u V} pU )ƍU =Džt<=th׾u ut h j' Dž=t)tthjF NE hShhRB =v ShP1hсgh `uh.`ii`J/t-iv%/u B`B`ivz/ޡ`dU EPhh' ÃXZu[8t#E%=@DžN~ VjDž=u=t%u t4PE 0 ' 4PU 2& ^X<%=@u=u =t Dž Džt)u Cu hhhb hhh~j hDž( $f( $Gu  u hnDž0F4tt$4t u*v $vh*Jvh f~2u[tHj/v ZYDžt +NAFhlPf [_u F$N~$+9/dt z/t/B:-h=vQhhh}WQR; `z/uB`B`iwf~4~ =tjv!t.t tج*th!j tRPhjs^Ӌ$9ډ 6|9w0PRPhjC^Ӌd9ډ`|9vhjhPj8 e[^_UE E EE#W UUW1t hwj |}UEUEXU}tjh9EPIY hjjhEEP u uhPtuhjp P@ txUE E EEJV UWVS mjEPS8cEUum 8t5hMjK E9؉EiEEUWt_GtOBt-]Kt/Mt3Qkt# btgt)>mtwt&2E"EEE@EEE EtOuE]މً}]ߍu]uU؉EԋERPEUJY9u{9uwE@EEXt *xum@UuE]މً}]ߍu]uU؉EԋERPEUX9u9t.j") $5h*j 5hjn EUe[^_USEu2 w=vjhhj$ P]USEu2w=vjhhj ]UE ptujjh!j UE[y hAj uhl hlUESw=vjhhZj- p]UESӃwvjhh[j P]UWVS$1jjEPSkbEUj 8t5hMj }9EEWt_GtOBt-]Kt/Mt3Qkt# btgt)>mtwt&2E"EEE@EEE E]EU܉E؋EËU‹uEƍE܋U܋E؅UE |w1҃} |}w19uuuudX99GEEXt *x@i]EUUԋUӉEЋEЋuU֍UԋUԋEЅUE| v1҃} |}w19tuuuuW9u9t.j"U $5h*j 5hj EUe[^_UE`dUE $USxt  )Jt AD;PHrjDHX]áUtHUWVSQQ=tl څtC< tIu1R)P5) eAD 1)Ë5D-p9v¡xEt19s,;C t:E8AF19s;C tAF t;pF)ȃ uHp9s!)Px tP RVQ Nt; tC< tBuu HpDH;PHrjZ5D=e[^_ËU҉t]R)P5D(p)Px tH QDRPpHU xVSt 5)Kt Fp59H9r5x u I9r*9 9r!)YSV5Df'DH D H@D;PHrj[p)9УwtR)P5& e[^U=Stp5hx  A[9[r5y u H9r*8 9r!)ЍXSR5D&DH DH D]Ð111111U1‰USdÍEPsR @ZYt9E%=uK = t=`uXEPhzf@s @ushMj UtK tKE%= uAuE؉}܋EMH(MQ0]X,ЉUeUЋUI4UE̋]ЋEEЉMEM̋]H0MX4]A8Q<C8A@SRPuuAA51RPSQ>EEU}e}EEȉڍe[^_UWVSdE@HU 9}ЋU=t(RR1щMIJ JJ-hh]XZS9}ЋuFUB9}]S 9ЉK}ЋuF hZPh`Q5vhe6hp $=tDV9}ЋUJB9}ʋMQhRhPhX h? XE(P]3h2 UMB EЋR$+A(EUQ,UA0Q4M]Ӄ =M܉]u^vuEЋuu]ŰUUԋMщMEEU[u^Ev]]ډUċUUMщMEEUuu^0U]BEREUMev4M׋U׉E}EUumM5qq RP]s 5uvvEU RPs5vvEЋU RPsh (U Ut mmɃ$h =taMA8+Y@Q<։]qD ÉutRP,$mɃ$uvDv@Epuuph. $ h XjXE(hP tEPh _Xj ^e[^_US1ۅ|w ؃ڻ|vjj RP#=C؋]UWVSQQ=ƉuhEPY_1(ыA9}5ssS$C 7 ~\9}5FC +C(sS$S,s ~+9}5ssFS4C0 ~ 9}F C8+C@S<SD~9}FSDC@~9}Fe[^_UWVS|hjPDžd8jXhPDžDžE Dž0h+ateHPtdcta|Xgtilikn{ktxhhGan_Ph 븃t hjjVjh:. yhGe (U _uh\ jjVPh: y hG 5$1ǍP ^uh\襶 $19Dž}vCt'CP YB|t>F$9|˃t$D8Pn Zu3~ h\ X\ XP X1n@o1;};j 4S 1у \,R F_CC ^ [6hjHt hwjֳ DP&Y5xh4 XZj@hu uE pU jQ)EU 1^;_s$1Ku} ?Džu*=jPhY[9DžDžÉP_ZuVVWbZ=Yuy.9t y Whҳ _XhSV3 9t19sTDžx1=t{xxKu=t]tXDž|1=u1ҋD% u|+|Ku=tj!EP} 7ZYyD7QE%= $U |M h ^uh*U [DžtPsg Yu#Wh8- WDž5 DhjPtE 0hM DžbVSYZu,ƅ4=t*U 2hM蒰 XDžZjSZSW M VSY_yShMG XZDžhP[_t DžD}u򍅴=t E } ?=te[^_ÐUVS] 1ۋut-p$;t3V, ZYt1=pe[^UWVS]1tz;nu{ou p1؀8t 8,uG@P Yuh\ 1.؉ @j,PH [ZWue[^_ÐUUWVSQ։ESC0| UÃ1IQRjajhK9jS1IQVj=(jhK9j,1IQSjjh+j$jUWVSffEf+u fEE]thMP:+ ZYu KEETKUEUP E_u E>tU1у~Auv|\u|cu AEC>tEC뫃}uEEC}t<]~Suj @u tVe[^_UVS];Cu C'18tSZY tSC ue[^Uhj脩 UVS]Su Zt SV؍e[^UVSu] VhYu S]Zt'VSY[EE e[^Se[^UWVSuVr} [u WdYtVWwvs [ZV_WYFVO_11 1RP~VW e[^_UWVSSSuYu u Zt1uu }E pUrr ^_1RP?uu EU XHBR19ӾEU |9w11WVu]u Ue[^_UWVSSSu4Yu u 'Zt/uu E pUrq ^_1RP?uu EU XHBR19ӾEU| 9r11WVuu e[^_UWVSSSuYu u sZt1uu E pUrq ^_1RP?uXu PEU XHBR19ӾEU |9s11WVbuu e[^_UWVSSSuYu u Zt1ueu ]E pUrhp ^_1RP?uu EU XHBR19ӾEU| 9v11WVu=u 5e[^_UWVSuV} Zu W[tVWwvo ZYVWFVO_11 1RP!VWe[^_UU WVSEM]u}|(v|v|wy y y1[^_UWVSuV} V [t WIY uhA=tt?GFWVRPeppwwvvF thjM GFRP+YXVWe[^_UVSVVEMU EȉU5U tڃىUMY[[^E^Z[^UWVSuV} p [t WcY uhA=tt?F+GVWRPppwwvvU thjg F+GRPEXZVWe[^_UM WVUS1 Ћu}tQRuu'9u9te[^_UWVSu [tu Y uhs=ttqUBRUEE HXEuM MuEutppU rrMqq* t%hjV U BMARP-_Xuu e[^_UE 5 EUMu AuBt1UWVS}Wu [t VY uhRVF uh?=tt=RPww&RPvvwwhthjx G~RPUXZWVe[^_UWVS}Wu [t VY uhVF u hj =ttRPww $ G~ЙRPXZW^VXe[^_UWVS0}Wu jE puVn t hSVPGShMjo jEPjwV~- u3]ȋMĉ u'}xWEEGP(E)ȋURP }ujjXZ h$^Wu ~EP e[^_UVSxu''~'5)t PRv Y P: Zt`ҍptPR= Z P Yt#DXx1ҍe[^UWV=S|u 1f6=y4y 6`x`9ul9r hw BfrBB|j EP3  :tE8t Rh*j/ x;= | N~jhD3R uNuEtUj EP32  :tE8t RhG/ WQb@ZYu3hMQ YEXNuUaUhhhh5x jUWVS`=}u u4EPW[ZE%=@uo+}uF]SV\ZYuE%=@t&=ueSV^ZYuXE%=@uHj/W Y[u@PVhhSI =~*?WEPV[=Zt=5|?Vh%5x =$u# AHAyQ @5 Yƒ tGtB=$u# AHAyQ @5z Zƒ tB뼃ytYt5xh2 $V[uVWZYtVhM "=tWPVh@ 1e[^_UWVS`j/] 3Yu_u@hrP _ZchSV& @up)ƃt= fwW$`?3hKSVj% up)ƍ u -tt *t#jjh3 Pjs=tt-EPVZYuE%=u 'EPVY_t VhMj E%=@t193tjV3 ǃ WUUE @@E E@@Ee\ UE@@U E B@EJ\ UWVS}u O<^=u5$@ $B@8.u=u B $A&;\v\=@u =tP$w@;\Y[v\k$@<(@(O<9W8|9v(B8@(A; (rh)j }W`> /j(q rj(ws1I;HvHI;LvL=LDžtm(rDBcZt&8uPD h(j> _Xu hI;PvP1=(Dž4>8P~8@^u!$r@Bph衉 $fy2duq@hMhR< "$w@GphhR< Edt8R0 8R0Y@[u$p@@#4P8q6@_Zu)$q@Aph 85 85^4uh(jК 4[14эA;`v`D8Pp Yu hj @P DCP (A%= t=`u Dž=Lt-DCPu =(tFD=LTuDC 4P& 4蟹 $_ $@$ u#=Tu =d0W, \UME@hjUR1ۋ }E}J: ؉򮋅P=$u$|BHBy Rj  5|j G XZ1EP$piƃ{Xths藲 _[\t<=$u$|BHBy Rj .  5|j ^G [^e[^_UWVS,=8@}EԋG ;~/P5 芫 …XYu jKy XG  Et x t MAM@u=PwtG$p tGp=DEu!ƍ6x9}}e[^_ЙEЋE}ЃE܋tfx2t.=Tut!0WڍJ1Phv [XEUE9Um=HuuM؉MEEE9EM W$wzE=HYtEEEU9U]E]!;]=Ht E@;EMԋUԍI=$8M̉Uu7|ɋBH By ;B| t"RQ 5| PE XZ]]#]aEMu9M=$u$|BHBy Rj  5|j D [XE؋E9Ee[^_UST=Eyj9>8dZ=u j [=<t=uLEM9~9}=u=uEPu $SjP]S5|S ]UWVSp Utfx2t6=Tu =t$MQ0ڍJ1Phvm _XUDžDž<y =Py Y^19}]=$Rlu/|ȋBHBy ;B| tRQ 5|P> XZlދpv S Y D4%tE1t=v SZ Z D4%t %ǍtPjVpP7 ~e[^_UWVShtjPu1 [u^=$u)|BHBy;B| ?Rj? 5|j?< XZhtjPFG nuG=$u)|BHBy;B| ?Rj?V 5|j?< Y[GEpv R Z D4%uI=$u)|BHBy;B| ?Rj? 5|j?< YXG19}]=$Rlu/|ȋBHBy ;B| tRQ 5|P; XZl럋p1t=v R6 Y D4%t %ǍtPjVpP_5  e[^_UWVShjt} P 1 lju&hjtPEl O ?ulZpv RV Y D4%tF4]t$tPWupP4 ne[^_UWVShtjP' DžlF1ۃÅpv W Z D4%"\19}VU=$:_u/|ȋBHBy ;B| tRQY 5|P9 Y_릋p1t=v R Z D4%t %l}=p=Ph> Y_=$u)|BHBy;B| \Rj\v 5|j\8 XZl=$GZu/|ȋBHBy ;B| tRQ# 5|PZ8 Y_lۉhu#Džht1}Ih1;hYE=$8u)|BHBy;B| \Rj\ 5|j\7 XZ=$u7|H0BHBy ;B| t"RQE 5|0Pt7 YX=$u7|H0BHBy ;B| t"RQ 5|0P7 XZ=$u4؃|H0BHBy ;B| tRQ ؃5|0P6 [XlGtHuhtjP| E utPjupP0 4le[^_U5xh[ j` UU5xhR5 j@: UWVS]} EE9ptmt &vtDEEXhWSs upuhMd XZu 芥^tu hҷc Y[u誥W褥%u藥f^vv W蟡ft5vv u hc à tPu h [d ff FPW?YZtPu hGlc vDW}[Zt#8-u~DtvDu ha/c FEF EEPu EE6ZYtu h|b [^W裤Yt u hMuPZtuhҷb =ptu uhVR 1e[^_UP蔤uDju u=phDuPhch[ hhMGb $ujEPR- @uhzEt ht Phu7juhDhhch[ hhMa j^jEPRJ- @uhha 0UthhPb 1tRhh7b UWVSP=hu} jW蕡[Z|]SV@ZY3=dt=pxWh跙 [^f=lthWh5x yjW$ZY SW裝ZYEPEP'hWjuIY[PjuH[Z} PtPEPh5xf (=$u# AHAyQ @5\ Yƒ tGtB=$u# AHAyQi @5 Zƒ tB뼃ytYt5xh蕠 %WV`ZYu=ptWVhVM 1>8uvEPV7@Y[E%=taSVaYZuSVh ` [PS`YZu-$PS} [Zuh1_ )WVhM_ ]SV賛ZYtVhM^ &E%=u SWV WV*ZYe[^_UWVSxitft$nnt=vtXbld4hdl1dlhph]u u apU )E}U EP} Mt趚_ZuE%=@t }~qE p0t5EP4YZuE%=@u GEEC<Ʌtd=t[5xh  XZu uhWh5x }u5xh%貘 ^X/~-uh1UPh?5x讙 5xheZo 5x =$u# AHAyQ @5 [ƒ tGt]=$u# AHAyQ @5@ Yƒ tBBtntNtyt Y1ytYue[^_UWVS=}utWhO5x記 =F%=wju ŖY[uFDuU=xHEPFPvD:/ u hjT =t Wh[j[U W;uP;uPjv>_ZPjv =ZY} PtPEPh5x貗 $S _5x =$^u# AHAyQ @5 [ƒ tGtB=$u# AHAyQ @5O Yƒ tB1ytYue[^_UWVSd}EPS莑YGE^t0tfEO=|t[8OShMT Pt'jjf $Sh*@U U%=@u%=uSh U XZ=|u$%=tEPSSA =xu EبtuPS"YXuME%=uSX.=@uS=tEPS^ZtKSYt*=|t 38tShMsS XZ=tt uSK ^}_e[^_UWV1=xSt=|u=u=t=t jPuh =|t8/hC4H $sd $sh*jQ =|t {sOd $sh*#S .=|u-s uáp9Í4uE>6ҊYy.6hM}M XZEShMdM [_y=t6E Y=tb1эDH9v8/t@-H9r8/t@9t)SKZx=tSE _j/S8 ZYu1 E9u诼 U)US jh]S jSj]UWVS }ucE @CE]v Rͳ Y D4%@uъ1<-u3SUC=fw u:.tc<+uCEU=wtj EPR蔰 1ɉMEE8.]uDUBEBЁw(t0C ȉיuu}}~ jEPׇXZ1e[^_ÐUU`j% UU1ҍt8u'B~ 15( Q<)‰UU`RP贇ZYt hn jvI E%=t=t5hjI EЋU(  $ UWVSRj5EE_Xy 5jG= t _:h hd@V  uh( hd@V t h"jH ( Ӌ$ 9ډ |9v h;j8I jjjV h h Vċ= t5hqjTH Vf( jh Pl#}tt5hyjH D-hjhP-hpjhLS- 5jhS|-h jhS- S}.^tS  "/h1R(P5 5 1ۃ9ӣ   u49u0f1ft"5 1҃t)AÃ9|e[^_Uhhhh@hxhhh h7hIhmhhhh5x! @j UWVSVV׉u5hV = GWf_Uw4 hL$PhV贉 Sjh)V裉 ujh5V蓉 VhYY YGX[t VhBF XZGXt VhN3 Y[GXt VhS XZVj 讈 w(h\V4 w,hoV& w0hV w8hV w4hV $w~ j5RÅXZ(= t5haB <7&hjhP&hpjhLS& 5jhSo&(  PhhSG& SZ'^uxS(= Y%hjhP &hpjhLS% 5jhS%h h hS% S&ZtPhM&B S':S'?5h S! ;t5h&A S؂ S˂X1e[^UVSFt1Ӂv RL Z D4%@uӄt#u1e[^USSCEt,Ёv R Y D4%@u}#uʊtC<#t ؋]^1]UVSPPj5^Xu5hg3@ F= t );h hd@S uh( hd@S t S裁1^hjhw ( 1R( P5$ 5 WEVdWEVuVhd@SHu E   ?Vhd@S! uE&=w =$ 5 1 fjf(l f*amnesiac51Ҹ=sf3SfhCe[^UWShPӉû YZuWkZu Whj= hPS {1e[_UWVS,EEuE= Ex(u 5xh*Uz,u 5xhMy0u5xh~ Ex4u5xh2g~ XEZUfzHu hD:> _My8u A0A,A8Ex<u ‹@4B8Bhh* XZhh* ^_h:k[11S YjcZG8Cts=8#uuj_k|utVyc[?iPifYjPj$ % ZujhSS& ShMjh ) h ) X39tP_yVb[ hhj ZYhjWP Sج Xt hWhg h<a ^5| =$[u#BHByR設 0@5U YƃtD t?=$u% AHAyQd B: 5 Z 뿃n(hBiXOt91ҡ|1pt hvi Y_uvhUj& 1uju vOu Dž1&du FY1u 藖 UVS]SC C u ‰KQA A C ‰VKQA A C ‰VC F C F SC fF[^UWVSQ]SC C  ‹} WEVQA A  WEV ;Ef19ÉEs$Q Ѓ1;MrfKSC fGSC fGjGPCPb jGPCPyb K(QA A C( ‰W(K,QA A C, ‰W,K0QA A C0 ‰W0K4QA A C4 ‰W4K8QA A C8 ‰W8K<QA A C< ‰W<SAC@ fG@SCCBKD fGBQA A CD ‰WDSICH fGHSKCJ fGJSMCL fGLSOCN fGNKPQA A CP ‰WPKTQA A CT ‰WTKXQA A CX ‰WXK\QA A C\K` ‰W\QA A C` ‰W`KdQA A Cd ‰WdKhQA A Ch ‰WhKlQA A Cl ‰WlKpQA A Cp ‰WpKtQA A Ct ‰WtKxQA A CxK| ‰WxQA A C| ‰W|QA A  ‰ f fQA A  ‰QA A  ‰SVSXOZy1ɍe[^_US] UBBBCBJAAACBJAAAC B C B fCBfB[UWVSQU ]CCCfBCfCfBCfCjCPЃP] jCPE P] M A(C(S(BBBA,C,S,BBBA0C0S0BBBA4C4S4BBBA8C8S8BBBAu(x$tɪ8ut}t$]Cj)PSuuhMN hj贅 U[ Uh_ 5 5 5 5 hOIN =w=w =v h  Xh 5555hOM UWVS j hEPEU uh AUBR )@ E MÉE}M EԉM؋M؋UMMU19tF|PUPPhM MAPuuuA  PhL U(B PB PBPBPB PB PhBL EPhL e[^_USh Xu!ShuL CZY~ ؋]p]UfUUWVSQQ]f;uuuj hSP i15UfCfC 15CC 1҉5SS41+5 15UfC15C 1҉5S e[^_USJ )h6]Ujjj5賙 =Ph 5T @uh1f=Ut h. UWVS=t X.hjhP~hjhLSij/5  Y^u @PjhS=h 5 hwS$S7Zu SPhMp _XS$j5 h 5{ ; te1xW5 h Sk jjSS x h hMPP VR^t~h [e[^1_UWVSQ1ۉUuVh/I 5|H 5jdh@ S uj褀 1@ Ɓ> @ t @ Ѕt t uAu1]AtBЃ w k \ t ut t uAu Eh@ hUH _X'e[^_UWPhH 5|f 5jdh@ R uj 1@ Ɓ> =@ t[hh@  _Zt?hh@  ZYt*hh@  Y_th|Xh@ ͌ _Zu1}UWVSEuhG E_= X= t.1}uh [V EF)@PUMYtEFPUZtEFFE@ Phh"G 5jdS Q 1Ɓ> @  t t uC"uC]t""tC] t Ct u}1эQ E BE@juFPhd uUE_tEEuUg[tEEG]F ~ EWUl^IYt}u؍U1ZtEESUYt]Ef~ F f~F~F EWU^^^ Zt}u؍UYtEESUZt]Ef~^ F VUEYEQde[^_UWVSu] Dž ft]!18Bt)at3ttY it:stAzutRvtYn  wD k _ S G ; /0 $hhh5xM jJh<SV = u = t  = t  p9ƍPhE96F@Y[u hOqjh[Sx tPh%jPjVS1t Phj +@P< Ztw)RPSb +  VEP38G^_t>8u48/t-Phhh  = uh6j`  $P5 5 F@Y[u蛞8'5 h- u5 h} XZ= u= u1ۅtS5 ZK^@_u:/8uuj5 4KY[=u8u5 h# XZn Shd@PH u   Shd@5H u   S  hd@ 5  4H u u Dž  Phd@5G uP1R PVS8 1 RPVS = u5 h8=y5 hXjI = t hlj' 5555 ht@ hUhh@ 1ۃ Ft.PV F)Ћ @PRCPh? C ~5 h? _= Xt#= t= = 5^t 54[[t 5J5Yt Rbf95t 5 h> hx hn  uCP~ >= u = Dž1?y^Sh> XZuF ~Ӄ= t$ t  h [!u Dž'tHSSYtCwbt= tdt= u= u = tP= uh= h XZg= u(t h Xjt UMS] ACACACACACQA fCACA C Q A  fC A C A C QA fC1ҊDDBv[US] UCBCBCBCBCBfCBfBCBC B fC B fB C B C B fCBfB1ɊDD Av[ÐU{U5xh*C jr UWVSQ׉蒗j EPSlZ y 8t ShMjT E8tWSh_j e[^_UWVSE} vlGj jp U UWVSWjEP [^NxBi]u(P} ZYtuP} ZYu Ny1e[^_UVSuP=PtV3} ZYu ;1e[^UWVS}W:/Mu1ztXNxQi] PwK} YZu(w~Zt(P7*} ZYu Ny1e[^_UWVSS] ;nu{ou 1u E1Y68nuxouSP YZuSP YZu1h9P(YZuuJ1 e[^_UWVSuPP(Ph7 ^t.=t%twh)c7 !XZt?fx t6hW7  Y[t 0hM hf-7 XZ=^LNH u VTFP tvTvPSQh6 ^\NX u VdF` tvdv`SQh"6 u t(h>6 1XPhC6 _XvEjae[^_k UWVSPPu ]t>umtS;tN1ЃщMMQM}/ DžXu h\j VShFuWʰ  Vk ^tSZ/ Ye[^_UWVSVE 0E}EDt><-uj=Sw FY[t(@hSFz YZt LFFh9EP| ÅXZuE 0e[^_UWVSQE} tU8tPtL?tGÉE'VWy YZt;,u<FCuK,h9EP>| ƅXZue[^_US]uPjfYZt hPPTYZt hxPBYZt hP0YZ t hPYZ@t hOP YZt hpPYZ@t hPYZy hPYZ@t hPYZt hPYZt hPYZt hP}[Z]UWVSS]sPƍEPW(ShU3 V- SN' u W&Ytppha3 e[^_hux ^Zu#hE9Wx Y[u EiEnEse[^_( UWVSx P]u}u XZuu;t޻VSU $jhE9Rvw uthxV7Y[thV XZth~V [_huw ZYuEuhhPd WPVdDž8U dh=DŽdt>uh1 _X;}dh1 Y^Cj ŝ7:ttth V* huv ^ZuWY[P6WhPB 8uhuhx jNh V* j|PSy hH j|ƒut%wtt4@Rh* 3=tISP3_ZyRh = tSS^1e[^_UWVS }} uh /hWh| Wu)EE1E5Sht ZYuWSh| t ZYuuSVlY[h9EPw ÅXZuu)) u!) Euu1уQ( DžXu h\j! fnoGSW] WuW( jShE uCPuY_SuEXZh9EPXv Y_oV~( Ee[^_Uhh hGh5x98 jf UWVS$uE1EEE p%dt[FtcatEftaoteurtittkvw5DQMyD8toPX ;hE}t hwj 5DEDEX.M%hu?Y[Ehu Vl pU )ƍU E tjEPjÅXZu h(hwq Y^t&hwq ^Zthwq ZYutuwY^uchw r^ZuPEuSuW u6Epw u@w Puw7wEX$tEa Dh= t>9]V1EuPZYu EPE_Ku!9]1EuPZYu EPXKu}tE 00_EXU 2EE+E^uE 0h1P[ta](V0p ZYu!Pwp ZYu Eu)U 8/uxuhE9NjEEX}Etpw (pUju jEuЋEu܍RuPWE 0&DžXuU 2YDžXu E 0hChw=o [^t7hw*o ZYt$hwo [^tU 2hj w uuw7w}j@E 0 ZYuj:U 2 ^_t{?@uw1э|1E 09tR=w u5Ӂv R{X Y D4%u.t -t:uF9uE:gjuu܋U r2up@E؃}ufg1u]hh2 ÅXZtFEPhfSd Hu*E~#jPt0@^_u8t h/j St [u*` U5xh] 1 j` UVStu] EHp%oujEPh`5DhSVR uǡp)ƃtnUEЃ%EE[PRShEp01҅yT"tu/SuhEt Suh Suh uhM* XZe[^ÐUWVSE EUEUEu E܅^jj~ >nu~ou EEj=V$ Y[t@];taU1IMQRV uUt <=tă;t%{ MuME;CCu !‰=u Vhj{ 1h9V tƅXZ8U܉Ue[^_ UUSM ˀ:tz/uB:/tBA)H~ y/uA[US`] SuzZYt-EPS}*ZYuE%=@t)Shj@ %0N $Sh*j@ ]UWVSQQE uEÍPU2Z MljXZu E Uu& UU1҉߃}ыELCM ؅_y}֋Et]U e[^_ÐUVS] 1ۋut-$;t3Vi ZYt1=e[^UWVS]1tz;nu{ou 1؀8t 8,uG@P) Yuh\ 1.؉ @j,Pd [ZWue[^_ÐUU5xhK, j@[ UVS,jum-Y^Phc@SC+ @tT)ƍFd<fPhcSƅƅ* @uS,S,ZxuHy ȍe[^USh]&Zy-h&Yxh&Zyhp _j CxYtMj C|Zt;jhsx A jju 0ZYPs| A s|sx: ҉Ћ]UWVShjtP]u DžpDžl1j EEE jtg$bt?Cet6gt=rth ot>st`vtlpppzpqpPlPh5DBNpE5D_ YE4G15DtP8@YZu hjG p 3hVSwz p)Ã4ttPv SSlp}DžxtDž|Eu8SEZut h  ^Et PhH! Y[tPltPh&)ythMj jW UWVSE EUEUEu E܅^jjz >nu~ou EEj=V Y[t@];taU1IMQRV uUt <=tă;t%{ MuME;CCu !‰=u Vhjw 1h9VmƅXZ8U܉Ue[^_ UUSM ˀ:tz/uB:/tBA)H~ y/uA[US`] SusZYt-EPSy#ZYuE%=@t)Shj@ !{0J $Sh*j@ ]UWVSQQE uEÍPU2V MljXZu E Uu" UU1҉߃}ыELCM ؅_y}֋Et]U e[^_ÐUZUSRÊ0<w"jEP5D+J xE8t Shj@ ‹]Uhhhh5x;' j@U USh!(!Zy0h!!Yxh! !Zyh/ j YjhPu; uZtP[Z7j Yt+PK j 0u1҉Ћ]UWVS hTjPDžDžDž1d 1DžEEE-g5Lu9tjDEM?W.olt)mst ut)DSO Zt@5CtЁw uu QY YQha^DžSDS* Zt@:CtЁw uu QkY [ QhujC DžDfDfE5DjjZYtj.5D諵 Y[u5DhMjNj EZjjCPY[Puj EZj5DP8 PPh`5D j E[uj EYbh5D^ [Zu*EISO8@859-f@2ECP85f@2h5D^ ZYu'EISO8@859-f@7ECP73f@7jh5DV^ Y[u jhh5D7^ [Zu#jhua ECP86f@6 5DhMjBhu ur pB;EttufEtEfE }4\u/}tJj1 EYuh&ISO8@859-f@1T@u h!jG PSAVV%TDž\Xt tucPSc@YZuShnu u uf%fEfTPPh y VhMjG jN UWVSE EUEUEu E܅^jj^ >nu~ou EEj=V Y[t@];taU1IMQRV uUt <=tă;t%{ MuME;CCu !‰=u Vhj[ 1h9VcƅXZ8U܉Ue[^_ UUSM ˀ:tz/uB:/tBA)H~ y/uA[US`] SujZYt-EPS]ZYuE%=@t)Shj@ r0. $Sh*j@ ]UWVSQQE uEÍPU2: MljXZu E Uu UU1҉߃}ыELCM ؅_y}֋Et]U e[^_ÐU?UPPjjEPEPhEth( 1EUWVSj/] 3E#ZYt@h4Pf ^_Et E1EE|F w@$MdDEZEQMEDM@;4= ugP Ph95xx jNK hZSul hE%=u hbj t o tuoj1}thh$hh ~JjhPjhS1}IQuS$jhSS[}u_u>P [t8= tj"jh4M Whj"jh7 Whj hhhoQ }u-jj@ZYuh'jj5 jj@u*n8t hjv 5xh _Xdj?1^+}uj#9YtC~׻j j@_Zu 'n8uPC^um[n0) $jj=@ZY9tRhjm U\Uhthhhthh hh!hh5hhIh_5x 8j/UWVSj?}YAhj詷XE ZERDž :-PK _ÉE 1Q' ^Dž8:OtruWhq Y[J1уQ Z‰u jj -B0BP= Y_"u-FDžF94tu+] CEB+q$Pj P5DdP; pG‹ 8t5Dh$hT\ =Hu# D=Hut hDHDtPRhj5 D{Poj P5DZ: ‹ 8t5Dh=j 0hWcLXTChzu uf `p)EE =Du hjb hj&0 H_Zu jj0 [^hj 0 HZYu jj/ ^_5xy[uh 蛇 Yu Dž5HE<X}ZuU BEE BDrtIRtittx~Xj@-j8D/sX=lGX~ft5|h ^_h8j,Y=X[t5|h XZhjhT&*9Rt5|h l ^_jD8j,Y=X[t5|h A XZhjh% hWhj^(X ^=\_t/=Xt5|h;  Y[hjh% jhP5XZ+h79S hj'jh5Vj+jN7^_EHE@hVE 0E LVk]th PV$ VjM+j6Y[EHE@tLhVE 0E V]t˃=tVaZhSV$ Vj&=\Xtj(UVSÊ< t< uCmts\u Cu5xh[ V XZGC 't "tCF2C t CF8uCuPh~ 5x; K < t< ue[^UWVSSh]SdN Zu Ytjh S u;/uf. f./F1҈щM߃ыEL;Mr5xh s j'SV7 YX?tGÐUVu NS1ۃ=ádGt;=Xt}5|$te P XZuVhj 5| e[^UWVSt1M =IʉEdGu}u&=\Vhs 5|7 } u=Diu =Xtv=u&u h ]SA u u S\Gu ÅXtSe$V"< ZYtWu V uPMYfKEe[^_UM S1ۃ=IdGt*u,…XtfBzfBtRX؋]UWV=XSt5|h  XZjÅXta=Xt5|h  _XCPJGу0{tdG0tSSKS[^u;5tGV[YtxNGu^=\tS$h 5|P {uSeKSSMs C  [XZuFie[^_U|NILSth h# XZth h# YXth h# XZth h# Y[]UWVS M IEEEdGtEuDžXt)wMƅXu h =HX9tEu ƅXtM^t 9t*[EuP9tL}uWIW[_0׃=\tWF$h5| W+LY1eEt"Et F;EuEt G;EtM}E$<fN}uWcIWXZWKXuu u@ }uPXJXfK=\hS}ufFufFFu'uVd$CuVJfNq~uVE3$uh&Muu ufH ;}uaWHWEPu uo}uPI_fK=\SvD$uEPhL}ufOfO=\[WFth^VCF[^;~uMu Yt&~t h{VFXZVGV[_vuu uPH1 uVJYv F uu u5 mƃfN=\VC$uEPh5| x=\tuEPh5| EGu uhuEPh5x uEPhD Ee[^_UWV=XSt5|h> [^;=tGsvWYtfxt`OdGtF^t?f{u3=\tS$h85| SFS7XZ[G낋5 t^^tR{uGf{t hVS)DY_=\tS=$h85| SESXZ[몋v 랍e[^_UWV=XSt5|hn* Y[ 1۾ tE{ts C SESoXGZuۅuƋ thSrC_X[ e[^_UWV=DRSXut85|h $t5|h Y[5@uXZj@Ƌ=@XtG9GVs@[;5GsEV6Yu Vh~BXZS$h5xA fcV*@ƃ볡G9tPVh5x K6QVÅXu h%BYCu h;SNBXZCt SCfcXSY$36fcY@9Pu5X=@Ze[^_UWVSWW=Xt5|hS< [^jfG'5lj9?EtGHPZ?ǃ u@E?WEX;5GvE9@u4E9@t4^u;5GsCVFÅXu h @XS$h5xS fcV<>ƃ;5G9VÅXu h 8@XS${4Efc9@^F4e[^_UWVSjYt<=Xt5|hl XZFtV1$=ff_vu߃=Xt5|h{E [^Dž;tGslYtLXtECt:V$W X~ZujjS$WD fc[댍e[^_U=XVSt5|h [^;5tGsCVyYt3fSЃ{fCufSf{t hS>XZ[F뵍e[^UWVSPuV} EÅXuVh5x; 1LW9YtEt 9t@u Wh+>XZ{u}t hS]>_XEe[^_ÐUG%=@u1=GuUS1Q`t 9Ht1Z[USf@ fCD=~95-h@jf)hGfG DCPDSGP DS@УD]UWVS1;u ]=Kt ShcXZ=Kt;t=Ku {uCCC%S)u9C 9=Xt5|h9 YXCt=Xt5|h  XZC S9s=Xt-PRh%5| =Xt5|j h [Xփ;Ue[^_USjjj06 +CC]UWVSƉӋ}9tU)yShH5x %jRP6r6 %FthF P6EF e[^_UWVSExu=h PU2U B=\tg5xhm ^_SEH;H| @릋]ˍ{ fWft)9~$=\tPh5x 1U1UB{ uChE9P+ Y[t2;tGr&=\)Ph5xU e[^_UWVSuS ^/Xu@x/t1k<1҅tR1LPR -$1[y5 -|Yt@9uWVCPA uԉڅ҉u1&:hE9P_- ƅXZt >s؍e[^_UWVS ] ujSuUjSuU huP1ۃ EѸ)PhE9P- ؉򮋅PIR -5 -e t$h@P) _Zu5 -=^uh5xh t$hlCP) ZYu5 -Xuh5x* -IDžƄS=CvhPVh 5x +RPVu3VVp -5 -Tá -Xhe[^_US]3%Y]]xUSjP YX1t"h ?Zu S1 @]UVSu6Zt$StVR:1e[^UWVS@=Xt5|h [^hD] Yt8uKDrtRu5`GPhQh =#u h^6Khhq DžXZuI>0% $ht5x2 hh5x 5xh %=$ufg W6P^Wj4jEP軠 =$uG WO[uƠD1V@-9v"R6)S j 9tK/vShH-e[^UPB9ȉuAB$t@9uA҉Bu hQQ-XZUUW1I`1_`1UVSuf~t hV -Y[~u&~t h"V,XZ~t h?V,[XFt^P+Yu h[V,XZ9u^SVXt/1&tC9tFۉCu hlVz,Y[6 -F 5 -e[^UWS]u h{+X1ЍH`1t ׉`1PDžXu h+XSW e[_UWVSQu ]u hS+XZ;{t'G{C_j/V Y^3xDW61IKSE/Z3PW fCu fCe[^_UWVSP= -tG - 1j$j\ ^_u h*YECEuK} u jAZtuh*^_uu}1IڸK[j/u ZY@P@ǃ1IFKsC^EXt+u ƅXu h *XE CFC^(} t"u _t h)^ڋE e[^_UWVS\=Xt5|hS [^=Phu{ ZEYu320. $ht5x; uh4P)ja=$u Ef` uPCX;5tGw5VXt%C uCPj3E G[FÍ}E;5tGVpYtpj$SW, ECEC@ GC t@ GCt@ GCt@ GC t@ G ujj$W [Fq1;5D1s1@1u E@ EujjEPf FNjE EtGED1EEElGuE`GjEpGjEEP =$u E@ @ uӓ Zt/500^ $ha5xk uhm'u e[^_UWVS=Xt5|h [^}uL tG1һjPD1 Z@1Yu h '_jjhfHjju y/h/0葬 $hu5x uh&tPSMY^y/&/0O $h5x\ uhq&uVj DžXZu hN&XVWS xjEPS y/.0ݫ $hl5x uhF%DRt7ruhlG9Etk} 5xhh 5xht ^_jElG=dEfG`Gu u[u Y Phx%XZE]ܣtG47)ƉE؉D15@1H19}t k$BQ$9sQkB$BB:t k$BBt k$BBt k$BB t k$B $뫍e[^_US]; pG~B2tPY P2Zu5xh: j ]UpGB=dS2]tRj |} YhGt h2j:Stk YZt/j:`2S`k [Z5`2+CYh(jS  YZhh YhGZueO,0x $hh5x hh hGu&,09 $hh5xA 2p2PSD [2Zu5xh j@]UVSV5F5F]+SEn $h:5| 5F5F+FE֡F ƹJt S+ [QhU5| (=Ft:hXFhFhF5Fhe5xV hFh5xA e[^U=l2t"f=Gu5Ghh tG=l2GfGfGGtjh6l2aUQQ=@=p2t5xh` jH=`2fEEt Pj,XZF=h2u=EPhm5  y")0 $h5x# U=PuEu u57 @u.)0Ϧ $5G5Gh5x UE jRP57 Bu5@u2W)0耦 $5G5GhG5x jU$;E =U$;~$PRh 75Ghz5xA jtU E 7 U5Gh5x jDUS] Su57 7]UhE 7UUx6=h2t5d2td2=`2t*,PCXUE Pu5xӢ UVSuU 1>˃htH09~.bqtn ltAstwtk DF륅uщKxAQuKx~ BJBJJBuKxX BJBJJBJBBJBJJBʅuPh5xd jFe[^UREEPhEUWVSW C=T=l=ku%5xh 5xh% =Tt=C=lt3=k5xh 5xh%v =Ku%=Xt5|hML Y^K=K޿Eu EOuEOu}It)5G5Guhh5x 1W=Kt0ShPhpxPh_B7W$| CC(K,~7)19@{lujxu Ks$s$C|XZC{lC|sg$sR$s09$s8CXS\*$C`Kd Rhu_X=KtC$C&=\CTx2|2U;uW5xh Y ^tRPh5x 5xj * XZ=2w[$5xh@5xh35h 5h*5xL 5xhK _X6H29tPRh^5x 5xj o Y^;1҃t&19}57u tB@9|C26=2e[^_UWVS$}u6l2|2x2=p26}thhc=T[=$u hG@ @5hGX Y=$u hG@ 5hG2Z=@=h27@=p2wDt<>/u4WÅXujWY0WP"fK/F뿍e[^_UVS]s{1Yt9tF@u hi%SXZsVhy%h%h@? e[@?^UWVSuF t h%V[_fN V$S 6JVa$41INV$S e[^_UWVS`=Lu} t=PuW>X}u6=PWVCY[H0q $VWh%u}u|=PWVÅXZyqEPV9ZYu)}t#jV聮ZYuWVȯuViy40 $VWh%5x uh&14=Xt&V}W &t)&Ph.&5|Ư e[^_ÐUShE&X| Huكڰ |tPjj|PCPDžtDžxͫtUh|P5  ~7{ Ƅ|t+R|P5PChf&Tj UWVSu~ 1҅PC_Lhlj [=DC^uChr&h_ ZYDCuhv&(P膀 _HCu h&^nj@5PC? Y[toPCEƀ8tTÀu-v S{ Z D4%u _t-tuh&cY[j F>G=PC HCEh& Zu&hhM^_hSuHC0DC@PhPC*)LCyu5PCh& 5PCh&5xA pG =E~EEm}~"jEPhh5LC%xjEPhh5LCjEPjj5LCEy h&ǼYjEPjj5LCE趨y h '虼ZLCe[^_UWS uh7'j]S 1IQS5LCe[_Uu u5LCUPjEP5LC Htj3XEUWVSlj։Ã~< uC#CNh<'%Whe'je[^_UWS]؁ ljU؍B<wH{SWh*EP }Fu @CCAt51эD9v H8 uEPhz'mj: EP e[_UWVS1ۃ ׉EU؉IQR5LC莪}I 9tjXEe[^_USU x&Ruh'hS ڸ'l]UWV1=@CSu+G LKGNy L[^_USPu uh'jP]ST ڸZ]UWVS u h'j]S' ڸsMx119}+)PEP5LCz jXэe[^_U=@Cu'q@CUVSu uVh'hS ډ@C*e[^Uu>1ҋ t Dž`2=Lu)=6c(t.Ps Phi( 맃Xu \EDžLDžPDžDDžHn KTtMt"Džp DžpDžl pPlPq^_hPEPh(Džhj; @u h(]Xt@ph(j tS h(lSlh(h( 1jjdPhEP|BREPDždm @}t h(j]a Tm4pVP884VG ~1e[^_UVSSS]SuVjZYujSjju"jjVjujjjVe[^UWVSHuVÅX1эA |/u HVb_uoj@VE ZYV)PBPh)hW~ 1эA/uHƄ荅P_t.jjVjjjVjPV辔ZYtVh)fPV[Y_tVK%=@ubVh)hW PWtWh*Y XZ9uVh* uVh3*Y "u P^_uS2e[^_UWVS4Et 1=hK*jW hE9s ^_hs ZYt&hs ^_ths ZYu~EPsb@^_tmusZYu\{QDžXu h\jV sWu uuW?1utWΉE#1e[^_UE hPuK Uha*h*h5xf j? UWVS,}] E1VEftJFt6 At!at|ttHht0nvt]ge^5D-|=MEDM4}t hwjXU 5DEXLh*SW  Hp9Ǎut t=Mt}uh:gsE_Mt@1}ԹhLEPjRb tP1$5Mh*jHU t EP[OE~=iuuȍPZYuV^tEOu蒇&|u{PhMjS uE[(E;tu3ZYtEu UVS] 1ۋut-L$;t3VM ZYt1=Le[^UWVS]1tz;nu{ou L1؀8t 8,uG@P葆Yuh\DU 1.؉ @j,P' [ZWue[^_ÐUShQh*I X1Zt&u uj蒪 $h*S SF ]U҉u*RPh*jb UWVShh*ݕ Yp[DžxMsV1҃8h*h+j^b hjPb p 1d<#<  < h+V ÅXZtm;thh+V YXt?u zNh+V ƅXZt>u -j |PSf t @t |8tڸsmh蛄YthWCP ƃhVP ƃxǃxphcSє pK e[^_UWVSVVhh* YE[uh*h!+E5M~twt8CVPR _ZuPR ZYtȅu5W^S6h*uV }tWSh3+R E싶puh }_u#h*蓒@^uh*hN+j_ 1e[^_UWVSPPEu Eub EM_tnu{W ZYuTtVP ZYu=}t$PW^+tPhg+>Q hjCP 뎋EEe[^_bUMtMRM?XÐUUVS=(ÉY=LVSh<5ّ 52 5hPg uL5|h<5萑 =$uf` 5[v Rc Y 4nt~?t{atpt'qt@Sh<5 _5h<(踏 XZA5|h<5 1SSh=5觐 e[^UEVSu t~]6h=5m @ =@t#3Ph5A =;5h E eH$h@h=5 س@=@t3v; YZt;;uvh=5轏 سQC t8tPsh >轈 sh>諈^Zuj 3h@T C4l e[^UVS]ۋE 5|u;l=Хuu |