IPL1 1fffQRfB@f  1Ҵfff0fff%f&$ZfYˁtu1ɠ$<0t6<t%< t< t & G 1҉)׉։>6f[fXRead error No bootable partition PUWEVfd1440?-?@ WEVN @ @  f)Ȏ؎ffggg*g,g"g$ffgf:fd)( RUVSu1] tPOC~jjR p5uD1 t3Ë` uuA9| 5hhh="t3hhhh/Y[t ?huFPaP54@P^uRdukR55hht!%0th-u j hh-=8t)5hXZUWVS$Ej P Mэv; t3t+=t=t= t=t hEЁ tt f=  u1҉ы}W5aP54@Ph huh,uW XuZtFuh7uV uuhBhut )؉jEVP5ujShL+uV& ]jSu^ jVSEЃPjheEЃuV   á á ÍuУ5T(BAuIBAuhh&h(?hhh&WVhrhS PWe[^_UVS] uEuVS! D3e[^ UVSu U< t< uB<-usB< t< t> FreeBSD BOOT @ 0x%x: %d/%d k of memory, %s%s console Boot default: %d:%s(%d,%c)%s %s boot: Can't find %s Invalid format! Booting %d:%s(%d,%c)%s @ 0x%x Start address too low text=0x%x data=0x%x bss=0x%x symbols=[+0x%x+0x%x+0x%x+0x%x+0x%x] total=0x%x entry point=0x%x No keyboard found Keyboard found bad disklabel Error: D:0x%x C:%d H:%d S:%d %s Unknown device @O7    |/-\ 08@]D@ <   ]Dd7@  !'/mnt202 !']D@ @@@<@T 08@]D@ <   ]Dd7@  [> [>]D@ @@@<@TU ]D  H S,8]D?A]D]D]DHYIA]D]D]DPA]D]D]DA6[.A]D]D]DB7A]D]D]DChA]D]D]DDw$A]D]D]DEG`A]D]D]DFUEA]D]D]DGMe{A]D]D]DIktA]D]D]DJL`]D]D]DKMW   ... ... ... ... ... ... ... . ...snap dev!stand binsbin # etc mntmnt1 mnt2 mnt3 mnt4 tmp usr 0.profile)/ ... . ..(share: # $FreeBSD: src/release/fixit.profile,v 1.10 2004/09/02 13:40:34 keramida Exp $ export BLOCKSIZE=K export PS1="Fixit# " export EDITOR="/mnt2/stand/vi" export PAGER="/mnt2/stand/more" export SCSI_MODES="/mnt2/usr/share/misc/scsi_modes" # the root MFS doesn't have /dev/nrsa0, pick a better default for mt(1) export TAPE=/mnt2/dev/nrsa0 alias ls="ls -F" alias ll="ls -l" alias m="more -e" echo '+---------------------------------------------------------------+' echo '| You are now running from FreeBSD "fixit" media. |' echo '| ------------------------------------------------------------- |' echo "| When you're finished with this shell, please type exit. |" echo '| The fixit media is mounted as /mnt2. |' echo '| |' echo '| You might want to symlink /mnt/etc/*pwd.db and /mnt/etc/group |' echo '| to /etc after mounting a root filesystem from your disk. |' echo '| tar(1) will not restore all permissions correctly otherwise! |' echo '| |' echo '| Note: you can use the arrow keys to browse through the |' echo '| command history of this shell. |' echo '+---------------------------------------------------------------+' echo echo 'Good Luck!' echo # Make the arrow keys work; everybody will love this. set -o emacs 2>/dev/null cd /  ...싶pu }_u#h: @^uh:h:je 1e[^_UWVSPPEu Eui E]_tnu{W6 ZYuTtVP ZYu=}t$PW:tPh:R hjCP 뎋EEe[^_>U]t]R]XÐUUVS=(ÉY=LVShK5i 5 5hP uL5ЌhK5 =$uf` 5:[v R Y 4nt~?t{atpt'qt@ShK5蓗 _5hK(H XZA5ЌhL5P 1SSh"L57 e[^UEVSu t~]6hL5 @ =@t#3Ph5і L;5h)T舕 eH$h@hL5蚖 @=@t3v[ YZt;;uvhM5M QC t8tPsh+M轈 sh6M諈^Zuj 3h@` C4l e[^UVS]ۋE 5|u;l=еuu |@=@t;Xt88u] E>Me[^BO u =thph+M ph6MއYZul5|e[^U}E u0h_M5 $gE EU}E u0h_M5Ȕ $E E{U}E u0h_M5耔 $KE E3U}t E 0hjM hhM5, U}t E 0hM h@hM5 U}t E 0hM hhM5 UWVS} `\}1ۀ?tJH9sC`Ёv R? Z D4%t1C<t\븋`tv1ۀ8to`[ҁv R _ D4%t-[v R ^ 4`C`<돋`}t~1=``tF`tv;tN1Ҁ=t;8u"9s2`Aʋ\+`H9rBtvŊAC`}1DžT1DŽd@~?=ƒ$St \u;F8|9t DŽd`=DžTƒ[t,$m\AAA<$ucA=wb5tXA<0u?t1BF:XσdT;TtBFDžTt{u<]tu\uA]$uPA=wI5t?A<0u?t5BF:XσdtT;TtBFtAF<,u9DžTITAt*<]t9\uA<A9uq,]tYIA=wE5t;A<0u?t0BF:XσdtT;Tt BFFA9`8u5hN Y[Ǎe[^_UWVS1}uU BEBfEtAHuh.NE PEP t%}h9NE PEP t}~E 0hEN5蟎 E pYuE Ptڋ8aiNt=nNusN1Ʌt =tQ1Ʌt =tQjRf‹E 1;Xu;PtQRSV趝 SVwe[^_U=VStW=tNЌxN(5(t(5(5[^UWVS4EtHu=hNE PEP! u$E 0hN53 E hBjЌjht=B?t =u=E 555W19u =(uPR=WnNusNP =u@=t7NxN((d(jju o I=<==E 55E j4‹E 1;u =(uQE R=4nNusNP ==NxN((W(K1 SjhE 4Ku uE 4hN]D S< ==E 55j7z19u =(uPR=7nNusNP趙 =u@=t7NxN((#(t &P;[F;uje[^_UWVSh1}DžuU BEBfEtAHuh9NE PEP t%}h.NE PEP t}~E 0hN5ۈ E Pp[u o1҅t =tR1҅t =tR1҅t =tRV}=u5hN 1PS Z}Yu/yShOA [_04,u(jE pcZYt[9| DžGWE 1;Hu;XtRuShO*04Vpe[^_U40S ùOuQju u]UhOju uUj&=Yt0j=$hS:u @ 5< ZPC jh UWVShEtHu=h"OE PEP u$E 0h/O5蔆 EE ЌhGO004Dž. ZYu(=Džu5hN hBjjh {q;t =uT=Gh`S^_uShNO5虅 E ڋ 555St9PV ZYu04 Vh > _X19ju =(u4Pס0 ǹOuQSVhOb=04u@=t7sOxN(((j5u rje[^_UWVSQ}u t 6hxOh?v* DžXZu%vhO5 e[^_Ë40 JOEOu(E;t^ujVj?Sm[jh:jjW~ulj}e[^_ U}5uU}VSu$E 0h_M5A t)@5OtRhO5 5hOā [^=uFjr=Yt5hO5辂 5hP} XZj4^5|8uPP5̖$hP5k 5$5,$h@P5? $hh@h@hhpP5 5$5($5{$5|m$hP5Ё 05L$5>$hP5衁 5D $hP5胁 5$5$hQ5W ,=th`hh9Q51 5hSQ Y[=thhhaQ5 5hyQ XZ5X_$55̵K$hQ5讀 555!$hQ5脀 (5t55$hQ5W 5L5h8R5; $5($hcR5 =pzRuP5x$hR5 5g$hR5 (=h~A5hR1~ [;5hX}%ShuG5F  ;5h|hRhRhR5c e[^UEWVSu] }u 1>Ru6h5syO ZYu2hs^O ZYu3h S5~ $t6\$Wh!S5~ e[^_Uh)Shu uGUh3Shu u(Uh@Sh0u uUES] u1=̵̵{t 3hOSGh5slN YZtPhsYN YZu ̵;ssZshsS5} |̵5̵/$hS5} =̵t5hS5p} 5h%]1| [X̵t X]UhSh|u uUhSh(u uUhShXu u=Xt ̵UhSh(u uaUES] t~!3hT5|  1=̖̖u>h5sL ZYu ̖[hsL ZYu̖<usXhsh ]X | ]̖ =̖t,|t8u5h-Tz Y[̖75|8uPP5̖$hP5x{ ̖]UhdThu uUhmThDu uUES] t~ 3hTUujh5sYK YZu е\hs:K YZu е=sTZy+shT5z d1=ее=еt5е5е$hT5Pz 1=е]UEt!Hu:hTE PEP u!E 0hT5y dE ph:UqlZYu9=uA=|t5hUx YXE ph9U3lYZuMUSEU u @Bt2hAU5Ky vriÅXtgSm@Yu Sh^U)2 B =`t$h`heU5y 5h~Uw XZ]]7b]UEt!Hu:h9NE PEP| u!E 0hU5x !E phUkZYu USQEtHu=h"OE PEP u$E 0hU5"x E hBjЌojEh;u ~=tuE ڋteShU0j[Zu =u@=t7UxN(((jju Xuj]UEtAHuhUE PEP t%}hUE PEP t}~!E 0hU5v 8E phV(iZYu!E phViZYu UWVSE EEEEE;puHyuEUhu_P YZu+=|EuE E#Ve[^_t t]}EPVu%UhUVP諱 [ZE[VtE`V~ E@E~Uz E Et:~5}u}t U2heV E0h~V5Wu }tNhV训Yt8uV1ӍCP&|SVǍ@Pg EPhHyWذ ^Zt??|t:UЌW[t¸VEu 1jjhuWu$}tt}e[^_]e[^_UVSEt;Hh"OE PEP t}0h.NE PEP uE 0hV5t VUE LDhHyQMMЌϯ ^Zt5E8|t-PE[t¸VuE hV0腯 ZYhBjEjEhot}=tajjPE 4}u`Vu[VP諐=u@=t7E xN((E(F=t EH9^uj-M[9M^t u[Ye[^UWVS}u$E 0hV5er Rjjɽ~'ÅXZSCy X~jj螽hW uWj/S Y^u@hPPE =еtJ5Sp X=$Zu$BHBy Rj 衉  5j i Y^O~j58hWPSb! jPST! Sh\Z* j% ~P 9ZuVj覼^C_uhW* Y e[^_UWSPE1ۅt#Hh)WE PEP EvE 0h2W5p E ph[W4cZY}hcWU BE_E phnWbZY}5hvWo 5蝩 5jO]Sp u?5hWn [=$_u f` 5/Ys1D)E X EE p hWNb_Zt5hWpn +u}uE p hWbY[e[_U}E t0h_M5@o N=u#=uE EWm hhW5n  U}E t0h_M5n N=`u#=`uE E~Ulm h`hW5n  UEt!Hu:hXE PEP" u!E 0hX54n _E ph[X`YZu9=u<=|t5h0Xl XZE phZXp`ZYu UEt!Hu:hXE PEPu u!E 0hX5m _E phX`ZYu9=u<=|t5hbXl YXE phX_YZu UWVShuP} R 9}7hE4Vx G 9}hhV^ CōPh\9_^_Hu jX[e[^_UEtHu:hXE PEP5 u!E 0hX5Gl u uhXUEtHu:hXE PEP u!E 0hX5k u uhUEtAHuhE PEP t%}h9NE PEPd t}~!E 0hX5pk E pphX]UESU |u2hY5)k /H|u h!Y]Yrh,Y]XZ|]UUBSM |v1h:Y5j /J|u hOY2]YqhYY"]XZ|]UESU |u2h_M5Yj /H|u hfY\YrhkY\XZ|]U}E u"t0h_M5i =thsYn\XU}E u"t0h_M5i Ã=t jjvXZjp=Yt jjZXZjJ UUҋE t~0hxY5Fi u@ hYy YE EW[Uj =XujoX1=j nojh UWSWEtHu3h\E PEP~ uE 0hY5h E p\E@[u 5hY}u5hY*g qEx u 5hYjh.ZYuIh`j蜳jnM y t4=u+5hOf jnSj_vhMh4\Y_~&1)QPh~ ME PPEHPQXZ1=j mSjݲe[_UhYhu uUhYhu uUVS]ۋu t~6hZ5f ju&5h2Ze ?jv@h| u `jvh`{ e[^UESu)5h?Z'e t$hJZE PEP t}~!E 0hQZ5f wj 58 [=ZtC; tj S8 ZYh58hz C; thShz ]UES] u1=,,t!3hkZ5>e h5s~5 YZu ,hs_5 YZu,'hs65 YZu,5?$5,1$h@P5d ,]U=|帊Zu1Phxu upUhZhu uUhZhu uUWVS u] }t~ 3.}t 3hZ3hZ5c uhsEE3 Y_Et8hJOs3 _ZEthNs3 ZY{E~sE_y ZEus Y6jj蓮jj舮EtP}uE죈=}t =|t-555Q$hQ5b EtP}uE죄=t}t =|t-5t55$hQ5^b VjϭSjǭ1e[^_Uju uU}E u0h_M5 b Wh-[TZu2=u;=|t5h2[` YXh][UTZuoUSPE] t~!3hb[5a =u5hN-` uEj EPs5Vу ɉxE8tsh}[5a 0 440 u5h[_ Y[RPh[5` ]U}S|u!E 0h_M5` h[|S|]UESt;=hu5h[Hh\E PEP t}~E 0h%\5 ` =(t5h;\^ Y[j E pkhPFu h uDH5hw\K CAh2kܖ@kto=$u# AHAyQ蠣 @5M Zƒd u" hk;X{VC뉃=$u# AHAyQ1 @5ޠ Yƒ tB@BtC=$u% AHAyQ B: 5藠 Z x5h\A] ]UEVSt!Hu:h9NE PEP u!E 0hU5^ OjE p։ÃXZutVSE ph\5]  |w1e[^UQEt!Hu:h9NE PEPg u!E 0hU5y] PjE pEY@Zt-EPE $[S $E ph\5.] 1}UEU u2h\5\ Hu E\vOBE E\cOUShj] SuLtssh\5\ ]UWVSWEt!Hu0h.NE PEP; uE 0h(]5M\ E phE^u ~hV葔[t8uV1ˋ}Ӎ<WWVPEq WhS}q WuSsq (SSEuEe[^_UWVSEt!Hu=h9NE PEPN u$E 0hU5`[ hV趓EZt8uEV1}ӍCP*|Suƍ@Pip jj0hOEE pV|hO̵U|04̵>xE(4VU̵0|Ce[^_U}VSu t!6h>]5aZ hN]6* [Zt(hU]6* ZYth\]6w* ZYuvYtu6hd]5Y tttL5L5h8R5Y e[^UEVSu t ttG6h]U=CuP3j h]5DY ;v%ÅXuvh]5Y JCtPoBCXvoC=|YtP3h]5X e[^U}VSu t 6h]v菇ÅXuvh]5X 1CtPACX3h]5[X e[^US}E |u0h_M5%X ;=tuE E]]V |h ^zJ|]USUBM |v1heV5W P=|uE E%^]VV J|u hR^JYqhW^IXZ|]USMAU |v2h_^5$W Z=tuE E|^]U |urh^qIXZrrh^]I |]ÐUE E EE釒 UWVS1ہ,lj؉IMIɉIuX}:؉׉IQRhSS5T<@DMEэYDž9sf 1I9s(48u B19s;vA+SPhSS5T;@D@]=$u$BHBy Rj l  5j XZhsjUr2{ u]e[^_UWVSƉUE1IME=t?E1I9MwuSV& u Su_XEU:uU<^uh5T:@Y[uju e[^_UWVSuSAË@+=YW@P3hi C+bdb}=d 9bDžxu:9=bu2uWPh ^% u Džx#;@sGP4h ^eh d=ƀ ^0跂Z p 1эY9v2~.Tv Rxx _ D4%t9غDR`(Lti CtMN{O|ndct!lt1oTr x ^Ekj/h ^ Y[u ^ƅ.ƅ2= ^uƅ/ƅ-^Ph ^Pf F~u2WÅZhSWf S:XP pp_`t1Ilp蕐 [t]h6xW܌ ZYthWˌ ZYtC9lwlWV`# uW+$t_Xpƒ [tx<YhPSe hheHSe ht0Se PS _ZxCff%=@uƅ/P5T6@Y[ujt XZDLh1 ^Id=tE1I9dw&dSh ^" uSh_X>hx ^<[uh5T5@ZYujh ^_=t5h_M jj/h ^Dž}Džn Y[XuƅDžX ^7X ^vK;/t^Sh ^Pc X=u$=bthcP _Zbt jP [^FbDž|C=t:;u )j/S ZYt@P9$5b^_|PjP+ u|tPh5|M hPhcb z\DžTb1;PsyT1XЉIP߉I9Pw/XIQSXv uS\Y[TbT\xX$\K XZ Ph`j e[^_ÐUWVSEDžDžu} uH%h\E PEP u E 0h `\Dž 5h9 }+j SE p~ t 9 |ڋ ;hu%E ph=`5K hh$P` k ;Cҁv R,q ^ D4%@uѾ $t\CS=wY15u Kk |CЁw 5uދEK9|uȵ)PE tV ` E |AiuOC;EDž}<ȵ)PE 4V_ E <1эt1 F<; }0zYu 5hY+u 5hYx t*=u!5hOH XZ=|tN5hH Y=$_u$BHBy Rj a  5j S XZR5@VY=_tG~tA=$u)BHBy;B| Rja 5j XZh$Ph\^ {@EE k 9t C9ct;E,e[^_ÐUWVSQE1Eэqߊ< t < t< t< uGVRW 1҅u4t< t< t< t< u< t < t< t< uGE8ڍe[^_UWVS8EEE%P҈Uҁ6H=<4ӋUEUu.=v PSm Z D4%tFFɉ0E=w 5uUvRm _D33UE EE@EU:Ee[^_UWVSEUt.t*}t$} t}t}t}t }t} u hT`j EUEUE EUE Ufjh{`uE u"EUEEfP6jh`uX u(EUEEfUjh`u uEUEuuh`d U tP.E XUtP.E_UtP.E^UtP.E[U tP.E Y3U1:%j/R _Zu ub/+]CSSuP2Z E8uFV4U $@W [^tbE8u \U C:Pj:E 0a t@PָUYU 8Ut*?[uij]_S ^Zt @t<:tuuWh`u)PÍGPW[ W輵uuuWh`E1ۀ~:u^j:W ZYtCUۉ:t1jST^_uuuSh`a Uf]}tuU[E 8uheHַU Y=еtpU u!:UPffuRUu!:PUu!:PUu!:PU u!:Pha5B 1e[^_USpjɍjdhBa]SX P=$Su @ 5 ZP jh UWVSLjh`PDžDžDžDžDžDžDžl 1 PPPPPPPd@tt8tt8u VhXa8j;PD Y[hiaP YZu DžFhqaS YZt5hyaS _Zuha ^VSha vVDžtj@P t)CP\;[j: ZYt@PXH8?t6>t1j/V, 9[_uu xeHt{1u t=еt{u!:Pu!:Pu!:Pu!:Pu!:Pu!:Pu!:Pha5? $=DžDžtQuHt >thbV ZYt Džt ?thbW Y[t Dž=t jjXZ EԋE؋Et EEEPR``Y`[t!Hu3N uh"b` t tEPj莩EPj9hFbj XZ1ۃuj/V Y[tC=еt+ۉu!:Pu!:Phjb5= t>taEPjEjuEwX=Zu0>V=F5hbN< ^_/ۉ-t?uDž t3hVSR hheHSR hWSR ߃$EJO}Eu t<=H((t EGOEsOEPj(R=,uj/We Y[t@,=,,=HEEEt Pj/PjXZdљu DžtP%Dž_tP}%Dž^tPb%Dž[tPG%DžYe[^_UWVS DžPPPDžDžPDžHDžLDžDžDžDžxDž|DžDžDžDžDžDžDžtDžDžDžDžPPPPd@/u0t&8t!hcP ^_thct8u,Cu =,uhc~t,[uj/t ZYt@PtA_t 8uhc4=еthd5v9 =H04DžTDžXDž\Dž`DždDžhDžtKhHyt [^t5:|t*XPRr ZYu04Eh?t-d8 ^L_uth4dX=$Pu LA Li [P{ ZYu#x40 tGjR=$Pu LG L _PU ythJd a=|thfd57 40у tRPhqd5t7 5j 6 [^uu.uh^DžHuh^oYd>h^Dž[oZ8PH1эq_{8tvj:Pk Y[t0j PBPY ‹ 8uA9u61эQ9rR)SP hPn _ZdtPpDž^u&ug PPPPPPPd@-w/t%8t t#8theHP=q Y[t hd.Zt~j% ^_tkhd Y[tPaDžZtPFDžXoP'DžEtPDžXtPDžXtPDžX质XtPDžX1}ԹxE؍PEPjEEEo tP5$h\_BtDžӅSojjjhVss thhWVH =|t;tVhd5:3 SffBs jsZ y hd _CssP[ y2Ph e P } Dž [yh$ehOPxs [=|L^th8e5]2 1Geth=|t)WhKe5$2 PfhWeL2 =iLhieRh|eL1 j: tF!PiZYtj%S ZYtSheL}1 SheL\1 ffPtPheL81 Lhe/ Lhe/ Lhe/ 40у tM5W/ 5450heL0 5450he50 PF(=tLhe_/ Y[h fw ZtPhfLi0 hRhRh(fLJ0 } t9=|tWh  ȉיut 5hvpʍ\PXPEPEPEPURhph h-pS> ZY  ȉיut5hpHt\PXPTPEPEPEPURPPLPhphd, LPT1UE E E fXf\\PXSTPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPURPPLPhphc\t5hqLPT11DBvfXfS hoS< [_   ȉיDžXut5hoKP\PJPIPHPh9qh^uH:Iu:Ju:Kt5hDqjhhC \f=%hRqiPh5P r xjh`hC =(t fPtPI YjjP £PyhE =(u2j`PjhR @uhkqhxq XZmPh5Py yh5t;j`Pjh5P3 @u=еthohn蝷 _X1DžD󫍅DPh5PS` @uhn[ [jD5PpZYy hq- _=(*ƒt=x=pjhdPA G eu Dž|j j VhSdPdR uVVSWhq=A=еpt5hp Y[t tIPPPPPPhqyǃPPj'P&P%P$P#P"P!P PPPPPPPPPjjhqǃX=u=(u(]1t (=uBj`Pjj5PDž`4 @u=еthqhn螴 XZ1)5PE P_t (e[^_UWVSH=,jj5P~l rPj5P_l @Wj]ġPSEfEȍ XȵUY~B jZu=(ujp^jhe[^US hOuEE/ ZYEOu=nNusNE4u=Ėt =u9lt jS]YXh(p+Zt5hrS 0j=Xu&5hr- j9lt jSJ][XhhrZYuljh wY[h ju>EXZ40 tRPhrm uuuh U Htuj+>j} tU :-tRhs5 }tuh s5 =tuu ui 49lt jPY[^jDž`Dž\DžXDžTh.sZYt=Ȗ~ j`Xhfj:h@jy:hHyu \* u hX ] ;|uLjj 3:] h?CSXhuSh\:XDž`o h?u  ^h_uu hOR bE=$Dž` Pu hB h5 [P1 ZYxE%=t%u h%s5  EċUȣ jhq^_ 40 hsNua) Y[thiNuN) _Zlt |_wWj5450h 5j54=$50u hC h ^Po7 ƒyu hO Y[ 5450hrV  DžTO}tuuh * uh\_ZHM Td^h9v&ltP[Ph7`lYj7jj 7Xl M=jEP~ 6 ljXDžlZ~ s19סh|9vQ=$5lu hB h胠 [P5 p $)׋lp=$Su dB d- YP^5 l~)pÃpl=̵=Xt =$EU9Ӌ |e9r_=$u)BHBy;B| #Rj#` 5j#1u XZËEUډEU5# Xzj|P| U+U|+E^҉tx_yHt@Bxt@B+xP@ [4 5h=$Džl5lu hA h訞 YP3 p $lp=$Su dB dV ZP3 l~)pÃpl=̵.=Xt =$EU9Ӌ |e9r_=$u)BHBy;B| #Rj# 5j#Zs _XËEUډEU5! ^=̵=Xt = $ɋ  9G|9sA=$u)BHBy;B| #Rj# 5j#r Y[=$u$BHBy Rj  5j Xr XZpyu hOl _Xl@p -i=$u)BHBy;B| #Rj# 5j#q [^5] ËEUډEYU=̵t6=Xt =y$$EU9Ӌ |`9X=$u dA @d Z=$u4dCHCy;C|d dj 1 dj q _X $=$uBdBHpBy;B|p tdpRQ dpp [^ $=$u/hCHCyS) !h@ph{' Ypp=̵=Xt =$EU9Ӌ G|9sA=$u)BHBy;B| #Rj# 5j#o XZ=$u$BHBy Rj  5j uo _X=$u hC @h ^tu hOm Y[=$u d@ @dÙ Zt)/ 8 t hd [^ËEUډEU5 Y=̵=Xt = $ɋ  9G|9sA=$u)BHBy;B| #Rj# 5j#xc XZ=$u$BHBy Rj t  5j 5h[5h zhy5^ hPz+^ [^5v e[^_ÐUS]Ct&Ёv R Z D4%@uhzSct ZYu xujhR^S8u u |UhzS&t ZYu 8h S t ZYu hzSs ZYu ]UWV=еS5|u |h[YtWj h$6 1[Zuj h6 ZYt {.uK;hhz5 tjhzhxu uVt  Ėj hgh@4 tbh@hL5 Ht  Ėt*j hzht u5hz [_1t@~h ^$%衔Yu)0 $5|$e[^_á$UtP1 X=\$Ėu \ PptPX= u hUj=Yt0j=$hS:u @ 5rU ZP jh@t$US j.=Ytr$t6=$ju@P U ZP蝒5$ $ Px jPt5P P j7=YtI$t6=$ju@PT ZP5$ $ j ӥ ]UWVS1Ӎ{v5h{Н jc uh{5ߞ 5)PVƇ n u)=$u f` 5Xj_1э|~ uƇQ@EM; U e[^_U=еVS5|u |h{袐Zuwj h0 ZYtc8t^x"uX1Ʉt#<"uz"uBBAtv݃=еƁt!hh{5蔝 |5e[^UWVS=]}t =u;=u- PF X =u7=uBB=h5V /thheHV9 hh{V& V yVh |nU YP |X XЃ} 5̵|̵Xt1=P蝢X;t"jjP3Ph[Vqa֡dљt t} t1=P7Xh?S X|5̵茛 S =u u5h0| ^_9X|15hh؛ u56 1j h- Y[te[^_UWVSSS|=е} Eu |=u5h|m uh|ZYuij h`- Y_j U@RPQËE Ёv R Z D4%@u=u=u tW=еuN5h誘 Y=$_u$BHBy Rj 誱  5j r$ XZE|e[^_UWVST|=еu EUEu |=xu 5h| uh|谋ZY^j S+ Y_tj.h+ _Zt1uTjh|h`k uB9E H9]AB߃=t uHy9tvmu9.tlE H9so]AB݃=Hyt 9t?E H9sB]ABE H9s.E%E H9sM %B9s BEEhM[^_UWVS1؍}Թ$EPEPh uVEEE u u~ Y=еtVShA~5̍ 1e[^_UVS]u SXu ]e[^UUWVS(uVjjV ePjV @L=ȵufE~jEP ȵEXZuu V@[ à C 8$=ȵ~JjEP U+UE+EY҉EԉU[y HEԍ@BE؋EغәiMy1PjEPfE u H 8tu 8 <SCtgEt:EPEPhhVE @t7}t Ủ WjVG 1҃ Je[^_US]S0uYu Sh\~jvC ]U u h~jYC US] Su @ZYu Sh~j5C ]UEu h~jC P[ Zu h~jC UWVSQ}W] j EPV` U:t69u2h5W YZut-SWhD f@A=wՀ:uЉVFte[^_UWS0=]uS2T1}ȹ }WjhS~Ku}uShNND W<1E0W<؍e[_UWVSp=еuEEEEEt9u!:PEu!:PE u!:Ph<5 =\th^E wEEY} uE}uEEPEPE PVE} ptPVhf5o Vhu5Y 5jO]SE uB5hW X=$Zu f` 5HX1щщMD)}Eu pE 4] ,=̖tOы} 1ˉӍ<WWu P Wh-S! WVS E] (u h[Wz^_uj}uhE(EYuhnWzÃXZu9}EuhYES(E_E8t3PhWzY^u}uYEtRPhWaz_Zt@hA ^hhh 臺05@%;Wu E= [uC15h9}Wh.# ZYtC9|E t }tPtp_Et }tP`p^Et }tPLp[Ee[^_UESt9=t 5h-HhE PEPx MAv$E 0h5胆 B̖t~E Pt|t8u hj> RPRE p,z[Z=̖t"=|t5|h5 j hh@3 j h7h@4l j hAh $j h h ՚ j h`h躚 =`<tjjE p ]ÐUs-USS}] t3h{ C7:tuShč5jĴ h=螎YEP.EZu1]UWVSSS=!E u/Vh蘩 hߠT E$ EFӁv R Y D4%@uׄE0E}t;EuYES\u FuDL"u E"7'u E')Ӂv R蛩 Z D4%@u GFutF+Ee[^_UŠ<^uR?tЃUSøՍtvtlv800B0\*vC@^[U=@S@tCtP3h؍[y ;1]U$jh 1UWVShhuVUE!~1[ZuhhHV~ZYuhx h8 hx E=tD1;эqEA~hx EX3h|x u^_;j jhVd~P~t uVh49t ߁H0< wk B|Њ:tuVhf5H &v uVh=uh6 1 jWUe[^_UUmUZUGUá@U~%5jhPMiy h܎=YU=`thh!06 XUEhx>¨tt ¨uu 1=Hu%t thQ#h5 jU)uu h5 Yhޏ5 j6fXZUEhu 1Huthh125 j2U"u hS5 Yh|5 jeXZUEhu 1Huthhʐ4 jT"u h4 Yh4 jReXZU=@S@t.Ct8tP3hC5u j AX;j 1hThhHh؍u 1]UVSƻ@=@t=Ct.8t!PmutP3h|t j X;e[^UWVSP}E25h| VhƑVh5} 1E tvE 0jh@VE GzPzutS t21:Ct!PC 8&u+Rh!Ss {t jS!EXO녋Ee[^_UjhPyU=Et't 8tsPh1%t 8tLZPhZ^s XZUEWVS} V}uxhhHwGxZYuhhw4x[^tR=ts3h؍r ;j hThhHh؍r Gjh@wx u wh|PxYs tp}twh5蜷 YZu'wh職 _Zu h]1 hCt!PC 8&u+Rh!S r {jSY}thޒP8xZtwh 5{ 1l{twSs 3h9q Bwhζ Y^t GU‹C C bP3hJdq Ce[^_UWV}S} 5haTy hhHw6v^Zuhhw#vY[tl=ts3h؍p ;j 1hThhHh؍p VhVhʓ5y 1m}7udjh@Vwv tPvZuC t.Ct!PC 8&u+Rh!S#p {tWjSYOPevZR{tjSs 3ho !C C P3hJo M)e[^_Ujj"6jj5jj5U=t jjp5YXjj"5jj\5U=t jj4 jj"]6XZjj4UQuh 2. h:(. 1'ҋ`t !jEjEP9UEUE1UShM- X= t.Ct8tP3h؍n j X;1]UVS}u thYjh vNt u vhPtYtvh˔5_w <{ t!=uh- h:- XZKtCEe[^e[1^UWV}S@=@t;F t,~t&8thhm XvhjPqm [_>j xY='t28 t-{uC "P3h s 3hm ;;}U )jh@ËE 4rS6su V)sZt U 4huuE 4h.l 1t3F t,~t&8thhxl XvhjPjl ^Xt8t28 t-{uC 9P3h s 3h/l Gae[^_UVS@]u ~FPPhGk ~F hk 5j2]Su ؃t5O e[^U1=h* =&u+PhٕSk 5 US\EPEP)ZYjj1ۅ EPEP)t"=tuE9EuE9EtN%jc\]USg\EPEP~)ZYEmttth}XhW ÅXuWj/Sv ZYu@}~jhhWPS# jPSt# h ;}j j EPEP( t$=t}uE9EuE9EtM]U=t>j5@eh( 5@(}uh"E p诮 ZYt jh iUjj.U=St.Ct8tP3h؍i j 'X;Ћ]U}VSu t5h+q @jhvn u vhbPoZtvh5q 1s S3e[^U=@S@t.Ct8tP3h؍[h j gY;Ћ]UW}VSu 5hDp jh@vn u vhPLnZtvh+5+q CC 9t=3{ tHPs G9C ]|Rhc5p 1v vSe[^_UVSƋtVs蚬 YZu1e[^UEt@UEt@UVuSt@tPYXC t0PYX'j}YáCYtXV:CCV@ Cu @ C e[^UWVS=0?t0j=7 ZYt@P7C@=[^˸@ 8:tjhPB uzj:s O ZYhP 1E΋эL1QgXPhV s ]Xs u(tp h_h% h0hė&e[^_USEt8PtPCtPWXC tPWX]]W]UVS]uSh̗fuSh5n e[^8ve9XEe[^I7USt&s sC*Ph)wd ֋]U}U t+@(ttxt9Pt1UE1҅tP U=S5hnc [}X~h6E p ZYTtHh>" ]ucPhfc ]ucPhw{c .8=tuhhz" =Xt hјf" X]uPhc YXt)]ucPhb XZ h" XPh$b 5} ]USXӃt 1Ƀuj.hPP| ȋ]U1ɁU ЋpAu퍅pPAPUUjh6hhp\Ujh"h^hVjfUWVSSS}EE h?1;ujh@E 4g PhYC ;E|-33{ tHPs hm5j {{FSUpt=u}thp hf Xh 9Z}PhK hA h&7 h]ŋE 4hz U 4h` _11;ujh@E 4f u5hښh aYX{t.G1{ ~U DP1{ ~U DPSEXs Z?$jh AS$jh +shhSFL1;}e[^_USjh P f u jh`Se]UWVSQEEu }sQ}u>=$u$BHBy Rj  &5j XZjj{jj{=u5h X_ [Xt_~F< t O~FB1t.J: u(t =h% Y=t5h ^ XZ5hhh uO=$u @ 5[u$=$u @ @5E Yty7r=ti t[CPdZthuh${ t=uhE [h 5SZY}u(=u jh Ee[^_\Oe[^_UWVS]u:h5 Y= tiGtP7jh]] ?K~CE E 0ZPcZtVhb uVh~D] _Xwd ^븍e[^1_UWVS=}] Dž8Dž$Dž DžDžDžDžDž t5hJjhopenf \ 15пѸ)PЉсQTf =3Ohh3a YZhhH3+aYZh#35 YZuOqh3 YZuOmh&3 YZuOt:* u  uOVha[ NP  tՃ1}Թ󫍽@WuVjEE` uWVjE@ ÃtXS$h5d  K迮 03 $h5c @ \g^_5@jh S t 谊 ^ t 蛊 [e[^1_U>? Uh0hCh\h5h5W j萇 UWVS<] uEE j/3GZYt@jhǝ5) 1 HxctKd084DEF-SLN Xa1n9fRd+e1kJlNusrUsUx]yawm^K ?0jEP5Dk U :u;Dt=v.h̝5Dh5h5U @5DMD5hq5h1d5hcW=DZ5D=XL~CDE9-5h 5hÞ5T hSVv p=u1=p)ƍ~UȅEĉUth#z$ EȍEЉE}X}th&]$ UEUXUNU~ CUEh _t%jwO^h f[jjj EċU)PPFHZYe[^_Uhh@h  Huhh@h HtjR USĀ| Hu@уӰh ||PjjBR6 u ѝ 8tyh\gX @|]Uh !UVSh YÉY~.h ZujSjj5 5@jT ÃyG4 87t;* 8#t1:5\5@h jh`1ۃ=ttAS5 j>v; t,Sh Y9Xuh Zt(1e[^ÐU1W}SU ]EPPډXP [_UMQB;As+QBAUU9BUE@UUBE ;B r+BB @ BUU ҋMtEAt+yA9}A;Q r+Q @;Q Au ;ArAAUS] S9u C9CrC )yC[US] S9r u C9CrC )yC[US]St9uK9u C9CvC))‰yC[US]Ct9uK9ruC9CwsC )yC[UWVuSt>uJ9Zlj| u9XSu Epݓ Suz] )e[^_ÐU=$u @ 5 Y=$Lu @ 5 ZH: Uu u5L貙 Uu u5H谙 UUUx9u :'y9u=t'v'op9ut_(Oz9u*(=9u1%+Xu&u9ui%s9u %1U=$jhtu @ 5x ZP聘 Uh j` j,h h`' UEwi$Lx]yVpOsHuA|:}3q,%ztv~ 1Ujh0hp薑 US4]؀9LX Py4Zv;EP5Hv YXEPj5H{  P@4w։j,h`LEP E؋Mt=`E؉MtM E؉Mu e%=T} ME~EEu$E EEtEE؁eEEuEMtMЋEt@Eu EEt E̋MЋUtU(% ‰UԃCMEtlhj^hj^hj^hBj^M X-Ec U}  Em U} E EI"#h Z~$jhh 2jh!j>,E U}  Eӟ U} UMu{`9tlugЃɣ`uh Z~$jhh jhj>E, hs YE&US]h  Y~Etj hh Bjhj hh (jhj>+]E ] U)t Ht8Rh?4 UUtGU"dUWVSV}u UdEBM=wl dBãdu BdddB}du BdddB}du Bd[[^_ËdBU=Sw}dPd@d@Ád~Ph 9Z~6d-Phh d-Phj>!* haO X]US1=Ts&PyPPt 8 t  Ӊ[UWVSE E}M}҉U_~jjRkE ӉEUGֈEU:uUA9u_A 9uEU舂GARY u؃9ƉEGȀAWE舐u}tYAPAPu mtEe[^_4#e[^_US6TsJC t>;uCCCtPCP-iP j"]UtiU=Ts@@ @ jYtjZtj Yt%%jg8Zt4=b4=j8DYt@I@Ij PZtLUBLUj \YtXaXaj hZtdmdmj |tYtpypyj MZt||jYtjZtjYtjZtjbYtj3Zt b =u8jYUSFTsICt=8t7uCC CPCP-iP# j]ËdUB;VS+5}^u~\dPd@h ds9Z~'S5h 'VPj># ha ^t%Ptd[e[^áUthPOXZh Yu*h dPddBdBdBdB'dBdBdUBdt@USh]Sp ZYtWhSp ZYtFhėSp ZYt5hSp ZYt$hSp ZYthSp Y1҅[uЋ]UWVSQQ=]t;uOjjXZSXjj_Xujj[^SYjjÅXZuVSE1эt } d_Mt}ыELHL19 MD19vu)WR;ZYu-h d+d)щ dSGd^EtMdCt7dB;wP~ =udd뺋]t#dB;wdE떍e[^_UWVSWWE }EE1?u~}ujV;]}Rt&u}t u^tu CtFC;]|}t u[Ee[^_e[^_UWVS+Phj<Bƒ $v;dB:S=t=tP_htw^0pPjSM dI(vDžd S[@Dž\@<:t\8|uG\\uލ P TTYWT@΃1DžX@Dž\@cc|t c:\B\+X)dt)PXd{ uXTM1XыTPZ9sPX3. t݋Xc:\c<|u\\|c勍\X1c t cyOcv S3U Z D4%t%v S [ 4\\\ ɈcwTx@u21@u T9sB@VT9u:dt dT9s BT:tT51I(wSY 8u B1h ~9Z}>hhSjjhhh]SsF $WSh Fjh$)";B:lPhPhhhljj hhhMQE }10h s9_VEPh CPE_j;Y@t2 t8@t t1T"T j9 Bt(tgtTt+|t/)PR)PR6)PR@)PR)PRj)PR ? 9+t )QSw`;B:h蛽^t1ۉI+vjj#Y[hhRjj#hhhtj2RB x(h s9Z})VtPh eCPvPj>  hc9 Xe[^_U1=t'jh*j US]t jj*YXt jjBXZ]U$jh |$jh h$jh TjjhhU$jh $jh hhh=tBU$jh $jh hhhZU$jh {$jh ghhhU$jh :$jh !hhhUWVSuh-$ 1Xh u]EEEEEE)79؍}Z|SVh CPWj>e[^_U$jh o$jh [hhh =t=tjYU$jh $jh hhh=t,=tj^XU$jh $jh hhh3=t=tjXU$jh ($jh hhh=tR=tjXU$jh $jh hhhYU$jh z$jh fhhhUWVSEPEPY[MEuEE}EUuEU BuBEBuBE܈BuBBZh 5)9Z|SVh CPWj>e[^_UWVSQQ1EE%u>}tuhXEEZh5GDžXOFE$ u=u=Pl ~Hu,FOE=9=, u uFOE?=u=u jh(Y[=== !==jhXZs $N?0!hhhq! j =Bk==jhShhq rShhq SShhqh S<Shhq@  t,Btt B!}tzt #t |/'t^vjj[X%hгYtP4jjLXZjS cYX ijSDXZj0 jSYX6"u1jjXZ cjj[Xu !jYShhq  t(Btu Bu8t."u `t jSXZj/XjYu=tb=s =sShhX =s P=s =s hZ}tuhN^_1}u}te[^_UWVS,h EEZt4=u$u=tu tEhyhEY^t=uE1=luhZtf1=1҃}RSuPuVhETE1Eu>}tuh"^_EEh=[GẼډEu NE= t$9 e=ts.t p9ujhv z9u j h*jJ 9tU9t FOMɃ t u` T 9u$9~ )ރ}uV5YX~Sh#XZx9u )ߍGe[^_U1uf=ttt=t'u-=ht!9~t `U}tEUjÐUVSutEv S[= Y D4%tv S Z 4F봍e[^UEjPuu u*US]t;tP&Z XtHhHySR ZYt7hS ZYt Sh@; /Sh5 jhh@Z ]UWVSQQuE} EEuEPh5^ =tC~9s(P*t Ph£5 CԃE3 ~ 9sPhģ5 C E ;u Phe Pj $ XZ|6Ee[^_N US=\ME ] =u4w4QhɣSQhӣ5K =t*=t=t=tn RQhݣ5 /w54u5h XZ,Sh5 SPQh5 ;uPheX [XE]M E E ] ]US1ۊ/w P4wP4hPSh t//w 4w4hmSh+e/w 4w4h9>ShG6t4/w 4w4hUShc XZ/w P4wP4hqPSh t//w 4w4hmShe/w 4w4h>Shɤ6t4/w 4w4hפSh% YXC]UWVSDE=\}Eu!= U : }} 9g U Ph5 C 5h ^XM At/] K RQPh5 CuPh5 ] K RQPh5{ 9U Ph5S C 5hͥ Y[M AЁt0zYt)|t,B5hץ%5hݥ5h 5h XZ5h8] Cu=5h[ Y^9U Ph 5` C Phw5I  9rM Ph5! C 5h  XZG97U <w4@h Ph5 M D t!tEt!t)95h%5h5h( 5h2@ Y^U D ;uPM D@EuPU |NxPh,5 M DtPh5 U DPhS5 M |u|uC9U Ph5 C 5hѥ` XZ5hX M ANuReuRouRyuRuRhEP# }5 tEP ] C$tPh5 9U Ph5 C Phw5  9M Ph5s C 5h׋1 ^] XCЅtWu5hp Y[Rhv5% 9NU Ph5 C ڡHy ;uPhPh XZ9M s$H M 1RQ 5Pl XZ"M P&P5v  C9=$u)BHBy;B| "nRj"% 5j" _XS Ye[^_USĀ| Huhʴ[upLщӃjj ||PjBREO Kj+LщӃjj ||PjBRO hKYu]UjY:h"Zu5> 5= j UuL4 UWS]51IQjSG. u 4 UWVSPPuuU}FEE E ]Ev S) _ D4%tv S [ 4]v S) Y D4%t!v S Z 499M1>uE 8t+EE)e[^_UW}V1St4 .'1] ;t3WZYt|ۅuۉ]e[^_U1}ÐUVSPPu EE PÍEPh膲S e[^UVSRu ÍEPS5XS1~Ee[^ÐUE EtPXUVS] u~K~Ph; ZFYe[^ÐU UWVSP5MEt>u9Q@A49‹YHsD9uA9u9QtEFuu 5 @t}t @1ҍe[^_UVSuM FɋUX$t Iҋ tNHǃ u"PhV h]jǃ uPhV th]jd 59 Y?tDtTth]j h]j 59 Z%B 1e[^UES@@$P] G =ZtdžSdžndždždž?dždž\džUdždžFhtw[g EZuE8EPju4E tt4Sh5" jWuSh5 u F\F`[u 1ҋjEPEPjjuEFHFDEFPRS;>tjjC txtjpS e[1^UWVSSS}]t EEPhht@j, 11 @tu}} tltPtL  t k C;p89`Xt k C;x89}Etu]htw&T YtNu#hZyhjS@W ƅu#hYyhjSW DžufufPh!S Ztj jP ƃ hS [tj jP ǃ }tE0}tE8e[^1_U=$Mu1BHBy ;B| t RQ+ ZY 5Qk ÐUWVSj&uFTEHU ;E듍EPV+-ZYM;Uu0EPEPjRV2+E]9CXUM E;v_PV'1[_EdӋE1Fdu+FTu-jjjVs%u FTuEHU ;E럍EPEPjM 1V*t^t Ut;] CEEvdPEPjV诟EBU B;Cxv!PCxPstV聟lCtKtCxEMT] suuk su3VS-$E M9EPEPjRV)t^t Ut8EEEvaPEPjV輞E?E;Cxv!PCxPstV葞|CtCtECxE䁋TU BtPuuv MAU] EMK@RPQQ CU+BEHPu3V.,M yjEPjRV~(t^t Ut;EEvdPEPjV蝝EB;Cxv!PCxPstVoZCtCtECxE䁋TWuu^ EPEPjU2V'UG]BK96)ʍD:9vhjVCL uet^t Ut#EEPEPj;Cxv!PCxPstV莜yCtCtEK1ۅt^tU;StuHT;Cxv!PCxPstVA,CtKtMCxE䁋T&;Ev!PEPuVE]CUERM@PQ E+C| WuE 0V)unUM E;v[PVZ,ZYuRdӋE1Fdu+FTu-jjjV u FTuEHU ;E1}t/t"FtM;HtuT u蔾Xڍe[^_ÐUWVSE} ptW^0F09tMCu/;N09ϋCuF4GS9ʋuF0S7Xu P Y_jj ÅXZujjuI ;} t9hu j Y_t&u 萤 CZuSʽjjuI1V0F4C9V0u^0F4^4؍e[^_UVS]u tPxYu ǃV Zu jjSI e[^UWVu SuEpH1҅UZ BLCBPCfCfCC PD Zths juNs ȼC {XyBEPB0 9CuB4AB0K9{uB0tW耼XSyXUB Fxt-PP_t$}uhsjuwMVu*Vu=FX uNFLt PD Yth vLju,MFPt PC ZthvPjuMFHtP XFTtP XFLtP褻_FPtP薻[V菻1ҍe[^_UMQ1t*A @@t:} uh)jQ&G1USMQ1ҋ] t2BXt:uhbjQF] M]]UUSD]<t k Bx8t#4 jSRYZujjSB   8#t  1҃8#uЋ]UWVSL&EU@R }tru Y[Džu@DžEEuDt;Ut k Bx8tEEE‹t k Bx8t @t+EPub _ZuE+Eu;t2EPub [^u EFuwPju EEPueb ZYDžu^tKEuEBXtB<9EuB@9EuBD9EtEuPujSDžEjj% uYL ^U0(tk B@8DžDžDžDž jjua yo 8U0dSu^_jjjjjjS1ۀ8Nu @1IQdPuPt(hjuH> }tUZt UtM@D2DžDžvsPPjun&N@D2;CxvPCxPstu7CtCtCxTDž;t$<%u {%t%B DžP^ [^ u[%=th7) 9thR6thkjuFhRL^ *1dSP )uh dPw }U+ UYup ZuT}t$UBt;PtuT۳Xt  Xt; Xx _th\juDt3}t!UBt;Ptu T 7^Ehu\ f 8 Et{Pu$\ Y[u[ xQ軳9uDˀPud_Zu/hu\ t PSY^" h\ujuCNu,jSjjuKuhujubCEauPS ƅXZuh\uju.CS } uHSuDžDžE Y_Dž]jPPuu Vuu! t@EPuZ _ZtDP ^JXEBh+mGXG(EEEO(GUjRURwP u]H$Щ}tjCPu 螺 gX1jCPEPE} uVFd{jCPEPEK EȃPCPuVF\>jCPEPE EȃPCPuVu\E9FXF`FXjCPEPEƹ E܉EEjEEPEPV gXe[^_UWVSX{ Ɖwj C PsV%htqCCjC,PC@P; C(ECSEjEPEPsEE R@uh C(@C(C$1ҍe[^_UVSu^1CX{,t+C,{ wjC PsVLgtoCCju C@Pd C(ECSEjEPEPsEER@uhWF C(@C(C$1ҍe[^UMQBXu(z,ALuB,APB0ɺPB,APB01UWVSu^CX1Ҩ} ${,CXtC,}EUu3PRjWVt<t WVEEPRjWVE;C vPC PsVet|CCUCxuuCP߶ C(ECE܋ESEjEPEPsER@uh C(@C(C$1ҍe[^_UVSuFtjjPqvAVF9t RA[VF9t RAYTt5jt XZ^lt=s s{tPh5؞ tCBC뼍e[^UVS5]Py XZtShv5莞 t"J 0[n $hv5h 5j ĝ e[^UWVSEhDžpu ǀhT Uu ǂa EMAA ȃAApA|LA0A4Apǁ,0ǁ@ǁDhh1Džx| ^_thKE0g Y[u Dž>hU2F _ZthM11 [^u DžxDžEhu<+uR{ujUYtW-c$1Q1Z‰t1-@cCPBP _XW<-uSCu3j[un jhYf-s@ t<%MAȃB9A uQ MAPUBMAȃB9A uQ MAPUBPYtDžDž7xt *pt |t 3P '_Z0tqVhhW 1򮍅jPIDžDž ttbjjjj jjjj) (jjjjDjjjjH( t k B@8`B4Xt k B@8tB8u*{^ru'M9uwN[El dt k A@8@҉u Љltl%MZYCU:@ tRxU1Qg‹MXu jMAX@ pR _XEA(A$Ѐ ru `x P$ujPu[^u-~2P`…XYj@tfJ jjRC;UB|xt2dg_tP8^thPjRPj7 jjEPE܃t"Hu Et tMd[븋 t1tPЃP1Yu31+h h,hTM1ҋVu؍e[^_ÐUE @81US] S8t tBABR~X1]US@ӋH81҅tA9ru ʋ [UWVu `S}uf't@9t't5v R趬 _ D4%tFE>u7E 9}tUBt;xtu TWo^EE}uuo[u~uEXt Ut+1}EvZuEPjuLt;>U;SxvRCxPstuKtCtCxE{tTpEEHEu tE;}s@nu~ouVE\EZuVuY[E:]؁@k M}Eu!uU Bxu8?u U fM؋AMrU؊B t}t ht}u h }t h8qu_}t-k Etk UBx8u1[k Etk MAx8/E؃xtEPjuuURuVjSu贰VjSuaMAVjSQ}tjjjjSu}t hdbu}u}uEEԀHhU=5j EPRMQ<t\EPVuÍEPuuyrtPShj PShjuxkEЁv R Z D4%EPVuÍEPuuPShju ,}t(}tUBt;Xtu TS^_}"}tMAt;ptuTV][U؊B @t}u hu.k EU苀tk MA9P89E؃xtURuuuPuVuSu:gVuSuH_OUBVuSR2ujj}thVjuEu}u}uEMԀIE@ u\k Etk UBx8t4k Et k MA@8uP ZYE؃xtjuuuPu[juSuuFjuSu&^u1MAjuSQujujSutE E E {}t uu_XE̍e[^_UWVS@jjjj?uEE䉅VEEEEbjjjjVBm jjjjV"M`jjjj3V-dhAg YuLPhHhW 1jPIVM| tDžhx! Zu!PhRhSy ߃1򮍕jRIVM tDž b_tj h_S蜴 1jPIVM tDž ltDžkeytDžime=fDž61򮍕jRIVMr tDžvtDžmatcDžhtimDže=71򮍕jRIVM tDž`hhhS* ߃1򮍕jRIVM tDž tDžrepoDžrt=5ƅ1򮍕jRIVMr tDž.tj hS 1򮍕jRIVM% tDž&nhhJhS8 ߃1򮍕jRIVM tDž'!hhhS ߃1򮍕jRIVM tDž+tjhS 1򮍕jRIVM> tDž2hW _uWPhhS; ߃1򮍕jRIVM tDž4$ tjh S^ 1򮍕jRIVM tDž5tj hS 1򮍕jRIVMA tDž6+tjh+Sİ 1򮍕jRIVM tDž9=9tDžtabsDžtop=fDž81򮍕jRIVM tDž<hhChS ߃1򮍕jRIVMM tDž> t k F@8Hu DžhKhW* 1jPIVM tDž0FRV`Y[=Xw Dž2=w Dž t k F@8HhVhWm 1򮍕jRIVM tDžIX1ۃ=@Dž@Btt)tMjjjSVjjjSV(}t k F@8PjjSVTt k Fx8t5jt k F@8Pj SVYt i C 8'U :tMU @9t PS蠎 XZ1jPIVM u E 10E @hajVje[^_UE E EE UE E EEڤ UWVSSSEhu PRɬ 1E EE샸HL}ut k Fx8u"jjjWVjjjWV(jt k F@8Pj WVtjjjWVStk Fx<tGjtk F@<Pj WVBtjjuE GE NEe[^_UWVSPuE1HLt k Fx8tt k F@8PPXtk Fx<t%tk F@<PCPXE }NNe[^_ÐUE8ujjjjCu1UEMw jh1=vhhjQUWVS}]u jh=vhhjSd PjjjS7lupǃdt k CP8tkd C;P<;ht dt k Cx8jjjjISjmFdt k CP8tkd C;P<;htdt k C9p89v#HPjjjISHPjjjIS(1e[^_Uh3ju51Uuu1U1W}1thZju}US]S裫 1]UEU8t% 1US]@tPZtPX1]UE 1U1W}1thju'}UE8ujjjjuB1UVSU ut k B@8H9r!t k B@8Hu[1^USQ]UCRS`YZu0ҁ}wuuu Sr‰Ћ]USS]UCRS`ZYu"E-0=wuuu S(‰Ћ]USS]UCRS`ZYu0ҁ}vuuu S‰Ћ]ÐUWVS} Eu)UB E hjRӁv R& Z D4%t"Ӂv R2v _ 4‹EH@E tE 8Pt} u8tkXhu[^PhjuMU 9zuhEPuγZY}uGE 9t+wwujuEE?@\ˋUBrM EAtk}ЃEU@ȃ9t.wwuju虶XME?A\E ˋE@PU2u'18EPEPjRuU}tMYt Ut>EG@EEviPEPju1&EEEG@;Cxv#PCxPstu&CtCtE܋CxE䁋T}]t&U}rtVuSף ]u GtPwS軣 _ U1tM}A)ƋEM1t}ttUBPMAE 9uJtVuS[  +]Suuu:yEU9BXfB`BX[+]܋M I ]1ۃ}MtEXtU;StuRTMA;Cxv#PCxPstu$:CtCtE܋CxE䁋T0UB;Ev#PEPuuc$E܋Mq]]qS_ tUBVuPF +E܋MqPuuuubEU9BXtBXB`E ?9t%wwuju葳u+MEA\VSujupu E@\1}t%UBtM;HtuT uFXڍe[^_ÐUWVSuF H1҅F "t(NA9‹FuA BAV9‹uAV)H1YtfVZt u$F$tÃ;t 3RFXv$DFX~xt FxP}XtP#FXtPFX@t P4XtPE[t P YtPEZtPEXVVEe[^_UWVSEu hj}Uz ÅXZujjV:EG@GCCxC {C,CxC|uǃqtP+ _fy1tPS`" tPS," tutPS! tEtf<WDYu jjS ujjV gWRl SVt_Zu2 SV肓ZYuSVAD^_u E1 Se[^_UVSMYSC9t9uC9uMsK19tA9AuCBQ9suCCq9s uK CHK[^UEPu hPhUw<$xh!h4hhh hhjP w UWVSxLÉUu} w)EPSUZYq}u EtS0HE t.u}t#FU:F}tFMu%@u:EPPjjRS]E@E쉃B Se[^UWVS @}*P ZuShj芵(jj+l t k BX8ShhV育 hSo@@jjjnHthjǴ uCBTV BP^ujj艴 xLB pj/VY[uCPS hR苠h%Sh60hShXhzWhVhhhSK D=PS 9+Vh2h2hhh Ph,Vh=2hXP) $hdhhhS輰 L=v hjtx u+<~N F+S 9u4)lj놃t*t蹇 [t hj1>苲 u @Tt o Ye[^_UWVS$}wtFX@u1tIFj vPY[tfXhvLjW`E tNX E t VPE Džejj+W费 Ft k GX8ShNhPծ hS@GjhWh vLjjV @tG#1S5P7 x()uh P' th\jW0(х ZuP^t#P贬 蝅 YDž[GjjWh DžE tjjW>g t Dže[^_UVSQu^SXЃ1ɨ@CX⽃{PSXuw1j#Zu|EPVZYulFjhVhCj sPt#hsLjVFjjVh&FjjVh hsL\.KX@1h:jVne[^ÐUUWVSM ut9sZsÅu S>#_ SQd#ZYujju 1>)<81Ѝe[^_UVS uEPEPEPu u菌t 1}OEtF9sBM)مډMEt$< t< uMAEEHBEtAރ}Ѓ1e[^USj/]SZ…YtB]UVuSFP5"ÅXujju 1Vu S| 3؍e[^US]t uuu N Y 8tG 8"u ;t1҉Ћ]US]# uuu k[  8t# 8"u=t =t1҉Ћ]ÐUSSE]U Mtwt #tjjhqhjSt{u1jtPS[wV$h$EPSɉZYu8EtPhhjS覬 U 2hjS荬]UWVSӉEU EE聣xu CPhQ ^_t jjS950' $t3[./GD?@\-E UBRu趈ZYCCKE j EPRE쁋PtPjju$UUEBU+C)CSE {u hexjuBPuB~Ck8Kv BuIM M~tN;EuVJA҉VFF+EPuVu*F =u ]C($=u E@(=pu UB(CMЋA( ~`F pu ]uF`CL@FdCPFhEt k Ax8tfN| ]tF @ ut 0h@ ^ C u FEEFtزt(t pLNtZ8!uPAVFfN|V~t:^v R!K _ D4%tVJC҉VFċFV:+zH~F}FEt3E}PtESRr3uumZYu!FvVHFBEĉFRU)}v uOJ Y UD4%uM FHCFFMF)]ȉFt8t(uhÃ~V\Eu0Fv2z u,HFBEĉFRUUF } M FHCFF랁t E~v~=Ev PUI Z UD4%tVJGEFV봃~&}!t } F8 VJ@҉VF߁~t:^v RH _ D4%tVJC҉VFċ^v RH Y D4%u<|ujh^$Suf F(Za ^ UVtNCFBFt6F8\uNv @FAF9uJFHFFtȋVEtF8 tE^FEt3M}QtESRrLuuj_Zu:~v4FP Ut|u= UF @MENFM} t}|u NEFHCFF@^CV^)ӋF+]ĉF~ CVFuӅt ;\uCH򋆀ƒ:wJtV`t tc  F`t4EPurZYj }uFdUBLMALFd]CP(FlVpF`FdVh4~`%~`u} ExF`u FlFlPu1r[_ t~luFdFdFpFhV`tJty F`MQLuC t?EPQqZYJ }uFlFd]CLFlFdVlVdUBPFpFhFdVhF`FlVp ~`~ ujF`MAL@Fd@QL8t k AP8Fl]CPFpFhEPSpY_ Et ;CLv9FlvFlF F\X ;;!Vu)F8!@FfN|BFt8~v RD Z D4%tVJGVFċFEЃbl/321tUSWlNcf&sw|F^t1+t% #t(-tlt0pt=F\CN\>UfN|J("MfN|I(UfN|J(VJ@҉VFngF.t'+t'-tK=t'^t<fN| %fN|@fN|fN|;3fN|VJ@҉VFu~<+t <-t<^t<#uj1S[ ZY=w5FQGFEHfN|FVC=w 5u;+<+t<-rF<-ufN| <+ufN|j EPvEPpMu ;0_U+F)FV;auFlFdNdVpAVhFlNXfN|uvVu$hMQEPEPE  }'}EԅtPulZYEԉFT1~ PvvVu uvFNFEËFEt3E}PtESRr.uubY_uFvVHFBFB2}v u;@ Z UD4%XM FHCFFSE)SPVu~^=Ev P? _ UD4%tVJC҉VF뻃~FEËFEt3M}QtESRr,uuaZYuFvVHFBFBEFHFCFuE)SPVuuvVuC Z UD4%t FHF~uh/S[_tF phjuQF`tdFluuJMubu7YPuiZYu&F|EPui[_EFlFdu)u2]uujjv PPu6iZY2Eu @}F`t:upFlMQLt9tZu]؃PSLCPPRS3EPLFdt9t%uMȃPQLAPPRQ FFFFt2]CLEԋCPE؁EjPj'S܂OUtB,MytuQWu_fyH]{t5t,UTu u ~ ujuM|Y[F VuP_Zu.]CTujjjS`u.CTt"ETUuMtQ荈[]{tSV\tLKL}9w8hjS9sjPugZYu hF\UBLMyyLfF|yfF|tff|F|u4u,]t k Cx8t @ttREPPVu}Eg}t}UMD t<.] hju׃ +- ^t@Tv RV4 _ D4%u@|_t h! ~t;t-v R 4 ^ D4%C΋P֋EЁEv R3 Y D4%u}_uEESUҁv Rx3 Z D4%u}_uEE9Eu@CNljjGpG0p0jjux$u.hThjuVUBT1ҍe[^_UVSE @tuFTtjs3Vڼ1҅th3jVUe[^UWVSƃ~@UEUu jUB <MBIdMNLw MJu?Exdt6jlWdSjV-jWSV0UBRÉ׀: t GKt? 9uu?t)Hu :.uGtZO)PRujVEgaGt$GKu jhujVE?aۉu KtExUZt MɉNL#tujVUZYtjMA 0V[Ѓu hS:VhY[_jhVx PVOYhS:VDYVYE@}u$ t k Fx8t<4}t k Fx8t@RjWV}MuPG]9tssujVE_u׋݋UVLujV\ZYtFL1ҍe[^_UEU E\UEU EFUEU E0UW} VStGxj@P( ƅXZujju~ 1҅teu.1}IQuu 1҅^u1713txt p0u] tكe[^_UWVSVVE PxҋuuF(txu h jM  u>V(z1IQru V Ju V{4:EPVvq juV uOU Bt0uS3Y[t)M A|%ЃPjRu ֋F$F(0V1_X1ہ,F(pV1Y[t]@tfH M A|%$PjRVAutF(1ɍe[^_UWVSP]S(;S$u uh%jS{tABE}1IQrVS u ]e[^_1jF|%PSB@ uSC(pS0_Xt:F|%$PjRS@uk(0ɍe[^_UVS]{$u uhCjSzojF|%PS? uQC$C(0S0…XYt6F|%$PjRS?u 0ɍe[^UWVSuF$uhcjVyEEEÃ;E1}ыE;^(TuF8UH9ErhS:UE}tEhVR_XF(E9útR93LtRh,VRFTu'jjjVOu FTu8hS:VRe[^1_ÐUWVS EUEU0EE]E܃} U#: !t"%\ } E싀P҉E1I)M1}Mԉ]tUzt;wtuEE܁T;GxvPGxPwtuGtGxEwtT#U;UvREPVuuԋE؋UrSF E]ԁ UB @EI1}I)M1҉Mԉ]tF8E싀E1}I)M1}Mԉ]tUzt;wtuEE܁T;GxvPGxPwtuGtGxEwtT#U;UvREPVuuԋE؍uSE U]ԁ } vUB<%t<#t u{EԍT8EV$F}t$uuS7 ]ԃ}wÙ:/t/CGUPRS6 F$N]ԋD;BF$@U F$ JtBxuX2 _Eu% [];^$uhijug "hjF$+EPFU؍P 14]SEPUESX=`C1tz@Xtt$t k Cx8tjS(YZ1҅,?`Xt k Cx8tujhS\ƃ 1PVE0WS]ujG 0S螲@1du7lu1EPS@YZ}uGlGdfVE0EPGlPGdPWSUSLtCPCPPRSK ECPuu hS<XZ1ҍe[^_ÐUWVSUB@X] tC}uB @8/t hjRECxtHtELhwl_ DžXu@Pʹ_t@t8u"hjuwb/Ct8 Ws1҅^{xCt/xu.v.uy.uAujډ~=$u#KAHAyQ(- @> s* Z>p=$u#KAHAyQ, @  s* Y 21e[^UWVSu} {th WV t1e[^_UWVS}@u hW6#ssVhW6Fue[^1_UWVSSSuV ҋ]} uvS9ZYuwj5FEMjjEEv$REPPSEtwjSK-u ǃUCPSLCPPRS蠭1e[^_UWVSÃ1эq`=`tV7S豹 u ?1e[^_UWVSljtE:t@uVhW5Zp0hW{5s hWm58h W`5^`X=`ts3jhW;5;1e[^_UWVS E]01ыU IrxQSRuE Px9u=EF9tjSuU BtuVSsx _ZtSEE%=@uDh&ShhW&X VW7x Dž,&t.WjuZ j/S*Y^,t @,1эq7Qjz DžXZuj뭍G4Gw VSP) EGh1whh4PW 4P4Rw Y[dFPZG,jj4Pw xVw,P/ 9t-h\4Rju_S. ^ S. G,[01ɋW,:t::uB<BjAPq ZYG(tbhLw,蝱Y^tdhLjwZG,ujju Y jj [^‰G(tG,G,tgPYG,W,EZuB0BtBx0xGE1҅tjE4We[^_UWVSEE8h>U YE1}у}YtUzt Ut+1EvSSEPju蝨u;c;_xvSGxPwtuzCGtGxEwtTCPuVp& u8tPu u hJEP_Zu؃}tUBt;ptu TV[E耈8U Bt8X~*v R Y D4%@tKG҅tp~,v R Z D4%@uKGԀ?t0Gt&Ёv Rc Y D4%@uӉ$uhNjuV Wu uPe[^_UEU4UWVS Exluhmju3Vl9Dž`Džduj j _dZÃXX j,j Y`^xdA`Z9Y uQ dA`P`dAAU҉PPPӁv R Z D4%ūPPv R ^ D4%t8tF>uHhPjPPP+MQuWBnLJGLE܋GPjEEPj'W6:hj ÅXZtBC@tP臖C[ujjW;WV]iZYu1ҍe[^_UWVSu1th1tVO'YtfV!ZtC,tPLXCtP>XVlYtS'dže[^_U} >Eu E j1UWVSHLPjjjjj6TS։1IQVEPSF,SH5;e[^_UWVSExG|xu tBhjK ÅXZujju.:G|tG|XG|_|C}%h}tECuuu謋 CtLECu C71IQVus CtC 1ҍe[^_UWVS RuӉNju V Z1҅Yt{ t}tt9C t CBPuWtrt0hrh hjW8t.tGt;Ptu T Ye[^_UWVSjjuhU, uF@|xtVpX1h4 ÅXtjj1IQSh)h3 ÅXt&jj1IQShVhw3 ÅXt};txhShh4W4 jjWU@ u(h ShhW3 jjWU uF@|xtV[_1t k Fx8jj4hډ tt9bjjh ډv uHE94u E98t2 E94u E98tu#F@|xtV苑[1u1ҍe[^_ÐUWVS0ExujU B 0u-M Ad@Pu[^uh ju!5}tEXt Ut-hEPjuE芅uY{xw8hCxPstuZWEHU BlCtCxEstTM A|tAlE Pd;Plu BM AlE @lEEEUE9%EPEPjuu\rEU؍T1ۃ}UtMYt;stuEE؁T;CxvPCxPstulKCtCxEstT#U;UvREPVu3ƋM܃}<EE @}}v uY UԋD4%tH EHECEMɉM]v RZ D4%urE8)tjuh?P Y[t EGE EG EHECEEEt)]v R<Z D4%uEE t PuW+ EE܋UTljUԃ }t)+EHUBPE)+E+EHMAPEE9EU BdMALBdRlEU9vuuOY[u'MM9M}u@)WVuut*}tUBt;ptu T*VƥZ!}t"MAt;ptuTV蕥XU Bl+BdMAh@Ah1ҍe[^_ÐUWVSQU B|%Bxtt=6jWu`n uCt\Pju0 1D E Xt0#UV5VBȁw 5uukj WCpC0pVjjujk$EH0҃E PtBpB0pVWu~E}PtESE1:Rwhu[Z wMੀt?2e[^_ÐUWVSCtCxEstTE+EP;}̉U)щMĉ}EԃEPEPjuuE;EvPEPVuzauuV uVWju 9}t%]CX8t{'tE9CuGCuuS ZYMԃ}EUЉ}ĉUEԃEPEPjuuE;EvPEPVu/zuuV: uVujuE ul}t%MAX8t{'tE9CuUȉSEuu [_u-Mԃ}E}t"MAt;ptuTTVY]Eȃ}CLCPt,CX8t"{'tC;Er;Ew SuXZڋUMJl1ҍe[^_ÐUUt k Bx8uhohjRN(USQ]CujE @ 0S w@X@uhjS(KtSwZu7EPSZYu"jSuZYuhjS'1҉Ћ]UWVS} Gt3uV9G|%PVtuP3V$[Xt;fJ G|%$PjRVu 0ɍe[^_ÐUMS4tQPC4PjQǃ41]UWVSQQ] EE};tH4vWZ4CT04@ 4uEE;uŃ}tWVXEe[^_UWVS}EPu +4P44P[Ƌ4|3 4t=vW[e[^_UWVSU80t k Fx8tMM] Kt k F@8EUM zE@ EE1ҋEu])ӋU;V86K,Eu PhVF TjjjVuFTEM;N8뚀uhV_ZEkFX‰]t ]hVY[Ã}u};~8suVXZ}qKtkE;F8uhS:VE_XEuUPhVF Tu3jjjV3u FTuEEM } ]Me[^1_UWVS u] Et k Fx8t-jjjEPEEPEPj3Vj js}UWpKj^jE]@9ȉ]t)RWډ8u`FTujjjVuFTt.jjjWEuV1ҍe[^_UMVSU ]ut&j%PQEPCTuIjjjS`u CTu*%t!jPjEP>u:CTu,jjjS u CTu hS:SY[1ҍe[^UWVS }ujE @ 0WpE0EE9EEtC?BwVhj ]S ]E#jjjEPU؉buEPEPjVWr}uEuhS:WFXZuuuuWM7GTu(jjjWu GTu F;u1e[^_UVS] C|PClPCdPSuVuClFLCpFP0ҍe[^UVS] fC|PClPCdPSuVpuClFLCpFP0ҍe[^UVS] fC|PClPCdPSuV(uClFLCpFP0ҍe[^ÐUVSPP]{U ujB 0SnDCLECPujVEBdP1B|tBQPjSGuECLFCP0ҍe[^UVSE X|SuVTZYu SVmmZYtۋt1e[^ÐUWVS]CE䋓EUEE,8dE@1uKCTu~jjjSu CTu_}u@PVSEh1 uUr,WjSMMGEEPuS[k c=$u E@ @ u^Yutu Zug}tMU }uOEPu S!uuPh;jS$}t#tCt;ptu TVX1 h\u jS#u}ujjSEh e[^_UWVS|uFU |BxEtPHBtE;!xu3ECOd\tk ||8tj ~u2jVZYjjPV}}E @xjWSu Vx腫WU Bx9xuj B pV_kHxCtP苐YU Btx0,wCZu jjjU t% tZBtx0hߠVJ4 < t!U Btx0hVk hV_XV[u t)jV|ZYt jU B ?jU Btx0EPE jdPu VE @UVLtFPFPPRV4l 1F @EWSu VU Bx~t}' E HtQEF f@yRuNrA0Vjl tF p贎F X_F fP? fPVjpV uVY[jU Bt0h?uÅXZt&E=$PuCSY_Pm ZYth\ujVR*E%=t!=tSh]jV}=$juCSY_PjjVuuhjVjEPE dPSuV7U BdUt ҉FLt@ЉFLʍe[^_ÐUQuUVSPU V1zx]tBtPEPSjyutEC1ҍe[^UU B| Mtt t  1j B pQmg PrXQYuUWVS]CpE9uhjSOEEEgF @E1}ыETC8UH9ErhS:UE}tEhSXZF pS_EX6E9t3CTu'jjjSlCT\CTu,jjjS\u CTu hS:SnZYe[^1_ÐUWVS]H19rXp tAt1>ut0FIt,tt"8tGKtGF8uKI1҅u1} tE [^_UWVS(EP}WY[EPuVjuWEPUu.[Z}Et_t Ut;E考EEvdPEPjWfEBE;Cxv!PCxPstWfCtStCxEÚTuuu蜷 EEPEPVu Wvt }X&E؅tMQPU-ZYtUE9u hjX)EU؋uush ;E؉ujhS:sEH Ht$u h jW }1ۅt_tE;CtuNEE쁣T;Cxv!PCxPstWXeCtCxStETU(EE;EvPEPuWetgEu؋EuEP/ EEPuuWtE}t(tGtM;Htu T u1XUЍe[^_UVSut{VJB9tt T モTߋCtP XCtP Xjjh3Vv s 覇S蠇dže[1^UWVSSƋC U}tPkYGPIC Zu jjV" { u VWus ݴ C {81e[^_UWVS4uv1t HuDžDžp9t:t'Xكڸ t9~ߋ6뿍PjjtPGP+ tthjV'e1crЃ91.Ht PV_Zt^t Ut1hPjVDž.bE{xw hCxPstVbCtCtCxTDžhr3 tu+V[Džh jV 9snt th<julUptkh B@8 Uhj/P4Y[u)Eptkh UB@8 Uh@juhWPEptkh UB@8 UhP?hMEptkh UB@8 UhPju $j jjuPure[^UVSjj4uVP u|pht k F@8PhhSt FjjVPjSu V0VjËF pVڍe[^ÐUWVSt<M9΋Uu9t WrXh\ujujjuWuue[^_USSE @}]ujSZYu.UCRSZYu}u jjSL 1҉Ћ]ÐUWVSPPEEE E}jhWPPqu EEE Ee[^_yVPWuShju^] e[^_yqUWVS(E EEыt k Ax8tE]t k Cx8tMUt k Bx8t<]u t.v RG_ D4%uFKԅuME t'M@tP<]^E t%EtP<U[}E <u1} t ? u@GNk +} }Et7tMYt Ut1EEvWVEPjuNLEu>;sxvVCxPstu*LCtCtE܋CxE쁋TU܋} ^jChS ]܋u t<< ujhS  Ph ZYt\CCGNjhS $MC)˃ MM ]]E ]G}EtEXt Ut6EEEv\PEPjuKEuCE;CxvPCxPstuJiCtStCxEUԁT}] }t(M̊D t~t]PHt k Cx8M]PHt k Cx8uh`EPËHt k Cx8t=E-]PHt k Cx8u BFOu Ec}EtEXt Ut1EEvWREPju}HEu>;SxvRCxPstuYHCtStCxEUЁT}u ]Ѕƒ[o*d.[\t~yFOt~t&jh5jh=S  MPHt k Ax8ESg U MPHSt k Ax8t \C\EP‹Ht k Bx8t#MS E >~8UPHStk MAx8w\mCFO=E)ÉE ]UtPiM[}tE]E@PiUYujjut Mtuu P! ]E }t-}tEPtBt9E u T u HiZMҸt\U uu u tE uuPu (E t ]@E t E1e[^_UWVSXxƉ}u jB 0@LVP|Ut k Fx8uƆƆ1ۅDžDžDž>Dž:EccA-tz,#E  +tC0 LlRg7pErHA\\H\Ng j EPuE 8uHE 8"u:uhEu hXjjjV BlBdDBlPVTYZlPVYZCDžztc,,0O?Dž3Dž'@E UBEzE8u utj B pV@~t.t%uu t hl*Id@lDžDžDžDž Dž$DžDž9FTjjjVuFT(REPjV 2;uxt^t Ut2(DžDž$P$Pj(;CxvPCxPstV ACtKtR1ۅt^t ;CtuO(T;CxvPCxPstV@CtStCx$T3(;$v%P$PVg@b(uf M (DžDž DžDžDžDž4Pj EPu Dž4Dž8<Dž@ø 6Dž84 @< Dž( @9vU=s҉u PlbZ PRb[_ujjV7 E    Q4 (<҉uDžDž 9r B9 r B jFL VFP{#ZYjjhV PVbjj]SVXE܃ttr @SVA_X2jSWVSWV hj,PV.. ,@EEqy 1<@19Dž|a9v[|=s҉u P+`[ PRQ`ZYujjV  < URP艺 < FTDž2 FL4FP 14819ڋ|y9vs|=s҉u!PI__!džw jj/ PRW_Y[ujjV  U4 RP菹 4 UJ  DžDžXG&t \t-PHt k Fx8LG"90}q&tCE^ePUlHu`}PNjHt k Fx8Z1SЉlj)8B)4u@4)@B)u`EujjP*DE@u,jPjjERPaEEjPEPEP)WVuUEjPEPEPWVuUEǂEEt ;Eu;;EuCUtP;sxv#VCxPstu*CtStCxEUT}1]܊t ;Eu ;EC\uMS;EuC\u \CGF~u{ECP‹Ht k Bx8uV)~uOEP‹Ht k Bx8t+EW UCƃ 8CGF,EtstPFMXV'MU_uAjjR }tUBtU;Ptu T uL[NVuP~ }tUBtU;Ptu T uLYuuSU Ee[^_UWVSE] SC9t5s 9BuC AJ9suCROLSX9ɋt9SuWPSS%Le[^1_UVS] {uusV}CZYtPF 19CtFjuVԜ u/j jsVTu 0ҍe[^UWVSQ} uuwVG[ZEPVv juV. tjEpPBO;N uUFJ BF f@fA.ujQu苜tju1u:GpjV]WUC$C( V1ҍe[^_UE UMtrt 1hENE U3hjQjR| UWVSSƋXF 9CUuC FLCFPQjuV u_SC BCBF fHj jsVou/SV)ZYu;]u98u PV[^1ҍe[^_UWVSE9ujjPM AxtHt UU BtEj EPu‹E 8u91>9tJ~?9}uhjun}1I>M}9tB;}t2G@Xj/S]"ZYu@uPu1 t}?9uhuju%1;>t} U B|%PUEe[^_USM9] t@PC|%E]jjQ]UWVSE9‰EUujjuPEx8"E6hjPaUrЃ9E;puuh%u huY[Fu^X1эQvDPjjh* Sjjh7u蛬U9ruh3u胬XZE;puZXtSUR8ЃUv@1ыEQ#9vSRU9rtPhu"hS:u[_6EEEEUBTu.jjjR6uUBTu E9Ee[^1_UWVSEEE EUE9‰U"Uz tr!VE[VuP臠 CCC E xCtCCUߋrЃ9~E,t F-E~ t EF$@EurEYuVP ~tC(C~ t FC@C E9pu_GO J9GuWW 6EbUBG9u:UB8EUxUrtVjDZujju ^jVPb vw+_CtBUB CB 6Z 릋UBt$PD+UB^ujju H1e[^_USӋҋCtBA Cs:DS4D1]UWVSVVEEXtڋEUZu ut*Ёv R_[ D4%+}vjCYujjuy-GPCCZujjuZ Cu SwCBWuP C8CUB CB Z  FE>tF61e[^_UVSu9t PVsXZSt CtPBXe[1^UWVSQQËEw(5tVҋPSE u}u jVhjPV}WWSEEt:j(VYZthj)PVWWStu jS-u ǃCPUPRSLCPS1e[^_UWVS}9u jjWOiCpC9uh@jWJE @|%PVW u*Cst VSWGp V sv$[^1ҍe[^_UWVS}9u jjWC0C9uhkjW JE @|%PVW u*Cst VSWo V sv$ _X1ҍe[^_UVSu< t#8t D0CB;t9s< uـ;u9s < t< u1ɉ[^UWVS@ EU BxHAtPB@^U Bt0&A[ujjXE‹t k BP8…tEY1I9v+%xuhju t UIt k Bx8RE 1ӍC Pj)t Z{Yt @FF FF~SP跙 u PhhSh?S[_o<1щр) uщƄ)萱 Yu0GKӁv RzZ D4%@tτGӁv RzY D4%@uτ(GӁv RczZ D4%@tτGӁv R'zY D4%@uτth,GtYӁv RyZ D4%@tӄt/08t!(:t,8t RK_I1,ʋ(эL,Qjq Y[@(C,P~xX,1IZKKAK (QUx_XFV S9Fu^^ hSS HYFV9uhjusVgVrU1ӍC Pjp _1sZ,AA ȃAqSPR @ Džjjr y֜ A [P苕 [^u'jjjjj;@u&腜 B YP)Ήљ;sC< u;t8VڋHZuމ)љ9sC< u9Ɖ;s2ڋ^tu;s C< u169Љ$s"8 t$B;$sz ዅ$;8 $C$1-tt !1IFh$PՈZYuu-$tt1I Pu$ Pru P$hju t3}t!MQtBt9$u T $8Xs}tUBt;XtuTOS|8_C[^^19/4PQ}ZYtuj/r[_t]qhhS4/PS$ZYuRэqD0Pjl [_@(CtVP C0/ F@SPR CC @BK$C RPɑ Q S 9AuYX lZYthju 譗 _thju 1ъBtDž ҈AQ9hju{tf@tSBt3u/v Q h\qju(H҉5^1 Qȉƅ19Džugj jij Y[XXX j,jKj YZ}GZ9_ uW GHGGUZ JLBPۉ Džt{yU u DžM A|%t.Pvu2 E@EPvu 9u$O9Iuy x9NjV9Rur p0FP vFp$E@XZWtMA BALB APB ZB J1.tW3Xt 3XVu!e[^_UE UWVSLPjjjjj:TSu 1IQVEPS ,Su_ZuU e[^1_ÐUWVSu @É׋EtPfYt.t k Cx8twh@XZtwwhz@ Ee[^_韂 UWVSxU 9Et 9ux w u >i_ @E4E tStC|\EEtDC@S9u9C|.u/;U CuU BS;U uM SGgXj jjufC@EFtO}u(VuEPjufkuC0XVsSjuAkEuuEE ‹@FY9_u2M A0E p)C9CEEC9CEEE1{9s-C0v RkZ D4%tF;suZCCUC@=$u'BHBy Rj ] 5j xY[uE9S҉U+}t}tgSB9EEEvREPju Essu C EEEC@9EEjuM|CCXZ8E;CoUъt k Ax8ǀUt k Bp81E;Ms&CU< u1)AEE9EI1)1Dž|9w#1)1҉)Ѝ|9)|D ;C vPC Psu C|CC|tCS C|tCS CN1b juM|uuڋEE@t5Uv R;i_ D4%t t SEK CEe[^_ÐUWVSSSuFLEFP}jWj'VEOuo^CXx ȀCXC4C4t"r;u;WV;ZYu7C4 WV^ZYuC4a EFLGFP1ҍe[^_ÐUSh]S螐h3S蓐hiS舐hS} hSo1]UWVS U BxHBt0v RgY D4%1t&fv RUZ 4tvP6Ō ut:C u4t$v RY 46vhCsshuXtppXsshu迏 tQC tIE[v ROZ 4EՋEE]BM؊BAuUsRj huF;t@UBTu1jjjRv^UBTK^ e[^1_UWVSQU Bx}HBtxtj B pW j~N[t]u@9u<~u& t k Gx8tL `~u2tkGX SW蠄^ZPh,W- F v R+e[ D4%uvv RhOW1EO~u& t k Gx8tL u`F tPhvGW膍 CE~2GTu&jjjW跉uGTt] 1e[^_ÐUVSh]jSu  kE C EC`ECd E}ClCpChtfK|Cxstte[^UMSU AxYtEEBAx@Ax[UWVSSE] 臈 E~,V09Ur/E@9v!PF0Pv,uguF,}~,=$uCHCyS誁@ S\YƒuU=$uC SZuB 8u* =$u fc SS<XG) u }tEU1 EGe[^_U} S]uAC0@K,9t6S(t/zt)K0B8u)HPhejS讱1]UVS]sjSZYuZjjS\ `t k C@8C4Xt k C@8C81ҍe[^UM UE $PhthPjRLlPh\PhTu E-!PhV?EEEE U霰PhPhIPhjR~ÐUhjue1ÐUVS]u t k Cx8uhjS"vFdufV|CL%b tt*@t=t^B-;.4+-CLS BCPBPsLSC fH tvXPsLh! hRϬPsLh+ hR趬j PPjSF|%=t =t jjjj"jjjjSXu tCC CP葬^u-S)YuhS:SɇXZ 1ҍe[^ÐUWVSxƉUujE@}EtEUzxPBtCt&Ёv R^Z D4%uӅ};!d\t k Fx8tj UB 0 CEt,Ёv Rf^Y D4%uЀ}uj UB pj1IQSuVT<jUBt@0EPЃlPPRVfuu hV%XZ1cExdw@l@PV肉Y_uMExxtP}tA;>u<{>u6MCt&Ёv RV]Z D4%uӅt;u uj1IQSuV@UBx~tuU EHtF f@Q:yOuKr2V tF p2 F XYF fP? fPjpVV WVlbXZjSVuWElPEdPVJee[^_UVSuF] ujC 0V]d@XtjډYuIjVcYZu6[|SV@YZuۋt1ҍe[^UEU EZUVSu] jډDZuIjVscZYu6[|SVZYuۋt1ҍe[^UVSu] jYu&jVcYZuCx] ue[^+e[^UWVS|}GEE0E}]EtU M}EDž|Džx2 ;ud|@1udGTjjjW}uGT}$u+x@PxWEhDžx EPEPjVWwSuju] ;EE=$uCHCx  Sj KSj 艾Z YuEF|Sl ^udE=$PuCSYP w ^Zu1E%=u!=$uCSiYPrQ Zu SSv^1t(G@Xuh\u jW読S*v[}$ujjWUh }tM EU| e[^_ÐUMyU ujB 0QjBlPBdP1B|tBQPQSÐUWVS}u ujF 0W{fV|t^Xldt k GX8KXFd@EEtjt' tC 9v)@FdFd^dC9ڸv)@FdVlK9غv)؉VdFlGLEGPEjEPj'WܝK9غv)HVdFlVW跅ZYhA WEFdFlVWE芅uxhA WZEPDVdFlY[tEEFdDFlEPW[Zu+E9FlvFlVWZYu}tEGL1ҍe[^_ÐUhk ju蹥ÐUh ju蝥ÐUVSS] EPC PCP3uVHt}th jVY ;C tPsZYtCCCCSC1e[^USS] Ct! C PEPj@Put CiC USt PRaZYtCC?CCC C HS9u CBCSCM 1]UVS] {uuUSv7RT,jjS\C SLPSPPfHhS:St1e[^UVSSjÍEPjsLS.ytCLCPE9CPr 1҅tPSPCLFDCPFHF0% F0e[1^UWVSQËE֋P PSRljEo^ZutEEe[^_US] Ct t?jjjjjj, jjjjjjHlPlPڋEf]C UWVSu F1 ]uF,=@t=@u_jjvx` =w5:` Ph:ZY7 `+d}tEXt UtL|2Dž\DžtvwPtPju\M|2;Cxv#PCxPstuCtStCxt\T`;|xu(VdP\l/ \0\ d j jPpPU z-huۋp~~)9غyy)9غtpuXu DžXpXjdEPǃWjPlPM y+lu#;hhl;h+hlulVXjdEP聉ǃdx\- WE\PdS- |+`xP```S+d- |d+d)$R\E p4u|Kjà E1\t3}t!UBt\;Htu T \nXڍe[^_ÐUWVShj}'4 Y[tGE džudžHtCPDZujjWŊHDP, HH |t.1IQ|u F |t&1ҍe[^_UVSutZ0tP@XDtP/X|tPXtPXSdže[1^USU 2M]Et0&t ^ItJWXPt k A@8E] ]t k A@8E M[E M[z1[UVSr0] t t k Ax8t<t k Ax8t4t k Ax8t@t k Ax8tt$t k Ax8t |t k Ax8ut k Ax8t-Qtk@tu@[^UWVS u} jËW4EdžVL$EPEPRVxet}tHEUtFP@9uFPFPSG1tGPjjuujWVu=e[^_UVSERPjju v4]S\buE1҅tPSPStk@uSpXVSe[^UWVS }u jËV4ELJWL$EPEPRWndt}t3E}uSF1tFPjjuujVW<e[^_UVS]CPu CPPv4SI u7Stk@uSoYu ]e[^e[^UWVS j {L_ǃu2EPSbZY}uEECPSEtk@uS0oX}uCjusLSdEPEPjsLSW`unCL@DjusLjSaeuLEPEPCLj@PSCL`u(CLHF1WtVRPjuujVS:e[^_UEU EUEU EUWVSu F0%V4 ;V<}F0u5EPEPEPRW bt}VW6jEF0ZELJtGF8 t k Gx8t!F8Pv4W MF4GLF8GPWtk@uWOmX}usF<9F4ukjFK8C@9st"B tHC@S8C4t B tAC8Ctu)t3(t#s E< B\M A4EԍEPuU_ZEPuօZY6Et ttE9uG;EuOuth?juPyEԋ] C{8t4C4C GEЍCE̋}Ѕt)]v RJY D4%uuuuV&}tK t k Fx8t,SjjE p4VwuHC1҅tPM Q@ E @@C1҅tPM Q@ssq4jVVNt9S1Z.u<P] EC8PD< uus4VkLÃtFtU;Ptu T uXM Q@A[Zu'jŰB<PhWLMM̋A,t @ t%PQW)7}E8z@MIt7w 5t@tB<v +t^uI11u!j jhjWw5j uujWW5Ur{8t4C4CqUԉVӁv RZ D4%u)t]t"t '_UEԉGF(F$F FtEFPWv$ FF=E PuWuƺ'^9[usp3UBLFRP}F8VE* t}G)@F(E+GHE)E) F VEPF}O< 5u! PPvvu|&YT[u@hp9hhS:u XZTu uX Tdt }X~^P9s19s<(,(8uA9s,8 듋t@t'BKAӃt )~~(~(t3BF(AHFKF(˅t|F+~;F vPF PvuFF ~^^tPWP) Kt GBڃYP0mX[_9%=@"F(uSF@+~;F vPF PvuWFF ~tPW@Pj FHF(F/DžGtC~;juZYthju): Dž[DžE*tikC;Hv.PHPDuy(DDjSf U(t!kDȉtDž @t u}t u&Bw9NF(Džuy tDžbDž~7G =w 6uEDžXCP $U(t[tjvu{ t%UtjjhxjR VF$9F8unuoTt`P PR PEo t"E*)lj~ t DžtE*tPE^XE(tF tHNF FF4FF0Fjvuyz fF(V E+F,^^ CF,t?v R]_ D4%uǃ CF,v RY D4%us}FF t k Gx8t8Ct&v RZ D4%uDžB PRSumUxMA|G9QxuyxUB|8G F@ME(y|W(GuSWutPjQ}t!MQtBt9|u T(|?XWvVju=PDžGGXu\u TG\T ;G vPG Pwu2G\XTPEGE]E ,ExQhPEE U@QhjR2UVSSu ]tEPSZYu#E9r jjSM hjS e[^UVSV] ۋut EPjj3Vu%EH9Cu jjV hjV e[^Uh)ju~UE Ut8uhEhnjRV Uhju?UVSu] Kt)v RZ D4%tFѸe[^UWVS,B1EЉֿtzF4EԋF8E؍EPu0uY[-]t+u{Uv R?Z D4%tTF,t1@ t+Kt(u#1===EPujvY[O}GǃEPut[ZcEu'Uv RY D4%tuF,t @ DEPuu[Z}Ooǃ}Eu.]Ӂv R Y D4%u _tEEPu't[ZEE"]Ӂv RY D4%uj}u5Ӂv R|Z D4%z_q/Ӂv RGY D4%u _@u8F,t1@ t+=t=uhEPut_ZK}u'Uv R[ D4%tEPu8tZYui}tOnV,tB uF49EuF89EuF4Pu2EԉF<ҋE؉F@t)B t }uHF@tB tF4V8 FE=w 5ujhjW j EP1҉ ZYtE=w 5uE1e[^_UWVSHE1} jU}1҃} EWEċuYXtujWF P# } Et EU} UuE}"} E#j1WE)ÃXZ} Et MEFN0jW1ҋEY__} SEt EUUUws5ti}0tcFPEZ1҅ MN0EjPEjY_} Et EUU M}"F1t h '} t jjj}1WEÃXZp} dEt EEFN0j1WE_X.} "Et UMM}~v7}jtEkUB-hu(Y[PuzMD`uF1tEFf0?uuDtCt-StYt!E$ E$dE_c E_y'j jEPju71҅u `1҅%}~u'U t k Bx8tL?~(}.t.1} }PEkMAX}NEċ@,9uN0 F(LUB0 uhEjufF1tMA0FAF1t FUBjLuVPF0OMt } u`Eu EtEjEP1ҋEdÃXZ} Et EEFN0<[t <]tzjEP1ҋEqÃXZ} Et UEЁFwd5tZFPE1҅YN0MjQEÃXZx} lEt EEF} tOUM 8tEE@ujEP1ҋEfYX} Et MEFGxEPEPjEpLP'U1zPG]9s.E8v RaZ D4%@u9rhju 4tMĉyPjQ9[^E];v RY D4%u<;_uEF;usFE]3v R軳Z D4%u<3_uEE9EtUĉ);4Ev!P4P0R]Sta0u}W0z0Ẽ 4}t}t$hjuiMċAQd_1ҍe[^_UWVSE0VjLj}W4 ^jM V(ZYT jjV\ t k F@8(`F4lXt k F@8F8V4dt k F@8FDF%u`FTuTjjjV[u FTu51t P P1҃?XtfF9t @t jjVU\\ vIF49Es)щEEԉMǃ\ǃXǃTPVB[^ǃ\ǃXǃT1ҍe[^_UWVS E@MEUu}Uu UTt.M䋁TtTudX U䉂TMu%tAjQY[ u+ZW} ujjuU\ VWhz^ } ujjuM\ 5荠E%MXAjQ^_jj"Y[tjW PZC tUWVP}E UCBPl ҉{uXllCy:ttXSYSOXVWh5^f8EPEPuMp } uWVE$Y[|> uOEx4uEPju EMA8HMUE܋XUtI;E܋Pvjh%]EXZ&jhEjhEU EPOF9v RF[ D4%uЅ MX;E܉MvqE)ȍK9v&v RY D4%t9]u E+Eԍ-KSv R車Z D4%u>E؉ËE))u)~|.uK)SVEU ^XtjhS:EsY[UBTu*jjjRxuMATuuuuuUjuMe[^_ÐUVS] uS ;Sw:kBjjRVt C @‰C 1e[^UWVSÉU@ EUDž|EtEǂtjyjsLjjS @s@9sDSL;sgVRPSCS@t9`9S<WS$Zx C<@NC<-;C@ˋ;VRPSS@t9ws9S<RS2  jjS C<@NC<;C@똋C@S49jrBPSMSUlCD9C}t8;t*URSV E;vPVˈZYujVY[F@9FDDžX9Es }jURz 5o}OtHtQ]SV_ Jt;Et PV1YZtjtPSRz 벋tjP3z jjV }thPVYZt DžX}F@9F<URV U9t RVlYZtgMjQR{y jjV(XuhF<@OFD4%Ѓ]Ð]ÉD4뭐 SD뽉UUv RD%@áD4%@UWVS ÉKuvNt69r PU t2v PU tK9sNuC9se[^_KUWVS É׋uNt69s PU t1v PU tC9rNu9ve[^_C뷐UWVS EE HӋuEt PUǃ PU9uC9r}u%Edu8 RCC%@t"C9swۡD4%@uM}u9w؍e[^_UWVS ËEHKE@t[9vh3Ёv` RB%@uH PU ƃ PU 9uK9sM}uC9r؍e[^_3K댡D4롐UWVS ËEHCE@t[9sb3ЁvZ R/B%@uB PU ƃ PU 9uC9rM}ueK[^_3C뒡D4맍vUSQ@(A,A0hHҋ|ǁ4ǁ8ǁdA8A<ADA@AH"ǁt.llx‰ C4Jy]ÐUWVSNj@4+G(E;UEveE+E9ruw(ƃ1UE+ERPjSE^G(EG,+EG,YG0+E_4[uw(@G0(ƃ1)URujPG^@D)D[H+E艷@^G(u<Hƃ1QuUjP]XZu쉷<Lƃ1LP)PT)uTLFÃ1tKVuUjPi]+؉W(E쉇ЉEG4e[^_UVS֋P0Í2;C4s 9S,sv2J9S,vS02C0[^ÉtS0ΉUWVS ] 1щOut/F0;F4s/~tF,F,@CF,u1҃ [^_ÉsuUVSu ]~ C(9C,s[^ÍvSC,)S(9sS,[^ÉC,[^ÐUP,H(19ʉtB9wz t H9w8 u)BÍvUUxB,;B(ǂdǂhB<B8vHB,ÐUWVS uN,V(9ѸtTh$ v@;V,lj@9vAV,C9w)D`F(9sF,e[^_É~,USS]C,;C0u;C(t'HC,S@S,C09r ;S(vHC,Y[ÐUS]C,9C0‹@vBA9S0wC,C0D[ÐUWVSuN,^09s=V(B9ÿv&AB9N,vQAQV,Bf[^_ÐV(B9vQAQV,fBӍvUSM =]w45t*CV FtQt\tA%RuC‰C빋V tiVuu WEe1ҍe[^_ËFt PvEFt~S}u E 0Fu믍v‰F 눋EF :t$AU FivUWVS Ê֋} tJt"tPPWuVe[^_ÍvU:usj.jhT/ve[^_sj(jhT/ ‰랉UWVS uEE8 t2S҉tvP8 tZۉue[^1_ËStEF>t'K t݃ VS EuƋS 0u&Et'CUBCEe[^_ËCU:t$1҃uà Q!1҉pj+jhT.ÐUWVSu<t[^_Ív|9tx9u<tމ[^_qx<uۍvUWVS ]ۉljuF^0@e[^_Áw8D4%t;>^F؃@7e[^_Ív S)%uŃ^tM\t_ t;w`D4%t\ Su)%@u;7O>\F7^A7?8>\F7\* S3)뛉>\0F>F0>؃F07)D4끍vUWVS M׉ӊt_u^C@EC8uce[^_ÉƈUvU R(%tC^C<@FCEuU:t BtCe[^_Ív}^}\} tCUwPD4%tSU R'%@u.M lD4> R'%u\C0C0C0\C ?D4vUWVS ƋEӋM t|t ~Kt IUFt?R$PSh3v"e[^_Ívu:t v t;Bu2hXF볍vUWVS uÉҸt= RWW ҉t' @PWuFv1e[^_ÉD"DwGPWt VR뭐F0"Dsj5jhU * haFsjUWVS lj֋]M ttH8tStӅue[^_É ҋRDS ҉tFA뭃 Qډ1e[^_À~uD"DCsP1뼍vUVSËu:t#"j@~e[^PVhkFsUVS|$ S$%tCw֡D4׍e[^UWVS|1ۀ>0NjxtCY<0u]ػE5t&؃jEPU؉C*t~"1ۀ80tC<0uE0e[^_ÃqjUWVSÉU썀AxEUEE|MME""t+UEVM 8ЈUuEu u֍e[^_É EPtUM܊ :E$XDU:E؃t UR؋U,UM؊ M E$ʉ D0 UM YE܉U UWVSuljE ƅƅ2"@ 9ʉv 99Pu;u  0 hUFPhUF PhFw e[^_;u u hUFz PhF$0hUFT PhFwSe[^_vUWVS EUxp_1EE8t4>P6uD> t>PSElMye[^_ÉUWVS Uxp114>u6tC~e[^_ËED>E D> e[^1_ÍvUWVSzƸt<\t<^t&B[^_ÍvB 0Fw&$$3vBt 3Cu V1w G t*>t 3 ;u Ve[^_ÉUWVS,'Ëu@d…>1҉I 1ɉtэy9S`B=19ȉv>vt*;t Št/BGuƄ/G9wRhPs\0G={`~usjjhFk e[^_ÃVC\ЋPIK`@C`e[^_ÉV0e[^_ÃVC\PC`뱐UWVS EHhEPA MҋAhPEuUBhP MQP@P FPF1ۃ @PtzCF9ExF PrtIF1ۃv @PPt&CF9Uz Ve[^1_Íe[^_ú UWVS Etppti@Et_''t`V3i&wuᡠ&&tWvV39&Nuᐺe[^_á't EuE 1ѡ&tÁ&&&&t|Vj EPu E8؋u-&Vh NhA FTA&FPt &r QEq @'1 uuRU&BhE&} GhPp 01҃Juu0U&BhQuhFEpqWuhFuvXUVSƉ~k@Xte9PP|`PdBxt8uXB t 8Bt-8t(Ku VdPhT jrKuVdB$t8u+e[^Ã~OVhT SSSrxLPϛPhT jr$轛QhT jr 訛VdeBt8E럍vUWVS,EDžDžE@EU;-tA;t<>9މPUBXPhI4Mq1e[^_ÃttQVhLUUrEMt 8u}wj#jhUe[^_ÍvCsvEM<މuNPUBh@uREމu`VUzX9މuWUBYDž]DžNFމtAމtމu8QUBhphM4ru`SEhM4pYDމDž''}76 u݃P PSwPt u,PM1hU}w1 Cv%uCƒ%Mw$T4tWPhUEpCFRUBhp 'J-'MQd׃E}t:uBEp&vVj PR‹8B:}Gt 8PVhT jRjȒPK1WjUBt 8-PhT jŐRj VPL‹8EM<83Wj VP ‹8u(x$MAt 8WhT RRS+SE0hUUrPE0h VՋQU2hUMqFWPhDVEp!rRPhDV봋[RPhDVEvUWVS Ë@h@ }Ch@EPhht@s +@tfEfu\EftPEPhht@s +@tfEftEftKh19A te[^_Ð띐9AuvUVS<]SY^jSQu VSjvEԉ$UЋEuRjVjSe[^à UuԋERjVj-e[^ÉUWVS<Ƌxp@\|EMwGPEຌ57Y[w WRU܉5XZwWhB''tBvV PRsgP袎PڋuɋPhz kruB GTBGP* P+[@t3QjPjK WL1Pe[^_à htwEDžyw@rjjhV`Ah@ PAh@@@QhBB='' jڋw;u⋅Phz B PPhrBQhvPhVp$wjjhVU5uÉUWVS ]ۉlj~9XP} e[^_Ív PG@FKGuWP9|ԋGXy=WBGWtGEt jUG됉W닃 j PUWVS lj)9vz j GO9t}9wP|xt|)ˍCvWdBt 8.qڃ~Odt 8GXz9؃~à jKuwe[^_à j ~Ge[^_Ã~:Wdt-8t(PhT SSS P茄wGXt=ʉ%9t*9Љ~E j 9]%GGW )PʉPhT RRRqPhT VVVr]vUWVS Ƌ@9Љtd9VT|_)Åv~XyFV8uD~%VdB|t8tv j >KF~e[^_ËVPJ FNVKjy~ċVdu0Bht8tyVdPhT jrhCx~뇀8tˉH~@PhT PPPP~Pӂ~LPhT SSSr|֋Bht8t뮐UWVS @XƉt PdB u&v~ j Ku~e[^_À8tQhT jr LލvUщSU ËExx9~9~‰[uمyUWVS ]ۉƉ@X9XPPdtL8tG~6PhT SSS'}P誁]e[^_XB4tÀ8tB88B(8PhT jr8P^ PGKuVdBEHP6vhMHw7 u˃wj 芾e[^1_hZ벍vU5OÐUWVSE@,EMQ09r#x9MA(MUQ,UB(MƋQP9u䋙 $Uv^vC M} U R2%t>C;]~ vG;]|1GF9uwEڋEQe[^_ Uv4 R%u;]~+]뢉D4{D4͐Cuz1qA(9JUQ,UVSdt |ht-C,)t+S,t0~Q Vxǃde[^ÃS,uЅ~*؉~+ǃde[^ 멉ډ躜s,֐USP]K,S09Ѹt0h$ s@藞C,u du ]É]ÍvUSP]K,S(9Ѹt0h$ s@ӝC,u du ]É]ÍvUSSEH,P(9ѻv"+H@9r"H,u duZ[ÐP,NvUVSUZ0J,9sOC9t3B@9wB,Nu du2[^ÍvZ,vuȋdu[^É[^ÉUUB0uHB,duÉB,UVSu^(^,tCv R%@t!C^,wܡD4%@uߋdu e[^ÉUVSU ]ҍlt l@ ~8e[^m lRulVte[^l뼍vUVSË@,P Ut;C0t e[^RSP+S,)…uZUv| R%t@}?t Eƃ@^Љe[^Uve Rb%tUD4녺\eu0O0؃:V0vD4뜍vUVSE u^@tPF0;F4sOtb~8t V@vKtF,;F0sU F,K@F,u鐉1҃~8tVe[^ÉډWtuF8tF,;F0r F,U F,/1҃~8ujVe[Љ^ÍvUSRM =]w?5t5CY_jS4XZjS*Y_jS XZjS_XjS }ȃ WSj11ۃ="-vtP4"袿C<"uQjWje[^_USS]Y1[aUSS] SYs\蒕ZC\sl肕XClC`sdkXCdsh[XChspK؃Cpʽ ,ǃ( xXǃx|Xǃ|ǃǃǃ輔Xǃ覔Yǃs(蓔ZC(C4<yXǃ<LcXǃLǃPǃTƃX"@2؃ǃ@Ŏ t XǃtXǃߓXǃɓXǃ3跓]]験]ÍvUWVS ËH1҃vCt e[^_ÍvVs "@t֋%=E9tRuXZu;|t;t! ;t;t! ;tt;t! x9t;t! 0ǃZ1A(8Zt1ɺuZ:(tAt AA~1҉聪AE1ɺuZ:(t(t (A~ut Vujs @ǃe[^1҉_ËCXvUWVS,Ƌ@uFu9  V%Α1҉]Fe[^_Ð]؃ SXZjSNY_jSDXZjS:Y_jS0XZjS&Y_jSXZjS_XjS}ȃ WSj-1ۃ="5vh# 4"訹=# t C<"ủ5QjWjFce[^_ÉvUWVS8]Su_XVS^}ȃ WSjtfL1ҡ"v9t B"u4VԸ jWj'Y[Vj1e[^_ágj5F<ZYt뉃 5Csh_vUWVS E }ElCxmC4C tE@CEC C<te[^_à ARVC׉ JV<C덉1҅xEE }e[^_vUWVS NjE ӋuE8tSt"8uC t+VW Hu8[ ϋEe[^_ËCUCtCe[^_ËUe[^1_UWVSuEFtb^(F@< < SVHtC;F4rĉߺ+~(gS~(G루sr^(2;CC1< Y< QFSVHC;F4rߺ+~(Շ^(뒋F1tF0F0@F0F,fFF@F<dždEPV[ts];s҈^IUU냾VJIE닖PVЃE FHw$ 6 HOvVDFDEȀEЋt|xu |-]:FE t F0+F(U 1tvF(e[^_ÐEЋuE싖PEPoHuVF^0^,M tF,+F(U 냍v|9PE;T@&EUPE]Ek j Y$ M3~0+~(NFXt1҉1ۅxډICVP9}1҉-끉贊@q4F~^0]E +U :!;LPv* R%MU䉖PD4$UWVS ]ۉƉUtXE쉆EV,M } t< ~09t9v9V(w 9tU9we[^_M } uɋEu+dt.]~fBF,Te[^_Ëd+Uu҉V,e[^_ÃEPVQHtjVz]"V,뛉UWVS UU҉ƋX(t1эyPWRSN1CE^, EF0zEPVHUƒ tc&t+ tW(E]G@룍vt6uڅ~KC댉놋F(F(F0F,e[^_ËE8F(F(F0F,e[^_ÃjVF(F(F0F,e[^_ÉUWVSׁ(ƃƅ.ƅ*dHtgHPÃƄƄ+.CƄ+*CƄPhPFHF(F0F,jVr<ujVOe[^_Ë<.t<*tPhRSO. @*hSP$BD.BD*Be[^_ÃjVUWVS]hjH$ x4Ƅ5@t |衅e[^_É|ze[^_ÐUWVS,UË@,EEEEE܉U؉C0;C4 u7:.zD*EEC0 S0BS0}L6tH6tS0BS0FuS0pB9S0vS0BFS09w-EPS|HnM(w $P6v<( hSEES0;S(v: C0P;S(S0vx uuԅ%E̋t89E]wv<[<]N9v}[MЅt E9EE.xD*G8C,;C(r ;C0#E؈CH}jS[E}t}C(C,U؉}8}:U؉)<Et(}t8}Eԅur}ulF=?uf}:u`EvEE܉E9t/<EC,}uEԅtUe[^_ËU܅n뚃ẺƃPhnH'*~FE9w{,OK,S0h$ jxK,9s\9 tWwBC,HK,S0S0K,B9S0s9 tveS0EC,jS EC0U؉葥<E8} E9t蘃<EC,?=?}C,@C,EEYE냻Q(A0)Љ4A,)Љ8A4)ЍA4;A,3A0<Y([^_ÐUUBQPh5 a SV5/XZ5j m`e[^ÍvSVhEP5de[^ÍvUWVS E u]tNRPh5` SV5|/__0o0 Ph_5{`e[^_ËEESVhPc}1уY^00Phv)P]]S e[^_UWVSju V}9~t e[^_Ã親Y0/$VhrZ7W USP]x P x Pשx P0u$u2$u@ SH1]à S#tЉ PH$t‰ PsH SgH1]UWVS|҉Uǀ ǀǀǀ0ǀǀǀ$(1}IE EPju u>‰EPRڡE%=WjjOE%= :' uZ uu hZ xVjjPhZh\3SEtPhCPur Se[^1҉_ÍvUҋE|  PhQjjuRjjP/x} S;Ze[^_Ãjh:'ډ ݍvPhZ3SZEZPhZu$EuvUWVSEEE E}uh4Et4Ph4jS3EEE} Ue[^_t(躦Z0+PVh5[e[^1_UWVSEEE} uEh4Dt4Ph4jSHEEu }Ue[^_jWh ^00+Y[Pupe[^1_ÍvUWVSE ҋ} 1tU8tOEEEE8_t^PEPjjpL@tCCfCECF u)Љe[)^_É@E뜃We[^_ÍvUWVSE ۋ} u1jRWE 譤!Ѓ@t5RVuE 膤9؍e[^_Ív跤tWhZjuӉEEtxPEPWut9vjjuuE!Ѓ@u AubQSuEУ|2t E)uE+Ee[^_PhZE0P&PhZE0PBPhZjuPhZju UWVS u ] }x菣1jRS ,!Ѓ@t(PWu xL9r+؍e[^_ÐCtShZjV#PhVs6VWhZ6PhZjVa륐UWVS 0 ɉƉu/{RjjjjWjA 1@t#e[^_Ðs3軙Ph'[6VzȍvUWVSW0x@,E1v1;M W wr;UwG1G ;u r w;Ewv Muu1ۉ[[^_Ë]u )Ήڋ_1ڋEHE%)É[[^_ÍvUVSu0u$Cu5 S\@dž0e[^Ívs3軘Ct̐ P'@ S@dž0e[^ÉUWVSTujV0*@4@@0P*H,P@]E<[ESVEs[ESVjEPE)PVg_h@VE1ÍvjEPEčPV-hSE%PV =G~0UP0@ 1ҍe[^_Ð}Es[ESV-Eț[ESVjEPE)PVqhVEhPuVE =un0UPQPhE[6VHXu=e[^_PhV[Qhg[6VSh|[Ph[Rh[Ph[ѐUWVS,} xSh[jW1e[^_É0H M P%1ۅ҉EEE tb^؋] %؉EP1QR EMU Q)؍e[^_ËP] E yE] ?ڍEP1RPh E؋MU܉@)؉Q뉋E %UR1RP" xjuu3!Ѓ@1PjEP EԨu1%RP )M ؁%1ۉȍMQRPz juu苜!Ѓ@tdPjEPe Mȃ]%EȉUuRP +EPh[7Wu h[jW>jPh \Vh\7W Rh\Ph\Ph7\Ph]u1ҋE RP} Qh8]uSQ^ WRh`]PhU\WPh]LPhr\APh\6Vh\\Ph\QSh]FUWVSEԍ9v׃P5~u}t25Pt1уt10e[^_É<$B<%uBpu1CƒrwY$]UЋxdיEЉRU2UQPg1уt1EЍU)MMEz O%vtK~W(@ AG9}1[^_Á뺐UWVS tt e[^_ÍvPjjS@tC@WPjSVjjS 1fz~1FB9~tꃹuQBtjS@tjFSF1PS 렃j1SXZF'܉UWVS E1҅t e[^_ÃjjHZtء@@ @@ f@ffBP fzfBfBfA B ~ fBj@PXYC {C@PCP&YC Ëp k1fx1BB\B\@QPj \@t&~P@9D GB9rE@@)E U nE11fx~b1t7FG@9~@@t @ƃuƃVf@TU҉PuT tI@ 6@ "ǀE Ue[^_Ã=`Y= KLX@)E U 111t;FG@9@t @ƃuƒ P!  Pl! X@)E U ~w11N1FG@93@t @ƃuºER 낉Ut+@@ÐUWVS UҸUэ@R(s;B| RQ#Bx@D Pe[^_Ív SЃ뽡@x2v jj]rQ脴| Pv SЃrQN0ۃ`<~\0ۃ`R;B| MRQ0AA P+ SЃmrQݳY;B| ERQ@9UWVS ǡt^ txNxA9~6x)tR(@98t 8 CA9ʉ 09ht P[ A+x9Tp^NQ AH9t@xt ~09ht Pt[ $QBHBx@Du= A9x;1AH9xAʼn P/뵉 SЃ닐qSv0ۃ`;B| XRS>L @pe[^_UWVSljU졘@uEv}7;wBH9t@xt <~,09ht PY$˅RBHBx@DOB9x M})7}aEU9U}9wuEE9E}U94tCtb;E}KCxl104C1C U9Ax9EE}EtJU09ht P;Xu%PC:PmUx}BH9t@xt ~09ht PW$˅RBHBx@D|B9x|E<)EE1e[^_1;u}BH9t @xt ~09ht PV$˅RBHBx@DLB9x}F;F0BH9x1v Pov SЃnrQX1;uBH9t @xt ~09ht PU$˅RBHBx@DuCB9x} F;vF-BH9x>뿉 PC믉 SЃ념rQp0ۃ`0ۃ`;B| FRQ8:;B| RQ88t/EQPEPPvf}f}v% h0ҡ9ht RSu衘@P(E9Eu苂hx@tut!@xu j{SVSxtdtxE<)E BH9x2 Pr SЃtrQ$`0ۃ`0ۃ`BH9t^@xt <~u09ht PR $˅%RBHB;x@DB9x;B| rRQJ6fBH9x P(s SЃDrQڨ0;B| RQ5 P? SЃBH9xrQj0ۃ`;B| RQV5UWVS E9UEUEu }tB)@;~/19'MM99|!1C9~ڋMe[)^W_v)Љ‹M) h@ut!@xu j8PSuxtaU艐t1҉x\vCB9SvUWVS 09htxt POQh| B)P@pB9~* v@(4CB9GB9~? 1fz~ v@(4CB9GB 9ˍe[^_ÍvUWVS,EE@@S9‰E BHɋ5tv uB@1E nEHE@ U܉M؉ẺEԍv19}Fu܋v(uЋEԋ 0u94Bt:9|19}M؋A(ű E9Bt9|u]m m KyU9U,M9@P4h@juxt_u艰tǀxE{u t8t.A9 CA9ߍvEe[^_Ëlh10b4t11O@x* jL8uEEQPEPEP!of}uf}1vUWVSESuUxtOM艈tx1ҋEN@TIE])9< SЃCH9x} P:Y}wQ0ۃ`N;B| RQ!URh| W WpP蒽=}qf}]Xf}]UWVS(j# fbftHfb dxdEx${VE 5FxtRUM C Q@9‰EUFx1ۅuPu@tlt 0FXE09ht P;5 Fp7ǀxǀt 1fy~<1҉1fy~#v@(M FA9GA 9ȋEd19ÉE} C;]|@@uC9|6vC(fD@(fDFC 9}Ջ uA9|=vA(fD@(fD FA 9}Ջ{fCfAff ph@ut!@xu jN: VSxtKtxh蹸P Pj e[^1_ d _; PXǀdExh| jjhPS\5Fx E09ht P)9 1fyXh@ut!@xu j8 jWxtaJtǀx Q1 vFQ9AH9t@x]t E~09ht PK8 $QBHBx@DuD A9x:] *B9x7EY뿍v P뮉 SЃ널qS贎o`;B| SRSGPǁxǁt h@jjxtHǀtǀxU0ҡ9ht R6 @p @ǁxǁtE 09ht Ph6 1fyh@ut!@xu j)6 jWxtGXtǀx@pA GA9yGA9h@ut!@xu j5 jjxtGǀtǀx jD56Eh@ Q@9‰EUE19ƉE1C(f|u@(f|tTEC9|C(fD@(fDB9|B(fD@(fDF ;u}p*EW @x j4 Q'UuJ陲UWVS EHӋu MUBuNBt 9M:Bt9BpXt 9Me[^_Ív9u9Mu h@u tBxu j13 juxtDUtǀxU0ҡ9ht R2Ph| uju@ h@u tBxu j2 jSxtCtǀxU0ҡ9ht R12E~#uPh| j@pXDNu lP0C@x11v;u#]h)@ut!@xu j1 jSxt Ctǀx Q1 GQ9AH9t6@x]t ~|09ht P0  $QBHB=x@D A9x: *BBxX9M h@u tBxu j0 jSxtAtǀxU0ҡ9ht R/Rh| j@pX9G9M> h@u tBxu jm/ juxt@UtǀxU0ҡ9ht R/Ph| j@)B9xE@ P//v SЃqS܅e[^1_É0ۃ`zF;B| RS h@]HjSxt?tǀxU0ҡ9ht R-Ph| uju@`P9M/ h@u tBxu j- juxt?UtǀxU0ҡ9ht R2-E uWh| j@>NuBx j, UWVS EHU]u MaBuNBt9SBt 9uBt9e[^_Ð9uu9u h@u tBxu j!, juxt=U쉐tǀxU0ҡ9ht R+Ph| uju@ h@u tBxu jv+ juxt<U쉐tǀxU0ҡ9ht R+E~*uvPh| j@)Nuߍv l\0O@x=1v;u/]싁h@ut!@xu jy* jSxt;tǀx Q1 GQ9AH9tB@x]t ~09ht P) ,$)QBHBIx@D A9x: *BB}9u h@u tBxu j( juxto:U쉐tǀxU0ҡ9ht R(Rh| j@9u<94 h@u tBxu jG( juxt9U쉐tǀxU0ҡ9ht R'Ph| j@0vB9xEa4 P#v SЃqS~e[^1_É0ۃ`nF;B| RS  h@aLjuxt8U쉐tǀxU0ҡ9ht R&Ph| uju@YPҦ9 h@u tBxu j`& juxt7U쉐tǀxU0ҡ9ht R&EuWh| j@NuBx j% UWVS ӋƋBɋ}uHXue[^_Ð h@jSxt6tǀxU 0ҡ9ht R$zBPh| jBpXKu h@ut!@xu j~$ jWxt5tǀxU 0ҡ9ht R)$B $Ph| jBKu1e[^_Ë`?Bxm j# UBjSh| j=BHXxSh| jpXGRh| VjV\VPg1MRh| VjV1VP<OUWVS E @x]tRUM E1`uSjuU EHyuLy  G  uEPE Pu5跏uu uPe[^1_9]1~vuh)ީ@ut!@xu j!jVxto3tǀx1Ҹ 2C;]|+vBx }*tPt;MtEH9u8Bt+t!Wh| jrQh| juu Bp 4TP?{ǀxǀtuuu uU E h| jSjǡ@p SPנǀxǀtFe[^_ÍvEuSju؋U nO@xux ] E1ۃE 4h@ut!@xu jjVxtB1tǀx1Ҹ EC9w9]@@(]h+]@u tyu j.jSxt0tǀx iJA E t t;} E H9Wh| juu Bp QP轞/ǀxǀtEuuu uU r h| jSjǡ@p HQPSǀxǀtF|EMTuu MuE+E@PU ERh| j@蜝{Vh| j@fn`Ph| j/:UϵvUhlt 0tÉƀ0h| jjj?ƀ0jBHPxt-BHtǀx  鳿v j&ZUWVSltd ]S_XjSrY^jSh}ȃ WSjXZjW SXZjS*t{VjSjLEuE$ V]SjE ZYjP?$# jVjYo`l jWje[^_ÉjSr S YXjS jSj* j/G9+lUVS @Hut jFw EP j]SVEEuV@P&'tƀǀ|  S& t ǀd|Wtŋ@t $ tPOZU塼ƀx|uÐUWVuSù1hUEPtMEEPEPjSuEȅt;Ett ve[^1_HuvWjVSe[^_ÉUSR=]u;u>Phjju =uu]ÉPjhjaغ   ]ÍvPhh롃 h\ X jhtUSEpkB B$B($ l,hDRh`p(؋]ÍvUSRtC SU]ÐUSP=]t9||u s kbXs$bbXs(YbC,}C0u (uiuQu9 s裍Ct K S;tM]à P|빃 Pn롃 P`뉃 PRn|#lp]à PJG-8 < s)vU1ÐU1ÐUÉUÍvUÍvUVSEEjPS9Mu7]يt<;tAE@Pt;u9;te[^ÉxʉƍAEe[^ÍvUWVS$h]u j}f]fuEܣEU܉|jWgPfXfXfpǀtǀxǀ|ǀǀǀfǀ\ǀdxǀp$TkRƀ0ƀ1ǀ4ǀ8$gk8RU܋MǁHǀLl ǀPt ǀT| ǀX ǀ\ ǀ`ǀhǀlǀp@ fx~M:%o@@%<@ f@@ǀH/Shh`DP#ƀGƀFǀtǀǀjjuV]Sb EFjjVSaE$P$P ǀd$ @@cXc 1ɺ  BtRjjVS\a@ PVR PfXf)X  P  @ GtvjjV  @P`£EtP(EEe[^_j@)PVS`y PVR P= hgkO488 M܋C @94VC @U98KM EqkƿqkujEǀ{k8{}t EkƿktlC MP4י4E܋RC MP8י8E8EǀkUELvUM1t6 \s# E  B @  1UEtEv1Ut,ǀd P\&`ÐUWVS ++ ++4+0+8+<+$-@|+~,_+:'#Xo< >v^## # -(-D<H>L*P!Tf5FlFHtD11I9s/FHa&`})+| .~0tC9rӍe[^_ÍvfwFHDC @C`lj P5aUWVS @;d~0P5``@d5=fG1f9Nw9~x `)ډ]C9~t)9tGHPLQuR =G9~2 `t9WvC9~t9~w9GKx^ `KxQt9}xA5`)ډKxt)9tDE@HPQuRgye[^_UB1;Et ÍvB;E tUWVS CESC)Eu uEZYtt$VB@EBB x6uޡU@ fPMfK@ M fE fB@ f@f+EfBU)UE M 1e[^_ÍvfJ;E|@Ef+CfBC9tLPWuR96K+E;EtC;EuEEC9uv} ;Mt܋M+MM뗃 PVǀ3 P6ǀvUWVS u }ƀxVW1YZu e[^_à h[oXZj5-[XVWÃe[^_UWVS EEt ltEEt;lt)hh@ fx~<!EhEu}tC@ f@f~2ЉЉ%?   !M9].EĀ}Eteu!#}}t-Eu&}u 9Uu EPjR*]h@A@ Et D@Qu jEE0JEAP @tt Et=t5@t#Ru j貆vt Dtt@t@}tG]u}t:h9Mu}ttE9tu EPuQ(@t@Hdyt@pht t@Hlot@pxjt@bt@]t@Xt@St@Nt@It@ Dt@?t@ t@@t)@tRu jJv}tMUhe[^1_ÍvuPu jE PEPEPEPEPEPEPEPEP 64P葃%h}6EUh9Mu}tEtE9u EPuQ%@CRu jhhG9Wu j輂Su j藂h0h}8Uu }'9Uu}tEtE9u EPuR$Ehe[^1_À}E9Su jRu jā)Su j諁.Vu j蒁E0 ǁ%hRu jpdkqSu jphUvRu jpl?{Su jpx)Ru jSu jRu jހSu jŀRu j謀Su j蓀Ru j zSu jaQu jHUh| u ÍvU@Hd1҅ɉt@HhtHlt HxttttttltÐUWVS,Uҋ} @Bt:t5<$t0چCu}fE fEm]mE܍e[^_É{S]^Et<>t2vЁwA5t70P k$C<>uыu]C kd<*t@<.uC<>tЁw5t0P$5k]E뛍vW $ vUS RP=@BtT Йȋ]ÐUB@puvRJ uDǀxǀtpt ǀpRlqÍv@HPjr 0P軀떉 P諀sUSPҋ  ~ _әj@pYXj@p0XZj@pHdYXj@p8DXZj@pD$YXj@p,XZj@pLYXj@p| XZj@ǀPPB( uB<jjj.P4YXj j@p.PXZj j@?.PYXj j@.PXZj j@-PpYXj j@p -PBXZj j@~-P@@@@@4@@T@j@,]j@u,,j@D,Pjj @,Pjj+j@p +sj@+B9‹~=9~=93ЉXu1v]v9ËXtҋSpt˃PRmtǃ@ǀ]jBvǃ^vUWVSV׍U؊ERDžDž9} Dž@BB9} SM )BB@,m8  ;EURVDž@@,1I9KK2qK΋vu (ZYPVNt 9} +} JBXLt ;_@B@BE؋MFE9MFEDž@BBH E9EM)Jt`9}M'ZYP EPVP,tB@D@B@Bt e[^_Ð]+]J'B@8tPhRQDDž@@81I˃9K4vP؋K͋9S EPVPvup 6&_ZP ]SVvPt 9%ZYP EPV Pt v9Wf%_ZP EPVPt9$ZYP EPV=PPtrPhRQZ9H;u:u1 A$M P(I]=w51;}9 A$] P([]h09G;|耽1;+U R<@$@(UڋCA;|);R MQVPDž@BURVZDž@@L1I9Kv>KK~%uDž@B |l@@D1I19v@O)P;tON@BDDž@B UWVS,ۋ} E9EK;M9|WЙEC;E1@ $BHB N~?@P8$ZBHBp 1tCH;E}E;E}EuuDžDž@BK PhREPGPt[}\S}~1@;E~%U+UE)}"tIhEPjuuWU=@Bt;}Dž}BH]B@0`B@H1~ B8t xvtPhREPw8$kvEEUjjuuWUE3@BtVh| jRk1e[^_É1;}vEv@UhRXojuuj=@Bt%;}DžvhEP juu1jC=@Bt%;}Dž?EhB@8ZhEP]juuRJKR=@B;Dž+Et~@pUR9@p8EPjuu@UHJP@pHEPMPjuuJj@p0URjuuj1@pEPjuujWSh| j ihURjuujUS=@Bt';}Dž?Wh| jph5j t?5j \?Rj iU;BRj M{<*vUj@HPjjXpt j[@u j gà Pj j fËU҉t4ÉU1҉t8ÐU`lÍvUSQXt'PRj Q P+g]ÍvPRj PPf]ÐUSQXt'PRj QPf]ÍvPRj 2PPf]ÐU@u1uÉ RiUWVS t| ;| @ f@fС,jp@ @P9(I(% f@ f@f С$lǀll@ P贚 @x l1;l1( 9fD9fDC;l}e~ԡۋ )R81fD8fD1@xt9 fDdC;l|v1ҍe[^_ÿkK f<t f f|t fD f|.fD"vC=UWVSEfU Mx؉];p| e[^_Ë50ff ‰El9| fu9ډU| fuME M(]fXf9ECEvus(E1Ct hAC9|C%9ufFf+9fNEAC9}}t uEE C;Ep5(MUf PhʋE9Bt$Bx lukZ1e[^_f3҉Ul9Uf9щMfbF9fNfNhFU܍RTRTRPURTRTRPu=$Ppd1UWVS,E] }Ef]f}fE AU]fO;5l@f}4f})f}f}f}AxUfUf]f} vMBf9MEf]~f}fEf9E~UfUډً]f9]}f;M}MEډEԸgfff)‹EfPf9Mf1+EԍUfBf9Mf9MUE)Ѝ@+}ԙhhȉffEfHe[^_áv f f| MfLPu1멃 EPEPEPVPIb1x+Eڍ+Uԍff@UE)Ѝ@+}ԙHx UE)Ѝ@+}ԙvU@xÐU Q 1fzx;fzx4Qu+t u vtÉt˸vUWVSEf] u}xa; l}Vt IfBft IfDBft IfDBf[^1_É[^_ÉUSEfM ]xB;p}7t(fDPft(fPf1[Ív[UVSU Eҋ]EfEfEx|;p}tuxx rxV]fuff}tfEfEf]ft ËUfEf=t U@e[^Ð@eEPEPP LEPEPP] ffuff}gVujhlɐUMɋU tQ1ÐUWVSơ@H1ɉ~9tGI[^_ÐUVS@1ۀx tp @P~v9tCJ[^ÍvUWVS|EEJ1~`8uE;M~ ]Ѓx-E x&StGTuMA@9~e[^_ËU 19W4uGM TMtsMA@9W\_0E G4ZU R]11ۍ #G@9~"EP(UG( F uڃ|ލe[^1_ÃX뒋U JxUMɋU tQ1ÍvUWVS }t G8Eu e[^_É PEfWƀuEEG4M@Y( fDfxCЋuG0Lw())xUG9}fFft994fFft"9|fWEƒE ;E}e[^_ÉfN݉fVƉ1USP]t,C8t%PCC0PC4Ps89 [8u׍v]ÍvUWVSEUB PBPB@PB@P>EMUfAfBfffQMfQMfAMfAMfAMfAMfA MfA MfAHMfAHMfA MfA MAMAMAMAMAMAMAMAMAMAMA MA MA$MA$MAMAMAMAA0A4A8MfA,MfA,MfA.MfA.MA怉EEuh1ۉE䐋UMB(Q(M<4EtfEMP(A(fDfDEP(A(fDfDEUB ;E}Ee[^_Íe[^1_ÐUWVS ut" t1vC9tڋue[^_ÅF uKEfVƀu;1Eƒ ;E|(F(t PjfVE ;E}؃ v(i$i;5tC;5t/;5t 1e[^_1tZ뱐U19‰tÅ~ÉUWVS uEEt E u 1e[^_Éj`jEU1tۃ]j uljC(fCUfBEHfCE HfCEfCUfS fAfCHfs CC 1Ҁ}SCCCCC C$CCC0C4C8fC,EHfC.fCfC@fCDfCBfCFE~+u N1ɋU{(fD9C(ft Ju }uUU A9t vCuFUS] E Pt&@0u t0 [É%鐋@ȉ 0ۀtÁ [UWVSE @uEu ؃} NVF0 Et0 E@V(fBf9~[fJf^A9}ffBfF.fN @f9~ff^tDjVou%vB9}fJf^A9|vfN1e[^_ÉfJlv^É Ёt߁ $ffF뵐 S3ExfNщUfЃ fEډUn  5UVЋE0 E ɋ^Fǁ\% t0 ЉEڍ@V(fBf9fJjViE4 VWfN @EF.9EEVUM~jV EUWVS,uE EE8@} NV;F0% Et0 E@V(fBf9fJf^A9fBfF.fN @f9~ff^vjV!؃@ SSEx'fNщUfЃ fE։UUvЋE0 E ɋ^Fǁt% t0 ЉE֍@V(fBfN9fJjV먐UWVS,uE EEB@} NVGF0#% Et0 E@V(fBf9fJf^A9fBfF.fN @f9~ff^vjV ؃@ S'Ex'fNщUfЃ fE։UUvЋE0 E ɋ^Fǁ% t0 ЉE֍@V(fBfZ9fJUSR];t0 Su{t @PC]ÍvCP]ÐUWVS }U t1ۄҋ5u_1F [^_Ðku@@ tԳUWVS }E t1ۄ5u_G [^_tvUSQ]C=wS1҉Z[ÉUMɊU t1HA$1ÉUMɋU tQ1ÍvUUtE B$ÉUM ѡɉt@u1Ív@t P1ÉUVSupw&9މt t#~ut`p tBe[^Ð@P@Ҹt RpS ue[^á@PP뺍vu@P4릍vU塸UP1ÉUWVS1҅ۉt C 9t1t[^_ÐStvUER,랉USS]t<@duRx4uf@4X5]1Ð@`tރ P < ˍv P & x4u뛉UMɋU tQ ‰ETÐU1҉t%JtRJTu tÉuڃy|t틉uÐU1҉t-Ru tJXu tÐUSPEt1 f@1҅u؋]ÐUSR]۸t SJ$>;t1]1퐐UWVS ]۸tvfS @ffsuo@uzf9C|tfKf9|k@S(fBf{tf9~frfKfJƋ C99v SN1e[^_Ðf9C~fS 낐e[^_ÐUSS1ۃ=d Cdt8`wdQP@4,PZ뽐]ÐUSuE:t!PjEPSPwx U9t:t]ÐUWVS u ]}=ftTӉUCt58tSu68FtJÊCuˀtStʉ봃j jqÉEFt|Sf@ t0vj jtqtbFt%Pf@ >uf{ ve[^_ÀT@؃j j*qCtÉE|CE SE<]u땐U1ÐUWVSEU @\DždXhOWTt 8/~ hs. QhPSFgBts󥍅hEhCt5< t<:uCt!< t<:tt9wʃvTt,Tt t u+ P+R R 9|vE1=wJ5t@5tÍF|PЊ=vߍ.<*u} FEt8$uF>Vr1Ʌu5tÍFLPЊ=vߍ. 1*%/(7}u}u#gfffӉ )S.^ j$U$<Ugfffщ )QBe[^_EF=w5t F|8Њv=.5 FF=w5t ÍLАF=5uFM *tFU h| juÐUUҋM t#B9|xB(If|ÍvÐUS]t#C1҃|C(f8u B 9}1[ø[ÐUWVSP}M ]txx fW9} Z[^_É9ˉ]~RI4:1}؋W(fD}G(tfWfTA 9M~fW9}vZ[^1_Ut uǀǀ`d`X@x@y XPÉUǀ`d`XHd@x@yXPÐU`dXPÉUǀǀB8% Bd BdHX XP%ÍvUǀHdHXXPÍvUHdXPÉU} t`dXEHdXEwUVSuMbЉ)ȉE)ƍjEPUxZe[1^ÐUM; t+ɸx1Bw9 tutáUMɸx1Bw9 tutUSXPPft؋]UVS]t/CuA S.;tO;tuэe[^É P- S-;uUWVSj|RƉt e[^_ÉэyvPWSV#Yf>|e[^_ÉUWVS<uƋU pE j|tnE +Cj|It8+9uЋ9ue[^_Ë@[UWVS,E}utu u8vQhjSf PWS@vq RTh%tnt Sփu SYǂ`UD4%u htAct$tu늅e[^_à hlbUWVS|EۈDžDž1utl;v23@tFB~ 73 Ph5@u~" $u-BHBxM t(=05j _u؋1~e[^_ÃRj SXҋDžYDžC((Džv 32z4r,ƅ$_=t]9t4PhV02t|0ƅuuWU1׹ PRPV{HVh*z_B0 9{(=1JK(DžS0p( ;SP>lC(t$@t$R.YC(HC(u܃SWYCC Co ߍjSiU*=\fK1fu "B9~C<ufKB9fK1fu &B9~C fuCр~{F)[^1҅t[^[1҉^ÉUEuÍvEEUEPQEBUWVSӋU҉t1t[^_ÐE[^_UWVSxEPe u38U5~|6 VK9MA$$;B}j|StDv)؃ ~!SPU9FtE@PhSeBj|^SuMA( Pv޿#7ti<EX( 5[V8C,UB(M@T4A( Poq XE0$@E =]Ctw@pPhVS|?_}XGHS?Gt$l1Gt@$qGt@$kGt@$xGt@$jGt@$mGt@$wGt@$umGt@$vQGt@ $t5Gt@ $n ju61e[^_ÉҸuP5q"d{9ljtpHOmt5 t8W5Ph>=tUt}2 =:t,P@A=5i V4}KWC }SG=H=@@t$56UY u܋G 1ۃ>tۃ4Xt#vCt4Xu j&!ƒ9zt 9zuB9uЉÅ=$P 5hu =Վlj 1=P PjhՎ5 ÃK]S fJgj+ƅU2% ƅ}_u(u,CuB]C f@DfPh&hSK4$2}WB_{8u?}G f@HfPh$hS4$B2WB8_s,e0MAx)MA f@Ff| Ph"hS3$1]SB,}C_vkglj 1=P Pjhkg]Ãh% @']Cx*N}_8 jiPƅt xm8j,Ьtw=+t8 t+1I9uWSR*uύvF@GlG EX4u# t4UBǀ ZuT}GxuH < u" h"/]S}_@b@[PhVSu7_UXBHS7YMALj\}ZGHkCXG@l-XGDmXGhnXG`qXGPtXGTuYGXvZG\wXGdx}4 Vx.WH$7Dt@HLt@uPt@dTt@SXt@B\t@1`t@ dt@ht@HYCdN@ h`u-MQHMSA=y56 R uP h{6UB f@ffPh8F6}}Gu)x&t#0S,UBZulx)SGB@2B+Ph VS4_}XGpST4b}Gx+x'UBu?B f@JfPh hS-$+MQ}W fzUB@}G4@?UC,UBZUBx%-4 C8}_MY; h  +MQ]C f@ƅ P*MQY P*W_]C f@FfGPh"hS/,$o*}WGA h K*]SlMSAY h&*MQBYVShdf3lh67ZYhv&ۉUCZt<Gt@SRkN S;1P6vhq6hbЊҍt$t1A@u Q&)]OSxu@뾋}G@MA(Ή Kj+v,袤uƅًFhv%m  VQ(WH$ā1GǀtSBS,BQh VS/XZUBpS07MAv h'MQBALGx*fBQC {PV5ƃs Eh=+5hƀ0MYx)rMA f@FfPh"hS($&]S}C_"S]C fP h0F%hvvv6h /v1m h$*&MQ<Y h$&W_Pv6hHZ/ah [^}_ hl/vv6h/ h"t%MQB,AYRv6hЂ. h";%MQA h$%MQB8Y h"$MQAYO] C,ZYPhGS,uOUBMAp,S,u ]C\ Vj$]SC< VJ$USP ɋ]t91 <|tBwu ]Ãhj;묉UWVS}E UEUtjtdUUÀ}ut vFGte8tEt@UMtv8t$AuGEuGu1[^_ËUt>tGtu݊럋E֐UWS(1҅t t e[_à hw}t1щу v뽉щу QtRShPS$ǃ hl,UWS]CuEuSCu`C umCuzCC 1e[_Ð Pt PsCt P_C t PKCt P7Cz PCm P 1e[_ÐUU$$ÐUEt E*hj99E*UMU tɉ  t ÍvUWVSuI EҸt. U;@ Ѝe[^_Ë ҉U 11ې9=dP5)PP ۣuE ыUYEE}= @< t< t}эQvE| 1| E| 8#:vMfD E 2e[^_ÃP56t̅ 5"QD = } USS]v9t@uY[UWVSuEEEsÉ9tjteE H9t]ti^tp\ tNF}E}X~}u h,q'E É9ue[^_Åt묃 t^u}%tÉw = Pc,%u SF#ZYPh˄&?߃u,_ÉF@ЃwzEE;É"@Ѓv+5 ShXZ&EE\Ѓ}]~]uEECjw$| Sl"ZYPh|&FiD4FJ h%5 , $   ^\:, h/& ;tB Z h&UWVS|EEEt< t)P$t؍e[^_øС$NP Ҹuá Et +Ev t t t\==: . S)%.Ph(b} P) P8E1 1t:uv/ t t tD4L=uE.t t t: Sw Ph(hȃ ##==|-|F=EF :,\ÈFà P^1҃Ft3 S'%uС_tF:6#Gt$}u S&[_Ph!}t%e[^_M t t t$ EPVƃǐD4E;V= }1эy R&%@t*Ot1E8w֡D4׾OE<8,:vuN< t< t<,tFj|5#X 5& j|5Ĥ }u8u h&_ ||9sPӁvX R%%@1/lSh;k8F9r|D4,Fhj.|||1ы||:1эt=@A9t&}u SZ P5hv,911 P#%t#\.FNw'=wӡD4D5PjEPuV }u@E9u5hB5E8u 9t hZ=7 hl} h(=|}ShLэv} h||PVr}u9t hZB5g hUWVS }1KCȄuљE u,fC fx,M @W38uՍe[^_Íe[^1_ÐUWVS u} L v L9v#9{u3u7uڍe[^_Íe[^1_ÐU}`u`ÍvU}uÐUt Ív huЃ hlUWVS ֋)ЉE1E);v#PRvt*UVS1эeD[^_à hl vUut0ÉH@É hUWVS 1\#^οЁvz R%ty,tr'tm\th:tcã    'xe[^_ÐD4%uEcã<  f1f0 غ   }e[^_Ív@у3%0%$} Ҿ\οfЍffʍf(ƒ0 غ \ã'fҍf0  +ãv@ƿ5 @tGсvUWVS 5ljtv9u}K=t7w0vZ K iuϋ t~{tB=2e[^_á1@@gHe[^_f?f6 h3l hk Kue[^_UWVS ] }1ۣ =v.%3Co%CNwK$d5tȉލv=w 5u *t.uC ݊<3]<2&  %yKuPPPvZYPhD P1  C сw 5uӀ*t΀.tɺ  e[^_ÍvC   J  e[^_á %빺zK KϺ5빡@uh@uh2l@`uhFHa\%[úZi*ú_ :  =+-*/úd gpq}d5úúcC&u tVE9tO\tW$t%  EVE̋u tE U tu9u1}ue[^_ÉU B<^t<,uE u   EE룋E x}vE NjE x%u%]S}Whu ݳURWhu 迳mS]Shu 衳#URShu 胳EPEPh@u bPWhu GHmWShu .HTgu Pu E؃E },+EvE̋E x/XvЁw 5u<.t<*uKM u <<  E CE̊Ёw 5u<.t<*tTj;u ZE uUEu Eej;u YE uUEzE̋E 8EyE̋U j+u E EAE̊EЉUEIEK;$]j;u )Tj;u M=5U=58E /U_u u.EԃE }ZE  E 2E U Ã%Nw$ Ë EEU \E U 121aT5j %5t(E   EE̋E =v΃Ph8}#d낉 %u]܅>E5u EEEUSP]KfC,fC'fC fC"fC$fC&S Ctd1f{tCCB91f{tvC fPCB91f{ tCC B9]à hxC뇃 jNC k j,CK hUVShjuetQhVP -XZVSe[^ÉUWVS U1ˋ5Ӎ=v5e[^_ÃRP 5e[^_ÉUWVS E ug=)P`F 1ۃ~;NDŽC9~$t0+PC9މN(1ۃ~4V,DŽhC 9~t+PhC 9 5FR55P+F``1ۃf~ u<;FVCF 9~!uًFF C9gV$F"V&Љ`19Dž\}S=PV1 DD\P)DDC;`| \Fo1;`Dž\}TVvF\PF4q V<1C\;`|~(1ۅ~3V,FC 9^(~huC 9^(ve[^_DŽ 6fV 1ۃf҉t0Ftt PVfV vC9ЋN(1ۃ~0 C 9~"G,u jsG,N(C 9ރ vvF hl|UWVSu V}WfV1Ƀfu0HA9~FuGfVA9f^1ft'vF Ht`t G fHf^A9f^ 1ft"Ft=t Gf^ A9ߍe[^_ÍvGfV끍vG fH롐GUS ]j/St@]Ð؋]ÐUvUWVS] uSV1҅x e[^_Ãt .8te[^_1IwڃVS$St9tjS댉fDž.vUSQT1҅tZ[É1ۅuډZ[t됐UEUWVS U ҋ](} 1} у Q4E"U FBU ؃"\w.D4% v  Ӂ R%C@~\F^FU BU >"FEe[^_à S%O~뺉\^~뫍~\Fn~\Fr~\FbPShV*1э|1^~\Fe룡D4$Uuj ÐUUҋM t JEHɉBtUu juÉUM EQPQPÐUWSU ҋ]t11эyC9vKu)Ce[_Ðe[1_ÍvRQ{C͍vUWSU ҋ]t11эyC9v u)Ce[_Ée[1_ÍvRQ"CCȐUEÍvUSR]t#tPhS5]ÉhjčvUuPuÐU=tÍvP5h5UxQPh57xRPh5t8uE5j:dXZ5j U E Pu5购YX5j 1QPh5U 5h5xRPh5rxQPh5Tt8uO5j:YX5j  E Pu5XZ5j l$ RPh5뚐U 5h5xQPh5xRPh5t8uO5j:XZ5j  E Pu5YX5j $ QPh5뚐UWVS ]EU}1~F~BE 0U2|[~qU U UOFȋUUUFKO~U U UFOe[^_ÐUUUKFlfUUEFE KOKvUWVS ƉӋ}WPtKe[^1_ðe[^_ÍvUWVSƉUfx"f^$ӍN&;EUEf)fFfFPv FF"HUEF)ЉEӉKx9 M4FU5rFU‹MEMKyNjEfF"f^$;E E f)fFfFPv F M F$VH)ʉEUˉKxAM  M4FUEEMMV fBKfJyE fF$fV&;EEf)fF fF Pvq MFV F&H)ʃKEUx[E E؋U<EEMMVًKx, 7FUűUڋFKyԋMfN&e[^_ËEF]UڋF fPUt ~"t 1Ð@"ÉP"@$Ív1t1ۉU҉tJtQ$@"Q&É@"ÉP"@$ÍvUWVS UUzËU9Ésv4utC9re[^_Íe[^_ÍvUVSËEt$Ht5C&K S$)C")[^ÍvCS")[^ÉCS$)UWVSu9ǃ1xGV$F"V&\ VDA9|u]}Zt~z}tBe[^_fVX9߉}vV fDJfJA9|fVBfN$fFfV X9߉}VDA9|fV BfN&fF 댋EufVX9߉}VD  A9|fVBfN"fFRUWVSƋEUE‰ËUEV$F"V&T;]Us#~v4u*tj|C;]rEPvFMI VDI9wFUuډ}[to~*}e[^_ËUUe[^_MufF@fFfF"PvFFH VD  I9wfF@fFfF$Pv NF FHvV fDJfJI9we[^_fF @fF fF&PvFF H VDI9we[^_ÉUWVS ÉU@"S$fS&EEu9ƉEC<C +E)ЍS0e[^_øe+Mk]EEUEqh3j>h\hxh>j=h\hwxrhMjUVS u贇ƃt,j=V賊t!Rj@PV"É4$Ġ؍e[^à V負鐐UWVS Hɋ}ujxt^ZxLƃ:VWIx:D;upe[^_É pHE ;M} Cx:-txe[^_ÉBZ-xLtC5LLxj-W1Itf-L- zuA py;tzD pAxpptңpt*?:t%5L  Ph5觵e[^?_Ë pA;M p|5x?::ttV 轂 Ph뜋U D;VWt$ |$L$tfffIutCffffffffffffffffffffffffIu_^ÐWV|$ t$L$uL$u1^_ù))GV)^_ÐWV|$ t$L$u L$^_ v7̀rϐUEUEUEUEÍvUEUvUEUUWVSLӉBiEԉ];vtEE<%EЁvo R%@uj Rs%@t'Ft Ӂw١D4%@u܍vU{uEe[^_áD4%@uF:]tE1EEEEy$=w5tE]܅Et5t/=w%5tEM܍Ë]܍TPFۉUu˃}hU}GE68/Sj EPVx8"~ ]8uEPuyE UEԃu u}}ԋ1׉IPQRVMJ Eԋ1׉IPQRVMۂSUB Dt }GEu܊=5E}܅Et5t/=w%5tEM܍}ÍTPFUuˋEH UBWЁ= R%@N R%@8E}0Ӂw̡D4=25$EE܅Et5t/=w%5tEMÍTPЋEFUuˀ}H}k} U}WvЁg R%@ R%@8EE0Ӂw̡D4̓}ԋu uXEE}BE} wjE؅uUԋED01ۉEǹIPQuVM>t0EUԋEعIPQuMVu} EUBu܋}u Ri%EEU5Ёw̡D4̓}ԋu u>UE}ԋUT|1UIWQRVMBt7UԋED`Elj1IRQuVMt E}v}}EUBu=^5PEE܅Et5t/=w%5t}M܍TPЋEFUuˋEH=mUB}0=5EE܅Et5t/=w%5t}M܍TPЋEFUu˃}wEUB 1Ё RY%@ R>%@E}Ӂw̡D4=5EE܅Et5t/=w%5tEMÍTPЋEFUu˃}5/Ё# Rv%@& R[%@EUӁw̡D4F% }ԃ(:Ӂ R%@|=51}Y|}E0t/=w%5tEÍTPЉUMFM܅uˀ}Y}yUCU}WЁ8 R%%@L R %@EEӁw̡D4͋Eԃ=5Ã0EE}xЁ% Rj%@ RO%@EUӁw̡D4ͅE؅=Eu uM؅uu uSӁ+ R%@J=o5aEE܅Et5t/=w%5tEMÍTPЋEFUuˀ}M@}<EU5Ё R%@w R%@E}xӁw̡D4̓u uau u4EUԋ1߹IPQSMVxEx (UBu}E9u])C)č|$PSVW}3;Jjgǹu8uE uES5PuuqUB uϡD4"D4D4D4D4D4D4<5Tu}G u?D4D4};U}Wml[}DQEdH8vUVSMEU uEQVtMu e[^Ð VEXZVEP討e[^US]fEfEBh}EEEEEDžDžDžDžDžRhj P uu EPDxEE]à uH ]UU uPRuUjjjuÐUVS$ҋu+CHCx8Uu$uJe[^Ð SWCHCyɐ;C|} uSuơ$tv Se[^ÐUVS$ҋ]u&CHCx30@$u:e[^Ð SCHCyΐ Sơ$tǐ S[e[^ÐUVS$uu^ u)e[^à VW^ $tؐ Ve[^ÐUSQ$ҋ]u"fc $u]Ív]] SАUWVSL]ـ} utytv9t ut"r}W1R1˅t9vPRue[^_átYwsth u⿪ PFPRuǶED0RQh}WE_tWPhEP}!BېUKvU+vUϑvUEPu hhuE#U鯑vUUSR5 3>Xs5StC B C Su]ÍvUWVSPljpE SpE j螉3WtT[uEEF1Ct SP C t VG1e[^_Åt s+ECMtǃ u뷃 u_ 묃 u[uڈUSRhMSt8t]ÐUWVS,DžMvh?P1trQhP舟E1эр) tgu Dže[^_à hbF hJ6ээhƄ)Pƿt޿uYDž!t~ DžvtquDž냍ƍttrډ0%Dž  ڋ@  U u1_1vUSS]Cu S茅1]Ð P{ So1]UWVSju=ǃ t, u kGZt1щ 1e[^_à R vUEpkU  ÐUWVS 1} IuwN j艄Ãۉ t4 h lCxt u p 1e[^_à PL vUWVS }u t93Vt5[ube[^_ø1te[^_ËCE }e[^_UhuqÍvUh uYÍvUhuAÍvUhu)ÍvUWVS,,Z0<[ Ph5HX\Pjh4Dž1Q}ىQu4[}ى Qu4=}ى Qu4 jS4H1WjS4HuPjSj uԋ M1n1ۃ d``}=5j+jh늃 PR Ph5։ d[0Y Ph5覉8VjRj[4+1Z0AYPE0h5H5j*jh0X@[0X Ph5DžvU juuuuE PucÐUWVSlxƅPjjjhVRSl 1҅t e[^_}CEEDžPEPh uU1҅u ƅPjjjhSww&l uσSVu h@@ C {}EEC]؉Ev e[^1҉_ÉUWVSdP}Dž\DžXt DždPjjjhhPuu .k tƅhPWhhP葇Rj hVh< t<#t< p< s< ráTv= PE%t= PTˆF 9 > 'u`h+-5 hPUE X`ƒ+-CXҋ`uEPu{\X\r1vTD4T4GHG6@ $B5$tσ Wƒ1ې t vF t t `  F< < < |uh+xiDžX<@UhDžXhdjhPjPhzB`DžXƒ+8`BDž\^<@`@Pu譿-i@ht&djhRjPye[^_ËXu`Bt<@`@Pu)밊h5 . 'i PUE :r i W6ƒdujPy\:du`jPxUWVShjh]Pu }$tluQƅiƅhpFtFxF | uuhPhPue[^_Ãuƅiƅhl붸ύvUW }1uuE jEEPuEE2}ÐUWVS} Pu uPWE1Džu<GPbEt;BEt0 uuu RW | WXu E uDžLpV膥1IDŽ /.rhDostsDËXr}r_Xh?VDlj$frte]SVxzE%= $SW4ZPp W`e[^_Ãh?h ǃ1 W`¸F<݃ W|1맸_ɐUW }1uuEu EjEPEE}ÐUWVS1}ȹtmdX*\@,8uY<<ۃ-1Q5$蒭$tV$@P$EEe[^_ÐEEe[^_葚EEe[^_2|]2\܉]2\(]2\`]2E2E2E2Ewn2Ed[2EQEjj j.PtbFu 2E@ E@E@EL@⸔މtbމjEh^)pV.;D$L$A,tAPjjP L$T$QYai qyy1ÐT$z,tjBPj T$D$JZbj rzju@L$ÐL$APjjת L$T$QYai qyy1ËT$jBPj裪 T$D$JZbj rzju@L$ÐUjuu u0UWVS }u] y{D4%u]$tX-tS_tN.tI+tD!t?*t:'t5(t0)t+,t&%FS\~]PjVqux S#%u;u t"u t tACCF\e[^_Ív*t?t[t #pt< w7$` S苟vD4R \뉐؃ t&vV SI%u tT\0FF0؃F0Fe[^_ÍvD4뫐@\FՃ@tPyMF S輞%^FC@u?F뎃 \F\FsFm\FrF`\FfFS\FvFF\FnF9\FtF,\FbF\FaF\F0E0F<80F0F-FFD4(UWVS ] MҋutCPVPQue[)^_ÉUWVS ]Mu }MvvFPWRQKwu+Me[^_jWPQh+Me[^_ÐUWVS M}] ut"Bw0e[^_Ív$@$e[^P_Á4tE1v`CPVt0SVШtIE }vɃ}ue[^_Ëht*Mt܋dU }\ˉht֋] tdU ԍe[^1_US ]j/St @]É]ÐUWVSu %I@EMgt.v6- +f qguՉ8ou%AEtEt]tf#A!tf#A!ƃt f#Q!֍vUkt f#A t f#A ƃ@f#y 5XuE f q[^_fA!ƃ(UVSg]u Et;-=Xuۈt!fA[A^Ðotuuۈt:%Ѓ uXt+AfAuI[A^Ív+AfAt-tI=uI돍v+s-hv룍v-u fQ+AIHUWVSl}E1? ]S螘uȃ VSj'$]fE$] fUjVjE$ REU1EEE=v:EÃgtnaM GÃguM8G5tPjEPW(‹Eă8u xt| uDR1e[^_ÉotuuM G돃MG놐G+t8-t3=sEe1EX wa$D =uU9Urj0uQ%EEEPVh=EBEEe[^_Ð=V]t^U9Ur8E]SubQE+EЍ\EU]EPuuXEE ,G6vIGvΒGtbE9Er>EUURuPE+EЉEEDUEEPVuӋE&E1 =@+ZU9Ur>EEEPuSPE+EЉEEDUEEPPuEG EvEt EMGEt E G$GGEI=t|U9Ur>EEEPuOE+EЉEEDUEEPVuӋE EEEExEU9Ur:EEEPuNtBE+EЉEEDUEEPuuXEM EE/M< uuN1)E}Ѓ+t&-t!XtЃ+u1E1Ѓ-t$+t2Xu<A!Ѓ ÊЃ-uA E!!ÃA !E!Ut-GUfWt+GfwDXGf_1 uM=UWVSM1jh'|x@uEDž|Džx pPk HhDžlDžhLj PSjߒ (RSj͒ QSj軒 PSj詒 RSj藒 QSj腒 PSjsXZUR|2 }uEueEMPQj|P}1IQuxE U|ƃvPjQ|H  9sEt ؃Ӂ R%tTEt#Ӂ RvEt%Ӂ\ RiÉPjQ|-FH1lEG,u}]QHjRjǐ (jQj贐 jPj衐 jRj莐 jQj{ jPjh jRjU|PPd$HtD4]44e 1}}WjhS:x蚪u,}EVPj|Q |G 貪E te[^_藪1e[^_肪1UjhhuzuÐUEÐUWVS }?)Ѝ9    W+ t:FSj0^S-tFU ҍ^t8Fu1e[^1_ÍvFWh:j^STM 1u؍e[^_É~u m j' PUWVS }?)Ѝ9@ @ @ W{^@ t:FQj0^S=sFE ^t8Fu1e[^1_ÍvFWh:j^SdU 1u؍e[^_É~u@m jb[@PUVS(j+u j_EE O EP-W1҅ j FEEE$EWEWEVd$E 8ru uYu U܉rZ$uPHU܉$Hu e[^à hD胞 hD?Sv hD'랉 hDCE 8rQPuXuNEU MI d= d?UBс Rf %%u~ƉuDž|] u΅xt/v8t'CCfCC| u׍v t{Fuuxɋ] thx:t]Mt3tu*FCFCfFfCFC||~ t8u quu軗|e[^_ÃdUBс tIt:f t1%`odiƋ`R`8?UU1Ɂ:ELFtËB%=ufzuzuÉUWVS@jjj}WDžDDž@Dž<Dž8Dž0!1@tQj4SW4t e[^_SFZtHPWxֿ(ؿ(1SR(ȿPWjj(j=$ $t$,ؿ1҃~#Ë,1ɉ8B((91QRDPWjjB u ue[^_hpy j+ܿPYܿAܿPiU9WӃQ uߍAFؿ]_[G!ؿ1҉W- Fu%^]t-G1҃W]uJ ]<% PƒҋYrt Pu݃t,$븸!GvUWVS, Ë{ CuC} C {uSW9uGDžyQI ЉtJЃ[ ЋN] t u uމN u‹uV  ue[^_ËSC  ue[^_ÉЃ{ u lЃ} _iF9ЋK[ [Ѓ, ȍ{{9s QW9rFQщW uރ u{9.Džv߃ЋK] t uȃ t{뽍vЃ{ t%Ѓ} ȍ{u{{vUWVS E }uE@E E tUB`uDž` vDž`E ]C ECCE \RhjhP4E);|advhVjWS@t3dƋ\rE);\}\F}  `PUe[^_ÍvPhjhPlE)9|11?\tshPjWdP&@Yd ؋\S\ϋE+\911?\uG?uK\\C@\뿐@ `PUe[^_1۾@0e[^_ÐUWVS(jj]SjhZ  u%Et| jjSPhZ 98e19ˉM}-u}}䐃Vuxt2CE$$;]| u]%輆e[^_Ë} u u*%e[^1҉_à u%뿐USP Pɋ] T~(QSR5LZ,P1TI)9wkLuwI)ȃ TPs$LtbRS5TP+‰PxD@)9TvELP]É P+$ Pr1]Pjjj+P1]ÐUSRát=\\u1]Ðjh\*x 1ːUSP$uE $ɉu-؋]É hX{E` $ɉtӃ hX{؃]ÐUWP$u>E&‹Eu1;M ~FE"$uE}É hXG{밉 hXc{E}PQRumNUWVSh %t8uJ WPh jhp膫p1ыEIE e[^p_ÐPj EPS[|ot>U t zуMt/tGum@뻃muS9\؁= h kt?gtLSh 렃jh!뎃Kuȿqok@]U jjEPhjEPEEEYu @(!tÐUWVSQE1ۅt)1v׹эQ9vӃEEuZC[^_USSv [P| ۉu]ÉUVSut3CuC RA f{2y߃ S. FuaFuL v F$u& v*1ۃu9 v΀u@ V1e[^à P* v莀t VUUwE fP81ÍvπɸÉUE@(ÐUE@DÐUU EP(ÉUWVSl@$Ӎuur{,VS(fF fC0C@8.t:Cfx2xv9P(t@fx2ye[^_9x,uAHt .uxu%E9tPj`jV)xfF UU@DH vUSQPÍ=CvNCuC~?]Ív PKC~?ӍvPsXcC]ÐUWVS ]9XƉ|TN@uh jSvYN9KuAKBuBe[^_ÍC(FPvbFuFe[^_ÍvUWVS Ƌ}F$UGIu P/Ã1tWF$uZCHS@Cz0e[^_Qjju ;úyٍv Sy뿃 Si#ǃ롉UWVSTEUEUB$<ЃPEpj]E}UB$qEEEE}EUR$UċUBUĀ|/XEE@$t UP/BUEċE@U)ЉEUB2@EEEEEE؅ um*FEЋUB$ u ~. uЍVEEЋU9E<OEfC2UCEEfC$~oE̅dEefC4 ẺCUBCCEE܉XE]܋E؅EtVUJRB;B@t+BȉBJRuUfz2x&B;B@t+BȉBBJuBfz2yڋUB$tE9BEUEȅt(}tEu&Efx2UB$'}EX t }sEe[^_èUB,U9tkЃ,PEp@UB,Uǂ LɻLt%D3VguEUtE@0EB$ uEEEEjU2UEEEt }EfH6EvE̋UR$UċUBUĀ|/JUEt!}F<{vE@$CCfC4 CE{E]܉]xE}Ћ@׉EԍWEsUB;EtEB$tEĉEE@U)ЁE SE"^uq]Ef@4UJ$t?1e[^_ÐfK6fC4 ~ F%=. uЍVEtۋ0t SE~ u\UfB4EH$St01YUB$uOC@C jڋEfC4MɉBfv fMvC@@CCVC&@Ps@u$@E6M9 uUAEt u[sUBYEPhjE UfB4EH$1S}GU1fB49 r봃} UfB4sUB1EǀAEǀ/UWVS ] ۋ}t 7r1G%uOfF4f tR1fHu?Gf~2uF8/tG$t(ډbGe[^_ÍvVe[^_Vjjh6<1҅x̉ډ GVt1҅u VrqW렐fvO$fXq1iUWVS E@%K8fC8fS4fJv Pf~2fF8ftfEXFP$@|/Lt /WF&@PAv@QJ=U2e[^_ètVhjE.TEH$1e[^_fS4Bf/ jڋEfC4fHu+UB$u"Wjjh6臸C 5fK6؍e[^_ÃtxMQ$@ueMAjsjڋEuMAƋE@ jڋEPfC4A 9C,tC6UBfC4V pP@f~2HMV$Af~2A$1҃~¸f)fF4U[UB$u rF&fF$@QPv@Eph;XZj/v@t-9F@B1׹PQRYv@-;f^&UBFFF,B 2Q$E@EUBB%&F6UB$u v  v m jEfF4fHtQfF8 MAL s ~m+x qLMA$uPjjh6׵F fN6m v mmMI$}mCfK6Ur[F@Fvu@ V @mMp'mCfC4mFfF4UEt3RhPh`B7_@`É@A!É UɉA!t@ÍvUWV@5(eHte^_ÐPheHPu݀/th/devf/PhF^_EPhuE%=`t = {$l뢍vU u Ð Pc ÉUWVS@jhL!j1Ek@߉у IQSjj jhLjj 5]hS9у IQSjjXu‰у IQRjzj jhS:jije[^_ÐU t0h?5@ tQߐuS hT!蚑$bh?5@ u;j1à P딐 j붐UWVSQ5 hh ` #tȀ tÃhMP9hQ:PWt8tޅۉ$x;#ovhQ:Q\Wt8tމ(vhQ:P,Wt8tމ,hQ:QWt8tޅۉ0S8<hQ:PVtJ8t PoP8vhQ:QVt8t P;P<50SBXZhIPhIQ0V1uο 70j40Q5 hh e[^_ÃhW_PaU$XZhW_QIU(^_hW_P,Uã40މ078¹ tX ,hW_PTt( PxN8Y[hW_QTuO +롃 P:N<e[^_4 t4474эvUSS][t,vt S5((Wu$]1]USP]t,vt S5$Vu$]1]U u ts$u1҉UWVS ӉƋtv3Vt'u=w 5ue[^1_Íe[)^_à VLe[^_ÍvUWVSuEPEPE_!E1҅Phjh`w]hDž4hEhUvKht@<|t<<:t8444B9ƉEvCM4<|uƉ4EWPhuMM 4οl!Sj:huŸt EQPhxuS@tUERPh&u-1@tUP|Phu1@t|PxPhu޻1@txPEPhv!uDEfdPpPhu腻@pPlPhy!u[@lhWPhu1@thdVPhvuf@td`SPhuf׺1@t`\QPhfuf譺1@t\fXRPh>Zu胺1@tXPTPhuZ1@tTPPPhu1@ tPPLPhއu1@tL`afEpxEfEbxEfEfxEfEoxEfEtxEChHPQEPu]]]]Ɉ]z@tċHHPQEPuXH FDPEPu91@tD҉VE EEPSj{?uE؋]US0]S>E EEPSjG?uE؋]US ]St>E$E.]Ð1̀SZv̀rÐ?Zv̀rÐ+Zv̀rÐZv̀rÐZv̀rÐYv̀rÐYv̀rÐYv̀rÐYv̀rÐYv̀rÐYv^̀rÐwYv]̀rÐcYv\̀rÐOYv[̀rÐ;YvÙrÐ'YvQ̀rÐYv0̀rÐXv/̀rÐXv̀rÐXv̀rÐXv̀rÐXv̀rÐXv̀rÐXv̀rÐsXv̀rÐ_Xv̀rÐKXv̀rÐ7Xv̀rÐ#Xv̀rÐXv̀rÐWv̀rÐWv̀rÐWv|̀rÐWv{̀rÐWvÙrÐWvQ̀rÐWvP̀rÐoWv=̀rÐ[Wv<̀rÐGWv9̀rÐ3Wv8̀rÐWv$̀rÐ Wv#̀rÐVv"̀rÐVv̀rÐVv̀rÐVv̀rÐVv̀rÐVv̀rÐVv ̀rÐkVv ̀rÐWVv ̀rÐUWVS,}1?] tjEDBv t"vЉ DC uC ЃDt),[^_UWVS<} R0%@t#7GwڡD4%@u݉<-+EE}Eu10LME"EEEE܅EEuEEERPuuEȉUwuuuuEdCUM̋UȃEUMčC< wK;M}SE؅x'E9EwrU9UwUE3U3E u};M~xEGC< vC<wN7;M|}BTM tU؅ҋEtGU EUe[^_ÐC<wWSEeUUEUċEЋUUЉEÉEEEMUUEGE0Q=te1عEPIuMty}1Ʌt"I;MrFBu1ɍe[^_F똋}Utv<=tBu+UM D P0tME0AMt<=EB@ɉEt=u=BFBu1g01vGu 9t^ ȃ PMTùPuS500 0D}PR-0 뾐UVSu]SVwtU0Btۃe[^ÐST$L$ 18uBu[ÐPv*̀rL$QYB̀rQPUS]9ډsvAtB9r[ÍvUS(PR]SMMu U]ÉUWVSEE UEEU$%t/]9]t}UBUEMuًEe[^_É11EE}Ãzw$@"MY xY$۸ uU Eع<RUPpuu$MIMWuuuUE8uEEEE.EPhHwMD|uUQ^EEP hHw܋]ɍuD0Ƌ] t}wlQЃu)ut.RuuuU<4gPuuuU]} GuuE UB ҉u uuډhM] C뤅PuuuUFu]u} *PuuuU E tUr+r$IEP}ҋ @)Ѝp$I鉅h )lMPu]ShH}D`UVuuuULEM|q]} G @EM0A (}G(@UB %ЃP]E]MCPlEPpUHlMdufEnE+E EJ)Ѓ}E9E$9MhNdufEn`Emz}W hHM]MC@@}M0A}0M}A @xuUS:]{ w}sMPPuuuU!UBuuE]UWRuuUEE}9EMAUld uUqUBSLE Nju P Ph]SuU[EmxFVgtcMuPuUrFU})ϸ$I)@띰E}E dHy] gUWVS u}EPEPE PEWUËEu19]t)e[^_à h,$sotփ5j QVh!5G5j#jhX$4'Etet65j jh!'XZ5j iW(5jjh"5jjh"&y5j jh0"랐US] ؃UUURhEEjEЍ PfEfEDžDžDžDžDž? uuEPۉtEЋ]ÍvtWLUWVS E"ЃU3B8e[^_ÐEP,1ۃ~ @(94ttC9EP41ۃ~@0949t}hC9E@$1ۃE~]UR U V!!uMC9]~9M %=uE#E EMy }^}3EM3G8^E #E EG<U1ۅuO}M4u(} uʣƒfto}t }^E U1EE^9^}E#E E1%=^E#E uƒ(M4_t9]t1Ӂ Ry%_t3с RA% _GGEU<tE܉E؋UX9ۋu}M9MPSuuU puuuuuuMU EEE܃ uU܋E9PQ11ۃ EESEBME Z$EEB?1xZ(,t=]Ӂ R%_GuWuuMU ED4gD4-D4 D4uUBRUBS E؍e[^_EUWVS] ;]EU}v]EQ%=X=HEA %=H w3=(t=tv];]|Ee[^_=hWW=XuԋEvFRuSPUE uuu‰ƋE;Eű}OPWCSVUE]eBu]ov=x!u%Ɖu%=u%Ɖu%=uEFRuSPUE uuu‰ƋE;EuC}]O]] 9t!]PWuVڋEu؋]QWuP=0E]=p=xnEFRuSPUE9 uuu‰ƋE!;Eu̍CEU@%|PWuVUE9tAG_]UP%Nj%=uOPWuVUE9uPWuVU萋E,]uA%EN]E+C ƋSt]eE]PE+C Dt ]8QWSVUEuUWVS\E؉UЋE U9EE}cM؃8M}؋EQ%=0wZ=we=EMEE9E|U9UEuEЉE܋E܍e[^_É=)ws=`u벉= =(uM9Mz]؉ȃ8S+EPuЍEPUƒE҉EtBMЃ}-v=:=*}؋_;]';]UЊ< Ёf RG%_}ЋM9yGЁE R%}_5}9}ttދ]8q +ESPuЍEPTƒE҉EtB$]MЃt&*3F8E7~<ډEuH S`ƒpu#44MtEEvEMv]}%=ufEЋ}9Gu}ЋU9z. $AډPhjSGE}؋G;EU؋Z;]v }Ѐ ;EEЊ@ЁE  R%}_;]wMЊӁ R%b_Y_t9]t1Ӂ Ra%_t3с R)% _GGEU<tE؉EԋUX9ۋu}M9MPSuu U puu uuuuMU EEE؃ uM؋U9J)11ۃ EEVEBPE Z$HEBB1xZ(/t=]Ӂ R%_GuWuuMU ED4gD4-D4 D4uPhju% E%UBFUBEԍe[^_EUWVS,] ;]EUU8EЉE[v=HEA %=H=(=Sv];]u]EQ%=Xv=xuu%Ɖu%=iu%Ɖu%=uEEFVuSPU܋E uuu‰ƋE;EuC}]O]܉] 9t!]ԉQWuVڋEu؋]RWuP=h=XEvFRuSPU܋El uuu‰ƋET;Eű}OPWCSVU܋E]5u܋];]E܍e[^_=0iEu+EPu܍EPC¹t@MM/=p=xEFVuSPU܋E uuu‰ƋE;Eu̍CE؋U@%|QWuVU܋EQ9tAG_]؋UP%Nj%=uOQWuVU܋E9uRWuVU܋EuQA%E]E+C ƋStEP]E+C Dt Qhju2MPWSVU܋ECu%Eu+EPu܍EPA¹Q@CShju뎐UWVSEH 8eU]u9Ete[^_ÐF u=d~GFFt Dž UM  u r9sI,ɉhN4dv8WGƒ ҉$tBh(lI9ɉދu 11 C  $ T i t)~'vSWS(N܃t> R%uJ_tA$t6с RH% _ vt; R% _ G < 9 (RpS (pSS$(m$9<Dž$ G@WGt DžxMu 1} y9v,hO4w8GE F9*v,hO4w8G||S R%uJ|_tA t6с R`%_v|t;| R%|_G<9(RpS (pSS (Ã} 1ыE LDžvtB$8Ё R%_SWS(Ãl@$l r$lA1xlp(D4WtB GЁ R-%_ D4}SWS(ÃtA1xtp(t@tr$VD4X,,`D4D4,y,>t@BӁ R%_DžDž LVV(脼ƃD4 (B1Z((BDžZ$rCD46D4@1< uGD@v@@P(@<)pRPP/t@wPhjpo0 D~ Li1&QhjpDž$n 0 (;p@v 7v0DD DF(;p@v̋rDu - AH~ D ~D j@S(`@9PCP(jS@(tt(4@))Ӊދ}O_w ; M30DADAD A F;(;p@vAAA ŋU 1эLD4}Dž,(.,(Džax@<;Fu1 u"@Duv@B@P(t̃0(;p@v 60DD DF(;p@v̋qDu - FH~ D~D j@S(I`@9JPCP(!jS@(tt(4@))ӉƉߋMqYy ";M30DADAD A F;(;p@vAAA šD4D4r9ʉs\h9s68u܋)ȋV<9|lj9ҋhu9Y9ʉsZh9s68u܋)ȋV<9|lj9ҋhu9d@Gu1`u!@Du@B@P(起t̃#0(;p@v 60DD DF(;p@v̋qDu -FH~ D[~Dj@S(}`@9PCP(袶jS@(tt(4@))ӉƉߋMqYy ;M30DADAD A F;(;p@vAAA šD4'@)pPRP%¹t@+@K+h9d PqE 1} ыU Lx P赍(p+PP$¹t@1 (@@ P.0 L% xD@G20xDd PS+h9d PqDFH(@@ PB0*zD@Dž$ PDFHR@GQ@S(6DDž (@@ P_0 !zD9ʉsZh9s68u܋)ȋV<9|lj9ҋhu9F{Q@S(' PhDFHDž PWwQ@S(褴r+h9}QdAPhjpLPhjp,[뭋0ucDuK L蝉W 0肉G0u:Dt̃ P뾃 PW맃 PI돃 0 P-;h;hU;hUWVS E"ЃU3B8e[^_ÐEP,1ۃ~ @(94ttC9EP41ۃ~@0949t}hC9E@$1ۃE~]UR U V!uMC9]~9MEREMԋA@t }G<EԋP9ӉU;^u;];]@;];-;]]C;Es -;]s-[c1ƒ:r=KEUԋJ9ˉƉMs ;-98-99r}ԋGE;]@;]s CMԉ;]t E]}ԋG|EЋ@811ҐMу}3G8tCUB~KU`EЃx,-MԋAx )}Ѓ }uк0e[^_à SUЋEC9~C1;ESƒ:}ԉ;] -]]̋UԋRU R貺%t(CMԉ;]swաD4%u؉+ũPVu̍]S~D5$A'1ۃu!e S;!u C2wݡD4!t SUЋEC~΋}ЋG$Pw z}.EЉP MЋA$4A$}ԋG9ÉE8W9ӉUUЋB4Pr0 }EЉP0MЋA4‹Q4A0 GDH Spw9sP8) j GH G@({B9B=5|BE܅~Ã+*w9FC<v6?t1{/B9$B=5 /w9GE؋E9EO9`:|WBMG +EPGP+EUPUGEXZjv?{Ƌ;Gs 8,WSVU؉Tw9x:}YB9bx}u ,v Ã+vu؋G+E@PHVG+EغP$uG+E@Px)UUUE j(h7u؋G+E@PHG+E؉$P [^u؋G+E@PXG+E؉$`P@=w5SVU؉w9 8w9Et{e[^_Ãu؋G+E@PxG+E؉$4G+EPU؉tjWJjSjG+EPU3G+EPe[^_Bh#9Ɖf UUWVSUƋ@EEEN19:^9B9s ;E5:B\)6.E*dJ‰QN9s*eB9s \$t1E9ʋFEY!E9EQe[^_Ð{ugXЋDH S8IXT BtH$@)F@D"v9ʉ):B)}ރ[(F@@FX@  ShN9s$B9s :\ j)\ FDH SpDN9FB9;:\2z)(B;EMF@t>  j(~M |ME F jjFH F@(FEE9Epe[^_Àz{ZNjN9s 8,5SWUN9aB9s :\n9IB9s :\BFD  BjFH F@$FENBuF+E@PHF+E$PJXZuF+E@PXF+E$`NI .z}* NP9ʉs@=w 5u 9lj v 돀z) z}vUWVSQUBƸ11ҋ%=`=%=pt\w=0tw1=t=(uLB@=t9w'=xtD=u29~듐=Xt-=h=t =u kZ[^_É=tv4%=`t=t=u%=`t=uă뗍v9~׋UZ[^_ÉUWVSLE$t  "1} эq jLhú UD@ EPhEE } 7|]xEE1DD@ ~C C KC C$C(C,C0C4C8C<C@CDxjEHCU|9xrxxux|9xrڃ jxqUBC^_SRugCEX=~5'׉2DžDžC0= ==9K<}%K<S0DžDž%=XZ=xP=ht1=`^9S<S<C0YUB;E rQ+u tK CHEC@UBZ eC e[^_É <7%=`t=t=uF%=`=u9S<|kK EK<~-C8C4}11DžK=Pt(%=HuF;~N=0[=(n9C<C<C0v== u0}+ x}{AxxMK<oC0UC<C0Mp jxlr=2=p-l==H䋕S0CPPhPI9K<K<@S0 h2bDC4S4C<A~s<1)C, 8S4FGs<9UC< PaC< PaC8DžK<& +S8HAK<;؉OΉp94~9S,28:t(+{8A9~Љ4K<9N륋C0Q AP`C,PhjPKPUrh})5nvWhph }$ 2 h)txH P Ph)5n! h)6xQuh)у h*V}7 cuuuoUB EW8tEj/u$uhWUtPRu/"觸Z0=Puh) jHj/uo juuh#}7UU *w`ÐUSPU] v R@!؃]ÉD4!؅]UVShh4,hPu1 VPt Chu㋄le[^ÐUWVShh&ԑPh茨uG~ۍe[^&_1v&fǁ&/Sh& ő`~ʍe[^&_ÐUS5 t18t,t8u ht8u]à 4UWSt 1e[_à h,tNuEу+?w S;u7 u-{UWVS %.%Ut*j/Wt+ϵ1ҍe[^_ÐGt<.uˀt褵E蓵茵1҅uUw$-buW}Ut WӃ1@zWu}Uf@뽻D붻믻d먻y롉UWVS EEu  vP%P  Kyu %lj1IRVC贎 ~ɻ vP%P膎+C ~ύe[^_sMj/V%x/@E %vtG)@RPVuJ~E Cu$P%PC襍 ~GGVS G%~U h'jjhh'h'u u 't'u 'É'ۋ'U҉帨'u<-ÐUUjjujÐUWU1EEDž|hIQR|P}WjEP  x%uuu|u PW|}ÐUWVSMɋE EODžd}lj+EPuu?E8/t)Ɖ1э|19vFO9rEe[^_Ív GDž`hNwX-\Xp.XEBPheHUElh貯DžtURXXUE9lx|1p;\rE`㉝`SX XJÉp\9sp.@.@ pXږEUR0袧p/@p|19Uv uUEx.ux tۋ@%=.tQUB@PЃpPy`XZEPX$뀋x9h uǢEuuۉ‰u׭dҋEt u X@L蟭1e[^_Ív|9Ux9Eg7 DždhKEU1} uKN@98d+UѥdTdu谑)EdTPS)PVÉ^EtP+Mu9sN/EPRP)VEP^[u踔pEDžt9hN/)PWuVE^[XJ1["1I߫"tQBUWS]tH1 эAQ'J'tKSP'轅1e[_á'u''ؐ PI9 UWVSu }Mt2A:u8t,u@t:t.9uA9@t[^_1[^_Ð1ۄt@A8tĄt:u[^_ÉUVSu t4>Mt,t+BA8tItv<:t A<|tۊu[^Ê<|t<:tu[1^ÍvU'u%'''1Ív Ps''''1UWVS j=u uà ۸ jd>H_Ed:tItE^td\twCAMu)FdPWI%Ed: 0uvA)}XE8؍e[^_C<:tՄt뎃 >XuF%Dž1IjRQR t(H8uI@H뱃 S>Dž R @S=81Ӊ$= SPXQ{x0;0s SO=DžF V4=vUWVS'} u=' '5't'P5'߀:DЁ Ry%@1|3\''x'j'Í؊t:\t @FuP5'=D뱐D4%@^:Q#D '61|3\'X''5$X  5' ''B'Z-h?rQ'e[^_à PÃt:nh?0멡'$X  5'>'ntǛ\:F|t:t @Au jjRjWEÍ@ vCe[^_1C PÃ1('vUVSu] ] u[^jUjjujEu UÐUVSuU} ЋAu")čD$Ãt;E VC AuP50Sue[^] UVSuU} ЋAu")čD$Ãt7E VC AuV2Sue[^ٙ U 50u uÉUWVSj/uDž|!xE81} у)̍D$eu PyshLS:1}Dž6ѾyD>=Wjh.jO Vj> jh'.j-hLS|n|de[^_Ð11q}эyD>=PSVS2J W\3SƄ5/uJEƄ8Q50ux?w,$H.ExDž蘗 /舗0PxM8 Dž| U1: @UuB&)čD$ÃWxCPRCPEP I 50ShWzӖ jÖ0^UhCܽtRu PuÉRu 8.PuUVSuU} ЋAu")čD$Ãt7E VC AuSuYe[^  vF̀rÐϕv̀rÐ黕v;̀rÐ駕v̀rÐ铕v̀rÐv̀rÐUEPj Ð(U҉'u`0ÍvU h'j:j:h,h(h(uiUWVS E8ete[^_ËX t;EuCu}C tRK117C t0e3ZC t(X3XC t GJ3@9{˃ s 43C,uAC4u'C8uA]e[^_ 3 P3r -P2ƃ P2뱃 P2뱐UWVS,ubu)th(u51PnX؉ZfDŽ)/uP6nY_h?IPDŽ /LC_DŽ CTYPfDŽ EHp PAs Ss˃H1A,A(ރ'M1Q1Y1`1d1޿i18»O 0t h1e[^_É)))) ))밃 _=)t+M1 5)/))))u) )h().k Jɐҳ踐謐OuL S  a P0뫃 L .  sUWVSE]DžlP $nCP蓈1҅-E=7 2 P.1҅D胏 S:o#SjuD1HDEDE8 q1|DD4 ȉ4 D( ʉ( D, ɉX, D0 ˉ0 1DD(ȉD((ȉ((ȉ(F~Nj||xR4}9||tI| u9||[ ]9ىp|1x SʋCȅ SCuB)ʉh|B<lЋU9׉|ah ȉJFD 9( , X1X~.tȉBȉBBȉBFD 9, ؋D0 1~0pȉBȉBBȉBDF0 9֋D4 |:;EfD, ( ȋl T P8+EgE}T RuneGMagiL DǃE@0D4 MP ( 4 , T< 0 }D 1DD(}D4(4(4F~ʋL d8 d@ TЉH ЉL pI1|dDžPDžLHPx ;HT;PD;HC)ʉC\|`|ً]L HG ЉL \!Ld`D KFLHP U94 ;< T]1T@ ~211ɋt;D;DD;DFE 9< ҋMD 1H ~211ɋp;D;DD;DFE 9D WUP |L '^D(MP u ǁL ]4 u ǃ8 u< u dž@ }D u LJH Ue[^_à V(mO1ҍe[^_SZ D': D'%1҉뺋H@ AUE܋1ÐUU1tuÍvUWVS }uU ]۹t)t1 t [^_É Bv w*vztH t [^_Ét [^ȉ_ú1^އV [^_ćOvUWVS Eɋ]} u?۸t.FVv CJ [^_L搐UVSEu] MUtEUM] u[ ^ )EUM] u[ ^UWVS E Eu}EtFOt0uVSutXtZt`)EEOuЋU Ee[^_Í}vt)EuVSWtЅuNjU Í3U 붋E 뫐UE1ÐUU1tuÍvUWVS UuM }tnt(u1Ё~ABtZt1҅ƒ [^_ÍvtZ ÅtE [^_É1덉vBt ÅtVlU]UEMU u(ɸt fx ÉQ袄ɸÐUETd81ÐUU1tuÍvUWVS }M u)9w_9vVSQD:P,}E؃Ot(Wv0t,vAvZB~vRBЃ w[ уW}w; уvnWBЃ w% EVv EB`VJE$USPE]M ۸t_tS}w}ЍBC wjՍC}wYэBC wKY[u8tGՍ}w%C?~tt Y[É?VY[à Y[ڐUWVS EL ҸOӍv< t< uC j$UE1vQjEPSXU9tv҉tp;E~E< t< uCvRjEPSWDE9t=t7v< t< uCvG~PjEPSWF E9tu VOe[^_ËEL ǀP $Ee[^1_~ۺ u~둍vUU1tRuÉUWVS EPҋ] }xo;gHx`[tZ҉]u[ ыL 1E4wNO C C$} [^_ÉME֋UBt| CB9v9r9L B !uE LtU E@1t+Ey21@!I}VEEE])։XpU]SsUWVS E@]} ۸tX L P !!9Pt9Pt?9Ptk9PtTL xWv ȀCJ [^_Ë8 CJًx CW΀x,|뭐UE̘ș1ÐUU1tuÍvUWVS UuM }tnt(u1Ё^ABtZt1҅ƒ [^_ÍvtZ ÅtE [^_É1덉vBt ÅtzVzlU]UEMU u(ɸt fx ÉQzɸÐczv̀rÐUVSEu] MUtEUM] u[ ^)EUM] u[ ^UWVSE 0E}DžTEtLOtFE9sOSu6u]T)]uvU 2Te[^_ÐQhuhPr u6XRt[;ERPXPujrxPu6XRtt,TOubE 0YE TDAU 22PhhRuq UE\@`|1ÐUU1tRuÉUWVS EPu Z}tu#€uutE1 [^_ËUZuq%=%=&%=$%==EE@EUߋ %uj? FCE9v9r9;M|F]tEUB [^1_øE!F|vV [^_þEEE뵰E 륰E땰E^v뎋E)߉xUPMvUWVS E 8E]uEtLtHE@~>?~9uVe[^_Ív~"U)EENtE䡄*p*UP *xT*,**@T**T**u9Cv*9C  ]t ue[^_É%EfS ECEHy}eEMeDEc 4*fK EADfK ҡL*f7f;Kto‹9uC +D*L*s99p suC;E**SP*C*B*PuhVhfS D+PjWVN>E䡄*)*PWhVg9s t5;Et%3ur**X*a{sSMK S;HE@ C QSX1 j ;*CC  SP C *S +D*;H*L*C;H*vBH*h2e[^_e[^_21ܸ1ո1΋t%t{9ysȅt t9xr 1둸2느UWVSÁT*1Et(J9s tJ9rz)ىBJ  +5D*L*L*A9r54*u"Ut*u'E*e[^_ QShWheɋEe[^_Ë ɋztBABUS j %E U41;us҉(` V 1҅u߉ +D*P*H9Љ H*5*sUUWjjjh%j EPj 1҃Eu P*5L*mEUP*L*L*uPibU-UWVSǡh*P19s(x*ttPWjSce[^_ÉL*9s΁wHEEuEuU܉ыZt1ۺCt1ЉUfB HffB u2EL*4u+M܋E܍\ˀH 4*:M܋A؉냸EMEU9Ћ]MfCufs MfC fCu1҉sED E)ЃwщЃ tB;U|9]m 5D*)uL*UL*ML*L*iE>Eb1R@PhU܋BPa<E1҅rMufC fEfKfM܉уЉ!LE)EufMfMBыUfSfMfK UWVS5$ljUE"E*<*5@*<*uY!h|1,vv<>;$(3,t*Eh* +D* 2P;H*2?L*ssF%tC ӭttttD;l*u9uw;E1(Et'Ett;]PSWV_yvh2h15*P$CvFT|*x*t 4*PjjjhjhjL* @1 j D*P*u  {*e|t*@*ut |*ɻM}M]Ej P$<* h * [v h *ZE*<*vH{ $dXe[^1_Rj?]Sh2RDt1ۋ |* $<*=p*tEu ؍e[^_ø%Et@d %C-CCx*Cp*Ct*C|*yCl*iC4*YC8*IC0*9Cx*)Cp*Ct* C|*Cl*C4*C8*C0*111Ej h *X 3<*2j h/2ÃEEEEj P?f11Y>2p<*l*8u8t l*]9]T;EE4*uP+]ShMPZvN21Ew1Su4*tP+]ShUO5vUU1El2vUE1Ez2vUEU E2D$9v D$̀rD$`Uu ujuuuu ujh`Ð`vÒrÐ`vK̀rÐ`v:̀rÐ{`v/̀rÐg`v̀rÐL$tD$̀r  -`UVSƋ]t6CB 3ZsXs$Npe[^ÉCFlUWVSEplEP1)tE9F~vue[^_à ^VEgˍvUU$4t,~/:4t 86tQRhK4h*^-*Ív7ڍvUWVS,EX`ۉuMAl1\P9}щNj@uBGEo j u uG uGte jGUЉW E܉G Rwu uwuUBlGBpzlUBp j3 7& WFUSR=+t+1҉Ћ]Ívhh+? tUSP$uE $ɉu-؋]É h*IEt $ɉtӃ h*I؃]ÐUWVS<}E8u U :MEUM$vEPuuwM MU}ȹUUċB`1HVSEPhEPhjr` tUh4Ep` E뀸e[^_Ë $u h*GucZtJEPh $u렃 h*G댃 h*bGEԋU @PM U2PuNMME̋U@$M U2PuMMCvUWVSLE E8E} U :uM9E UM$E$URuMMMMċU }ȹUUUUB`1HVSEPhEPhjr` tnh4Ep` Emme[^_à h*EJ $u҃ h*Eu*Zt8EPhҩ$u닃 h*mEtEԋU @PM U2Pu'MME̋U$@$`M  U$2PuM M$UUWVSUEw $7vRPhN5h +_ +øc5øt5ø6ø5ø5ø5ø5ø6ø6ø7ø5ø6ø47øT7ø6ø"6ø7ÐUSP$]uW=+t>t++ZtJ $u1]Ð h*=1Eu봉 h*=뗉+v$u ]à h*=䐐UU hBPRuUWVS1}ȃ,EPu5 Eȅ]̃E؃ @P: uPu܉E0E@$ uPuԉEY_EPhXZ5uSuVjǃE V$7e[^_ÃEPh蕠E ׃EPhyE e[^1_ÃtEPhPE 떐U,tÍv h#,ÐUU9w ;ÍvUWVS,}.M A1E؉]ԋWPWRu hhuk u>FRPuu$S`1эA)ƋE؃w$;])빍v uuh:VS{k EƀEԍe[^_Ív uuh:΋E1w<;Ph:VS2kt)ƅteWh\VSk뙐 uYPh":h/:jWh:h;hhEjXh:h;Juh:UVuS] t)tCSV[ PhvG5e[^h/:hh:h;hEhh:h;ɤU u$hvG5ÐUWVS u1tYVhhSiuFVwVOZY0p$SoO ttKƃ؍e[^_É)QVh<:S7G PdOZp^_PS붐QVh<:SG P0O_Zp^hEhh:h<袣USP]t" S PhvG5_]hEh+h:h<QUWVS<}t ?PhWP@Y0;1IKS:C$ )5o. CPV@Pp7f` $uAe[^_Ð1IDžkHDž0 5f0e[^_Ív 5/L?v̀rÐ?vx̀rÐ?vZ̀rÐ?v)̀rÐUVS]ۋut%E >vB:u@t BKu[^ÐUu u胟ÉUu ucÉU j@u uyU j@u uYU j@u u9UhE PPu號UhE PPuqUVS] SuV;1҅u e[^ÐCPV;1҅tCPV)1҅tʃC PV/1҃뱍vUVS] SuV1҅u e[^ÐCPV1҅tCPV1҃ǐUVS] uSVs1҅u e[^ÐCPVs1҅e[^UVS] SuV1҅u e[^ÐCPV/1҅tCPV1҅tʃCPV1҃뱍vUVS] uSV{1҅u e[^ÐCPV#1҅e[^UVS] SuV31҅u e[^ÐCPV1҅tC PV1҃ǐUVS] uSV1҅u e[^ÐCPV;1҅e[^UVS] uSV1҅u e[^ÐCPVח1҅e[^UVS] uSVk1҅t t$Ht e[^ÃCPV1҅tᐍe[^ÉUVS] uSVW1҅u e[^ÐCPV1҅e[^UVS] uSV 1҅u e[^ÐhjCPVi1҅e[^UVS] uSV_1҅u e[^ÐhjCPVi1҅e[^Uu u諚ÉUVS] uSVW1҅u e[^ÐCPV1҅e[^Uu uCÉUVSu] RjSV+1҅u e[^ÐPjCPV 1҅e[^UVS] SuV1҅t tt&e[^ÃCPVx1҅tڃCPV_UVS] SuV#1҅u e[^ÐCPV#1҅tC PV1҃ǐUu u#ÉUu uÉUVS] SuV1҅tt'wHt?1ҍe[^ÍvuCPV CPV1҅tʺÃCPVJUVS] SuVS1҅tt'wHt?1ҍe[^ÍvuCPV CPVG1҅tʺÃCPVUVSLE E؍EP]ZYShEuuMPEPVSxUe[^G7vS̀rÐUWVS,ÉUEE E̡$* uo2E}_f{ua=$u8( PuuSg"ffC5$]EEju uuuuԍEPuuk tr} uE$u e[^_É h1W- h1C-v h1,v} uӮ$u 1e[^_à h1,1䐃 u7Ẽ@tcE h1,vQ@jjSPE̋U  u4cBaB B5C2USh8u$u uuEU à 1tPESPjSR؋]ÐUh`"h`"uuuuu uÍvUWVS}u]ME5M]EU }u [^_Us$vUWVS8} WÉUE/td1}عEPSEzXZhS-6XuujVS%VtNG4f@fGe[^_à P5Eu V詬 WhP<jմ1EЅt S21QWh)<ՐUMEU ME 5UMEU ME 8UC=vUh8Eh`"`"ÐU vU1W}E@f@o@_1ÉUh8u$u uuuuu uÉU h8uuuuu uUWVS EEE08] t e[^1_)t,CE EEe[^_ 5,(ƒ֍vUSP]$(t3, h8hu uuuuu u3]Ð,u7$uEh0h,D($t h1(S5,)| h1|(,u렉UWVSUҋ} ut$PjjjhSPR tVjWuUe[^_ÍvVSWuUe[^_ÐUWVS ]E;u(> |>0CEe[^_Ð j .tŃ jjFtVEx^^Fjuuuu VM1'E v4$Ee[^_à VJWjjj蒳UKM1}I ыMxQRSPFS= w=/CUX P$/GUWVSDž\`v `V;C t޿D< uͅ Sl1dVjjjxP( jhuzVƅyg1IxQjjxRd jjDžhjDžljptXRjjxRP'{thd0xA uu hPSdq \ `\e[^_à pѐU8UWVS(PtPu GWPe[^1_ËE  u %lEPu 9$DžP3jV h.WuuVA u)G\] t" E 0蕧G(YE p膧G$e[^_à h4> V!vDžTPTPXPVuPuuV+QPuuV{-? hh>xPhjXSE؃ YE䈅XPSV< h>/E 0h>JO h?8=vUWVS u}tg jjjVjD 1҅t$RVWu n\4$uWu S8 t e[^_6Wu h(?ÏC$P1QWu h`?觏1ƍvUWVSEuqv W7$,6p(][uVuu ut* j荾0,CE,$c h1 WS WEe[^_PVuu [4$uuu 36 t!EuC h1q6uu h?G˃ h?55$u 1e[^_à h1Q1 h?1ӐUÉUEM E E@TEUSE@TMP] @M U[UVS] sTS3t PF Pu< sP4$C@uKC4uXC$ue]e[^׼vF P҃ sP轼4$赼C@tv P蟼C4t P苼C$t Pw]e[^fU1ÐUWVSE؋u ]DžPPu(.WVuut Su܉uctuh@h@Pe[^1_Éj`jQj`jPXZhjPY9GPPjVGP(jP2PЃPPǀUGTP GH$4 ,uF,p,,,t,,,G,G ,G8TDžTRPXSu3xIhjZG4G,T W0RSP<$L.e[^_Éhg@h@薊;Pt P Wh@ h1U$ h1kvUWVSExTwE] FGjVPGXZSVF%u Ee[^_à FVP^UXrSVuu u|sCDCC e[^_Ë,u>$h\h,$t h1Z v 5,Ã3=I9C;E 9C /E9C#uCP VPEEPCPEPjsRC PEPjsRE C EC1ы}IwщIEEC@uuu$u uuus pe[^_É BRP h1,eKuCPZYVPWWjju6 h4Ʈt/t,C]P5, C~UWVS<$5,^7GEjEċE jEȍF0PSEEYXEPS` CSPF`C@2jh`"v,S$,t(udG,$uue[^_Ív,, ,D ,L , , t h1G,0$t h1vv h1jdjtq,tOF,5, h1O$ SЃ hA}jh`"t,똡$u1 h11vUWVS\E,s$HS0ULFjVPC0 Fs`uVP U UUFRVPUP VPRuVU FVP$?)Y_FjVP@EġDEȡHE̋UEEԉUXZ}WVEPW~EEUP WPR Ee[^_Íe[^_à h1Y$ h1oC0Eh2:hhAh BPnUWVNwEEċJ PRQtDU]ċP SPRuEEȅ.SV\E u  h1UÍvUWVS E E$,}su$tSW V e[^_É,-P-p- --- F,F - $f h1]fF>SWVEPS< u{F(& h1SvhTChh|ChCgX* hC e hCd4$茔1UWVSu\ uU Ã1DžddWPhWV >hC0C,hPj‰C4hQPWR| dDždPWVhC@$pP@T@X@CDDCHHCL$$-C-C 0-fCEDžTTWPXWuP XC0C,Pj‰C4XQPWRC8$jڍe[^_É-$- -d$-d(-d,-0-C-C 0- h1v h1[$ hlD1at V轐e[^1҉_à hD҃ h]Cȃ h]C`UE@@xu"PEPEPQuUE ʉÐUWVS4jEP9EE$E1ۋ=9EUWVS,uE FPhvPRWDž6yl8t~8tt8*PhhS jjSPRWDž6~x pYXjsF@RWPFC4-1DžDžtRMȋut69HuP9;Džs9v΋ủ S$ h1M9$e[^_Ð h1' CSP CSPe[^_à h1I h1$PWSd:PSR끃SURPn h1{UWVS ]tX]1vUƃU DPcK11 CuӃ ve[^_hEhUh}EhoEC늉U单x Hu ERxFUWVS E ~\Nju0$ufʸ!u6t%fFftO uà 6}uލve[^_à h1?܉ h1C$UEU tHt1Ë1~ÉɸÐUVS] SuV=1҅u e[^ÐCPV<1҅tQjCPVA1҅tRjC PVA1҅tPjCPVA1҃뛐UWVS }?] E1;EEPW>tTEt`t@Eh4jSW4 t,t1EE]1;EEPWx>ue[^_Ðze[^_ÐUCvUVSPj] SuV@1҅u e[^ÐPjCPV@1҅tCPV;1҅tPjC PV@1҅tPjCPVy@1҃뛐UWVS }?] E1;EEPW=tTEt`t@Eh 6jSW t,t1EE]1;EEPW4=ue[^_Ðze[^_ÐUWVS]Cj Su PʋȉFȉFȉA CSPY_~ WSE81҅u e[^_Ð CSPEXZvSV1҅tփ CSPE+EF ^XCuSPZYWS81҅tCuSP둃VS91҅zFPS91҅`FPS91҅FUVSu] PjSV>u e[1^ÍvCPV7tCE uK e[^UVS] uSV91҅u e[^Ð3CPCPV<e[‰^ÐUWVS }u V E(N,ʃ(GRWPڃȉڋFȉEFڋFȉE~ڃF ȉڃFȉڋFȉFEڋFȉUBȉMAN$MڃF$ȉڋAȉAE!Ht)VW7EEe[^_ÉGj WPt‹ȉȅFEuȃFEuȉF ȉFȉFFEȉFCUȅBts=E^Ru#PjMAE4MAWPWRPUrSrmN$MGjWPȉF$UCȉBMA=EYu&Pj3UBEBWPWRREpSp辤FPW8(FFPW5~F PWz5FPWb5FPWJ5FPWF$E }e[^_~hEjAhEhE9hEjBhEhE9VPqSWPqS覣UBÃPEppW7EuWU7F,PW 3QMqqW)7EwUWVSL}EE0EfGoP5F5FjhW谡 þt_E EȋEE̋EEЋEE؋EE܋E0EE$EE EċSu,u(EPh@EPh>jSƋCSPfGe[^_hIFj`hFhF)8?hZFj_hFhF 8vUWVS ]ۋu VSK2u 1ҍe[^_ÃFPS+2tFPS2t̃ CSPY_~ WSE11҅t CSPEXZvSV1҅t CSPE+EF ^XCuSPZYWS11҅XCuSPAvhEhhFh)F6hgFhhFh)F6UVSu] tOtihPqjEEPVu 1e[^ÃCPV0tEsVS hEhhFh:FN6hsFhhFh:F06vUVSu] t]ttSV0u e[1^ÍvCPV_0tCPVK0t̍C E ue[^00hEj=hFhF5hFj>hFhF5nUWVS,U]t1t e[^_Ð 8t5PTǃ1tԃ PPhFj ]SSWTt)PWu u2 4$Hq<$Ke[^_à WK1mUWVSh8} E1tPSWu E$RK h5tQPWu Ɖ$$K1uUte[^_ÐUEtPEPjjuEP  uUҰuUE EU1Ðv̀rÐUWVS E ۋ}utSWU?t.e[^_Ët4tSWU?uӐ SoE 뻃Vj螤ÃE ۉtPVjS끃 hF?1UVS] 1;EEuPV01҅tMue[^uuSVe[‰^U1ÐUWVS } ]GC GCG CS@BDs C@LtJ~~tU $8-90tl@u$u4e[^_Ív} ]e[^_j} ]e[^_` h1뺅u} ]e[^_$WSP$҉u1؍e[^_É} ]e[^_ h1@ h1USP]vV$uR8-9tkRuj j衢tyE B8-B$ۉ8-u1]à h1뜃 h11ա$u ]à h1$u ]à h1UWVS <-fDžE@U ZȃtHe[^_Ë3΁w䋅GPVwSG0FËGG CGM Y(EȃE̋CEЋ>fRf?fn)¡<-EȋỦE؉U܋ AEEЃ E䍅PjjuVDžDž H=E؉ȉEȉMɉJE9ЉhGhj hjP<-uXZhj1ң@-v@-fPB?~Bvjj}W<-t)ЋtD ?B')Ћt;xPhGh9GwfSwte1VэPphJG vh\Gh9GvhiG狵v<-?ÉtDžddd?9uA9CuҋSt19ɉ֋uC9H-1ffDhvGh9Gv;JijP+9Љt]|ihGh9GuhGh9GurL-@-@~;9}jjBȉE؋ȉE܍EP}HE؋U܉ỦEȋU EȋZ(ẼEЃMA@Du QF(BHA+^(XL<-)4VF@-fff9f@-fXf XCf;u狍AyFQ1׹QjțFpvvQVF~ tf@1FBVAQ F A1hGh9Gs P?f)hFh9GqsVC9D-dhG뙐UWVS EP?}wm)Ѝ4<-\fSft^1ft2U CUCUCDSJye[^_ÃhGh9Gr1e[^_à WEPEPEPUr uAhGh9Glr1fC뺃j&jÃ<-\fC5hGh9G+rEfU EfCUEfCUU fDSJy#UWVS$h?hH1{ƃ1RVhP{w<#t<+hP~[hHP\8tڃuSjoWu {4$能e[^_É Pr2DžPP}1IQuhHn u ߞ4$XcSPhHh@H5yRVhP.z V脼e[^1_ÍPhHh)H먍vUVSu 1҅tHhSu1҅t-j:S 1҅tQj0SVF0ve[^ÍvU P-ɋUE tE UtUSP]tu]]a]Ív BRP]]avUWVS<`-Mt/蹧9B+ PPR::1DžPh@J So>tL q D<uЋx, S#>uu2t(hPs! S911襊B胦 Ajjjqh" DžDžQPPj1R PPj1R[e[^_ád-u<$hQhd-舷5$t h1 5d-E~9BBjA P PR$jjph  "PRPj 0RvPhPi h1=d-Rjj5 j /^1rtW`-o BRP1e[^_Ë S771ރ5d-蛷뜃 BRP1UWVS ÉUtuCv tt uvz1t'1BWVuu uuSR e[^_Ív \-tuRB$\-MPQ@Ae[^_ÐX-PuP$X-뻡T-,jP܆$T-PMQ랍vUEPhmu,l tEuUME H1҉UE Ph lunst }҃JÐU uhj8p9ÍvUS(E] ESEEPhmEPUpltE؅u UE܉S1҉Ћ]ÉUS(E] ESEEPhmEPUpltE؅u UE܉S1҉Ћ]ÉUS8EE؋E P]E܉USEEPhmEPUl'tEȅu UЋẺS1҉Ћ]US8EE؋E P]E܉USEEPhmEPUltEȅu UЋẺS1҉Ћ]UWStjhj]Sw Shtnj8p et Etve[1_Ív}t} e[_ÉUE Ph lu,l t}҉ÐUWVS ]׉u Uuu wm1BABABABABABABABh-t5QRSWЃt1҃e[^_Ðe[^_ÐPRSWƐUMȃSn URSj苂$9-tC t1 $th1-P-uщFx PPul V(UB t 8UBt 8 u'$uPPjEPj见5$ue[^_à P҃냡- P0e[^_à h1랃 W:! h1 P0'= P'?UWVSu F^ ~DžT)DžPDžXDžd^d~f?uc `P\PPTuDž`谿 xH jXPPTukP xRdVudPf?t ڍe[^_Ðۋ8h9tPdPVu~yN8빉DžTDžPDžXDžddSPhVuDžd@\QdjVipȆ.) j\PPTuLO 9UUVuS] SVu 1ҍe[^ÐPhCPVt݃CPVtɃC PVthDpjjCPCPV# u덐hEj@hJh|JUhiFjAhJh|J?U1ÐUW}fDžfDž1hX0jlIP DžDž(Dž<DžXDž\Dž`DždDžh} EPu P蓓}ÐUhhP/S{ÐUVSá$u-1ҍe[^ÍvW{uhďh-|uЃ 5P/z1҅ujjW tP5P/|u끃 3"gvUhhT/zÐU$VSu-1ҍe[^Ézuhh-M{uу 5T/z1҅ujjV tP5T/{u낃 3!hvUhȞhX/yÐU $VSu-1ҍe[^Éyuh\h.zuу 5X/Jy1҅uh j(V tP5X/ {u| 3!bUhh\/xÐUV5$Su/1ҍe[^Éxuh,hH/yuу 5\/zx1҅ujHj[U tP5\/>zu낃 3K hvUjh`KhJhayhKjÍvUuh`KhJhayhKjXÐUh`KhJhayhLj/ÐUWRE}1 E@@ @@@@@ __ÐUVS] ؋uEEPuuSuh`KhJhayh@LV01HtUe[^ÍvUVS] ؋u3EEPuuSuh`KhJhayhLV'01HtUe[^ÍvUVS]؋u EEPuu Sh`KhJhayhLV01HtUe[^ÉUWVS /ɉlj EP5/5/h`/V׉ËE u"tu e[^_LE萃 5//=wW P//tREu"n또 ho1҅/t/A/~"1WU;vUvUS] MUEEUM ][mUUvUUvU1ҸUVS Gu! jjjjhJ z u#v jjjjhJyà 1t5jEPEPSE KES tBw؍e[^ËEBvVRhdMj$S1ۃʍvUSP]t,u]] PP]]]ÍvUVSE] qu tt*ve[^ËE0E@u&EpًEtЃ PPE뻋]C UWVSl} UEEw0tTEu Eċ~te[^_ÐuE2-UB(πB(EtыEʉЋEE1ЋEЋEЋU@EESUuW]ċ3 Et ]ċ[]EȉE>]čMS E ЈEȋUjRQ3P  Eċ@ uuWuu E@]ă{ CEɍMEgЋEE3 PPEăj+렍C zU#E@]ċC]ă{ ~ EKUUCE;EvE"CRPuunsEċ@ uuuuƃ QjuEPDw@M]ĉECELvUWVS u] 9ދ}sY:tB9r ɸu:t0OtFB9s :t B9r u#BB9sE;D@e[^_Ê뱍e[^_ÃVupje[^_ÉUWVSQUM u9ʉs :tB9rEEZ[^_É9sB9ʉVs:t B9s؀:u9sBZ9EwNjڍ[9ˉFEwF C9Ew‰Fs:t B9s:u9xB9ʉVl:t B9r[9SB9ʉVG:t B9r890B9ʉV $:t B9r9 BB9E:@9F(^~$EUWVS u] 9ދ}s[:tB9r ɸu<t2OtHB9s :t B9r u%BB9s9ED@e[^_Ê믍e[^_ÃVuvhe[^_UEVU S9Ћ]s 8t@9r[^Ív9s@9ЉCs8t @9s܀8u9s@H9ѾwˋȉCȃ9wȉC ȃ9w9щCKs9t v@9s8u9s@9ЉCt8t @9rc9[@9ЉCO8t @9r@98@9ЉC ,8t @9r9@H9Ѿ ȉC$ȃ9fȉC(UvUEu EÉUS]S]]DUEzt ÍvEǀE  EǀɸÉUWpXwXwXw  1}ÐUWS׋҉u jjhXjjp ‰tB1IM]EEEjPEPRR1@t e[_te[_UWS1t,jEPэEIPRM]R e[_ÐUWVS M }E|]U Hyf)u$u uuuhLhJhKMQEP0upEMP1|EtKv u$u uuhLhJhKEPEPy0te[^‰_Ðu$u uuuhLhJhKURHe[^_ËEx@(DžpMEPt1pMQt1pEPt1pMQt1pEP t1p pttMpcEMQ2EEPEMQEEPEUB tEEuM <KU2S)SPV%<9؍tEUr)QSPV;9؍tEUr)RSPV;9؍txQ(@AUrS)SPV;9؉pCpxtP(_xAmUr)QSPV<;9؉ppxtP(%xA +Ur )RSPV:9xQ(txAMAtxB MA t||t2e[^_1щpME9Hu t."U$"LEM1u `뤋Eu)RWPV9}u)QPRV9t0Lu)SPRV9t0uP)PRV9t0uP)PRVd9t0tEP+tPRt99ttsMA/EiMAEEE@EE@E@ hMja USP]tXuCu+C]] v PPCt؍v PPCb]]J ]ÍvUWVSL@M }E] 0u ttie[^_ËE0E@uwEpU Hyjh0MhJhKEPj! e[^_ËEu7U Hyjh0MhJ벋]C w PPEUWVSl} UEEEaw;} Mu EċKSe[^_Ív} uɉЋEЋEЋU@EEMu} ]ċT} C]ċKMCDHPEȉEUċB!}rCEGC EȋUjRW3P M+-t}EċPUċB@B]ă{ ~CzvUtEUEMQ(πQ(׉ЋEAt@/UăAt Eċ@ uuu uu >E;ESPuucEċ@ uuuu ЋE PPEă:}]$UEăxDEVPWS u fE@D뽍C ^] APPUPRMQEP~ tEt8tۋUă, ]ċC){E,:uuuuuRujEċU ƃ uuuuus@ujU `ƃEp@@E@@Eă@DhUE@A(@ AP]C@EċH@ @DE;ERPuu?aEċ@ uuuuƃ Nt]]ă}EP(t@Ct MA C @u S(] Ep C MQ(S(uuuuuuuu U E@DqE@DhMjUM E| Ep:CtrMQ($ EpCtOMQ( APvEă@DlE"M"hMjE UWVS ]E 9Ë}st::tB9r :uRtHOtSB9s ::tB9r :u*Pj EBPR,1‹E8:u ;Ute[^_Ê 1}щI)9u9u8U 1}PuuI@ÍvUWVSu UEDžx!ЋEЋEЋ|@tEtuN];tSE-uo t vPh!Kj@EPk@tie[^_ÍvhSQ0E]8-t t vPh(Kj@}W@҃uEEEPEP}1IQuEPu &rE;|RPuu\EU_u/[xuVuu9 w."x**Ee[^_ËUu{EPEPPPEPR,ǃ ! utYEeEǀzf,vEǂPEPUPPQS}WRSe uh4K}wE)|U|TOElpEPEP1߹IQSh7Ku jEu)QRj:P1JGC9>)PVj:SJ');lH uuUUE@}GUB(π B(Et}ЋE tuuuu^ǃ exh|u;|t"ЋxePEPURSEW|uu*늿6`EǀPVSp:YpUWVS<u 1ۃUDžDžDž\eЋЋЋ@ P複 P tayPŏ V81IQ3 S輆1ۃVVxqP@hMKhR/=wMP3(;"TvtSuJ(0EtEe[^_h8NS莅Xj1ۉǃ PmЋЋ4]"t"]8]А/U1҉/t3RE/PE /P E//ÉUVS5/&v 6sXs $u١//uh5/Cu5C uB StZC6t׃ PCt˃ PC t P밃 Py/뀉///e[^ÍvUWVSL/ sLFuމ/5/u h/ uՐPP1IQhM5/9  L//eW5/hP=/4<+uU/ h hR <+t<#< t>< t:< t< t< tt C< uv)< t< CvC< t< t뿃 5/%1Å۸t[suOS Ct8:t3:(t8hMQfGu1e[^_à jǹ1󫋕//ZYhqQFDžhIPF4< < hMV )~* XS DSPV l B@< t<,t< tvFVm<  j@F$j AVPW B01уqDž<\Dž~w GPɉ~"RP~ XPVPSZ :P5/hQ ty1эqD3< #ND3<\DžNDžD1эAJ //rbGpUWSp];=/t5/SGOELPhM訝ŰEȉ u/Lh?hM £/u(Ltx=/tG/e[_PEPhR57X5/}+Lu|t//t P]M=/=/e[_1 QZ/ZYSP/묃 PMRT8/LVUWVSLMtE8u 1ҍe[^_à /uL/tE E…1Ш uvWVS &U ttPu DuɐEttPuDuEttPuDue[^_à h/'1҅/E DžME Dž3GPhMhVzP1ۍPعIQV %}I R]-%@t FӁwݡD4%@u9= P,%@u#F,tt=wՋD4%@tPuwu+;,t=v] P,%@tF׃?@9F1ۃ tҺD4멋EthPhM,ucE tQPhMhVx hMHj됋맋M1҅#nEbDžMBUh4h 1FÐUVSá$u/1ҍe[^ÍvFuh,h/GuЃ 5 1zF1҅ujj[# tP5 1>Hu끃 3KgvUhh1FÐU$VSu/1ҍe[^É#Fuhh/Fuу 51E1҅ujj" tP51rGu낃 3hvUh(h1SEÐU $VSu/1ҍe[^ÉWEuhh0Fuу 51D1҅uh j! tP51Fu| 3bUhh1DÐUV5$Su01ҍe[^ÉDuhh1IEuу 51D1҅ujj  tP51Eu낃 3hvUjhNhMhhNjÉUuhNhMhhNjÐUhNhNhh OjýÐUEUERuu uhNh Nhh`OP能01HtUUEUERuuu uhNhNhhOP401HtUÐUEUERuuu uhNh!NhhOP01HtUÐUWVS ǡ,1 EP5015,1h1V׉ËE u"tu e[^_qKE 5,101=wW P01,1tREu"m뗐 h1҅,1t01@,1J"1VU_vUvUS] MUEEUM ][UUvUUvU1ҸUSP]tu]]]Ív PB]]USPE] u tt7]Ë]Eҋu=th?h,N"ˋEtƒ PBE뫃 R띐U/vUEu EÉUSP]t ]]v]ÍvUErt ÍvEǀE EǀɸÉUSP]t smu]]X]Ív PA]]8UWVSL,P }E] u,t4tjE@ E pE@e[^_Ë]EҋuiU HyjhPhM,EuhU HyjhPhNh7NEPj̸ Rh?h,N{ Rj P?EUWVS U u} 9r"v R_"%@t+F9s~#tcӁwԡD4%@u׉#t?9t;}t]1] 9ȋU}v9s8::t#B9|}tuw2}t9e[^_Ð@Bڊ뤋E띐9Ⱦ}ڐ}u1}+U9эAu9u}8Pj EPRU9x::o9E뚐UWVS uU1]z))~hLEP3ue[^_É8thLEP3FtσhLEP3‰Et8tEQj EEPRE8uN~ ~YEt/uhIV>3t 8tK~*Euԅ9E")EUWVSl`P }} UEEw} {e[^_Ã} uЋEЃ8ЋU@EEMu]3} Et 3]KMC EEP3&tRE| v >+3 uuu PVqE HtH]EP3{&uuu En}Ue[^_ÍvUB;E_QRVW<EXZuUE)HPDPuRW+ Eu]lЋEHE%ЋEqUM Hy6IQE'E@ ]h?h,N]FU HyuuWuEphPPhNh7NEPEPy0EM EpE@E@ }d]} ! uuWuhPPh Nh7NEPEP0E]1UM U$VUQPj:RQ*t\9EtW )]EP CEP$EHSPuR:E@MDE@ ] E@ ] P9ExE"EO} } MU9JE@UEuuWuuhPPh!Nh7NURuuWuuhPPhNh7NMQU2u1lhPjM EwUWVS,} UEEQ} [ЋEЃ0ЋU؋@EЍE*UЉE8 E} } EEPEP1IQVuu DE؃U90PRuVx8EXuXuuu uV } u} 0} 0Ee[^_Ã} ЋEEDNUu{EPEPPPuRǃ  uXEEǀJZfvǂE싊PUEPPPQSuRSue uahP+=UЉEUEEU؃)uJRTRuPVǃ )uhuVd;EqEк"ARuuV҉ЋEEQNEǀUWVS<} UDžDžDž} ЋЋЋ@ PdOv} } Pb"tPl} 0! u >1IQ67 Vc} 1(} JK} KP@h]NhVb=WS69؉WVb[^)HPD:PWRà !PhPV ]S EPSj`$h1tD vt1 $th1l1Ph1uщFtt P#FLPF VXu$uTPjEPj5$ue[^_à h1%l1 P$e[^_à h1뚃 PJk FHP҃OhQhzhQh\Qą5UWVSEX HMb  )؋} 1UPPfDžT #8PSjVtDžLPLPEPE0u}t{PWu U2T"ǃtJuE@$6@ e[^_ËUB m"UB$e[^_S"UB$B 뼋U2Pj`jXSE @@DEEEE]E`EEjPVǃ,E@ _vUWVST} DžTPEPE0Nu}tNuPVWE0!t)DžEe[^_O!UB$B e[^_ËuvURj`jXP HXUHLDž`Dž\DžX`EEEEE`EUjRSxD)Džd(UVS $1Ks< @K DSHC SC$ p1u2p1\t1x1d|1p1xC p1jjC(uPV'XZSV'ZYC PV'4$EPCUSS] tl1t'RSp<(PSR á$u؋]Ív $u1]Ív h1Ѓ h11hEjvhQhQ芀vUÍvUÉU1ÐUÐUVS $ɋu]u#RSu V,á$u2e[^Ð Vs RSu V,á$tэv Ve[^ÐUVS]u 19sHr e[^ÍvVsD(ƒҸt܉SDsHe[1^ÍvUWVS $ɋuurF8Pu@~"Svj 6tPCߋE )׉U8fN )~ $u Ee[^_Ð V7  Vc 뀉~EGPPV VD+EURP6u}4$uPSvj 6tSC+ljEWVuTVDUQu6u`E)FU :$uBFD%~N V E $u1e[^_à V+ FD V 1UWVS =] C(EhLPo EuEUhLEP& C8tK(hLEP8K(Wj MQV38"nE8UEt= hRm<+K(hLEPwCQEu21e[^_Ë<+h<-`Et܃Rh#R v h6R/뼉EtVhFRvzK(mE{EhLPb8K(Pj EPV 8"!E8E%VhZRQ hnR@EQjVh~RF:PhVhR !<+C<-;ERhREtt p{ EhLEPC18tK( hLEP 8tK( VCZYhLEPM8tK( VoC$hLEPC8tK(@hLEPCv8tK(hLEPljC IEtF?uihLEPƃEPjVhR<tK(PhVhSPwcrtPWPuEt hR U1u 1ÐjPM11UWVS,1Mh?h1S1ǃvPWhVS#t/ttF#tЀ/uv#tÄۉu&뷍v R;%@u)#t$t FӁwԡD4%@t׃ 1ZYP51wLPWhFVS We[^_ÃjPLUWVS,=S}ء1K1 EPE=@1ۍvShJSj EP< h6SEPuEt518tv451GKu VoC8t+ ul<UЍe[^_ÃjPK7EuEUWVS1J11u h1"EEEPEPEP}Wh6S51N u\UEu51JE]PEPEPWuSh6S51$SVt1҃Be[^_Ãte[^_ÃjP{J vU1uII 1hdshTSh6ShSjE Ht;1u"1`SÐjP J맃jPI΃j51I1ÍvUa1ÉU1tt1Ív/1U jE jEEPujEPEEt @HÐCv̀rÐ/v̀rÐv̀rÐv̀rÐUWVES1ۋu t%߉CtA9uu1ۋE[^_CU j juUcwÍvUWVS$EEEEEEEu }Ej`jC8PjCC=$zh0h1$t h1 51JÃFM;%{E uE@Ep JuҋE@Eܿ5uܿ8u E0芈ËE 1{v5uMv$uFh0h1u$ h1Me[^_鵀 h11u럃 h151}c E0貇U҉Et1 u8zu51{S51hUjDvUWVS}j iƃ1t\t1ۀ?u)Fwb$HUvPWBt CUuUytFe[^_ÃhUj諂XV1e[^_ut Fƒ ՍvUWVS ]1taKt5 3vEUt>EPBwԋCw($lU 3|ɋE@tBwvEe[^_ËMAtJuJuE@ EJutTuTEp8KB;E@ EJutTuEp5^MA7vUSP]t/tTj.VTUtg @PEj.V.U tA @P ] j 荙Et}t}~} VEe[^_Ã}u jjLtPjjjS CjgV{W1I EɃHX됃 jEx}1E@U؆fBЃQPVj&E@UP! j臘E ǹEUB؆fBPЃPVj躼~AE@UP u6Xu-E uۉUE Pu1҅tu u‰ÐUUt~tÐJvUE HEPB:At É<uzuB %t.B %=uπyuA %=uAB뱀yuA %uU卅tDžtPxPu1҅xyt Ht#1҉ÍvuvfzЉÀzUVSu] tZt;SVWX1҅u e[^ÐhCPCPVXe[‰^hhFjNhVhUZhEjMhVhUYUVuS] tt,PjSVWe[^hEj_hVhUYhdVj`hVhUY빉UVSu] tJtaSV1҅u e[^ÐC PVWW1҅tC tBtQhEjphVhU)YhqVjqhVhUY넋CE uKe[^CPVT1҅iCE ue[^SvUVSu] SVVt$t*HtOh hhVhUvXe[1^ÍvCPVwStCE ue[^\SCE ue[^(VhEhhVhUXZh|VhhVhUWAUVuS] tUtoSVRu 1e[^ÍvCPVUt{uڃ jhUC PCPV:WhEhhVhVkWhVhhVhVMWpUVSu] CCt e[1^ÃSVRtCPVTt҃CPVQtC PVQtCE ue[^QvhEhhVhVVVhEhhVhVnV=UWVS }u Gt2HtGFt\wFu"GFGFe[^_Ð_ue[^_Ívw[$LV u܋GFG F븐GFe[^_É_ txF^`vF^HhVh+hVh)V^UhEh*hVh)V=U    hVhhVh7VThVhhVh@VTUWSPt e[_à 52=$u1h0h2t*$uIPe[_à h1뽋 $u ڍe[_à h1 h1P륃 jXZS52tw S뇐UWVSE HUB8Pu@Dž<Dž8Dž4H9AHvh W%@teUB%D4%@t4MAHCAEvà R뾡D4%@u%u0DžDDž@H:BzHwF$VMA~^E9u)MZIH49AH vEE;t%EPUREPS0];tEt܊t.Eu'}܍UREPWVm0u܊t EtމUE9Uԅu UE)‰UԊt VuVUԄUt؉E؃ useXujeE؍e[^_à Pr1EЉ4$e1ƃE>u뱊)‰U멐UWVS<} R臡%@t#7GwڡD4%@u݉<-+EE}Eu10LME"EEEERPjjEȉUTuujjEU8JUȋM̃EԉUMčC< wNv;M}Su؅x'E9EwrU9UwUE3U3E u};M~xEGC< vC<wN7;M|}M tU؅ҋEtGU EUe[^_ÐC<wWSEeUUEUċEЋUUЉEÉEEEMUUEGE0u;uBMM1*e[^_QG;uX뵃DQډ#_4MS )ʈѸU!9)uEtGU-UWVS*|=EUHM1ۀx0u vCE<0t]u1u!:UyE0e[^_Fu:M+Et)}P"pU2+EX1F VgƃEu11҃;}v,O:Et ك ƒ;}wԋEM)ȍX YRā)ËE 89EuU܋E 9PEE P;U~`+]9EUҍsEMtMSu,wE @)߉E܃Et U B OHMUM EU܉Ee[^_ËMM10ۊE@ ,'Hj u~Ee[^P_ø+Ew EpPE}EE9p}QM 6G1Ƀ+w:-/t@S8FtFTCutU~w)SutLsEU t'NE~CPu^tESuPu]܃FFuMQFn0ucFw)QuہE)]܃EE(EVuE.MaF0aF0tTEOM ME9~ CPuoE PME@UMbU Ut} )ڃ9jusE܋E܋M ;Al u{M]hU H90MEM BST$L$ 18uBu[ÐUEPu umÐUWVSE uEVu1҅tN>;}wS1Ҹu9rEutm19sSuFU]9EsuU:t$Ue[^_ÉE1҃8te[^_à E 0CU U‹Ut{먅tVjdxÃE ۉtPVjSȝE h[1`UWVS }19] svSuUt ]F9re[^_ÐU0u EEPUÍvUÉUSPM] t2rt1҉Ћ]ÐEEQPQR‰Ћ]ÃUARQ1҅tƋE뽐USRM] t2rt1҉Ћ]ÐEEQPQR‰Ћ]ÃUARQ1҅tƋE뽐USU ] t#rt1[ÉB] UH[B] U[USU ] t#rt1[ÉB] UH[B] U[USQM] t2rt1҉Ћ]ÐEEQPQR‰Ћ]ÃUARQ1҅tƋE뽐USSM] t2rt1҉Ћ]ÐEEQPQR‰Ћ]ÃUARQ1҅tƋE뽐USPM] t6rt1҉Ћ]ÐEEQPQR‰Ћ]ÍvUARQ1҅t‹EfUSPM] t6rt1҉Ћ]ÐEEQPQR‰Ћ]ÍvUARQ1҅t‹EfUSPM] t6rt1҉Ћ]ÐEEQPQR‰Ћ]ÍvUARQ1҅t‹EfUSPM] t6rt1҉Ћ]ÐEEQPQR‰Ћ]ÍvUARQ1҅t‹EfUS ] EEPu,1҅tEЋ]ÐUS ] EEPu\1҅tEЋ]ÐUSPM] t:rt1҉Ћ]Ð1;EEQPQR‰Ћ]ÉUARQ1҅t1}믍vU+vUWVS Uҋ]u t׃u"tUt#1Ƀve[^_É)ӐPCRVSP 1ɅtՅtϋC}E []H ,QCRVSP1ɅttC}E 3]He[^_UWVSE E]Uu}SV1҅tc9witsqE]E ue[^_ۺt3}u؃SjrUEu h[q 1ҍve[^_Éte[^_Ãuً]t uuEe[^_EE EEPp3EEnl<1@fC냐UWVSj*Ã1tvCt~  Chh\+tR sC1щ $N*CtBVPeCC ؍e[^_ÍvChUj 1e[^_à S*1UVSut> tWe[^ÐFuKF u6^ 3.؋[$)u V)e[1^à P)뼃 PUWVS u} ,v9vBx\u t3e[1^ËV ^t;t߃j:SF$tՃ jg(@VuWF؍e[^Ív3FuhUj  v[@uFu빉B먐USP.@4uY<4u5$1ۅuah0h<4à $u,ۺ@4u 5<4t;ډЋ]Ð h84/‰ h84<4u넃 jG'XZS5<4+tt S;'@4둉뇍vUSj &Ã1t&D4,4tC04C؋]Ãh?h\=D4u ,4 S&1]ÐUWVS }t=t= toe[^_GG,4H~ ,4W<&1e[^_É504,4(40444" s%Z3%$%tC@vtσ P% W%X5D4c1D4\USQ]t 3~%Cu]]h%]Ív PW%]]H%UWVS Ɖ* 1D1ERPhVoUPRhjzEK\ ut}\ u)CPEPhj#EC-E}t+bt~v~KC뙐KˉPEPhjC UPRhjCtd}PWhjoCtDPWhjREt'HyuujCC1ɍve[^_ø\ ut-\u8¹uCCCuo j #CCuj,uESC4C@C^_Ps"Cuu1Be[^_à P"냐UWVS } D4?GG04G1=(4 h-"Ã1V5D4hSn9;#tރ j !E jD!Ep@F|@ 04uYE4404G44@e[^_Ív1e[^_ÍvG @G@뿡44UP44@44뚃 S7!(4릃 S"!뛃 S![u!뇃 S!4$U*w $T^v|]øT]øp\ø,]ø\ø\ÉUPuh517ÍvUWVSEo*E"E8IuX04t4Ɛ^u3rvu1=(4h?h\6E hEPuhu 7t>8#thP[1}щ؍Q)9t@u um uyEe[^_à VK1e[^_ÉPRuViu jDEt@‹E@Euz5j%jh]|_5jjh\h_ 5j'jh]Q_5jjh\=_ 5j)jh]&_5jjh]_ 5j&jh^^$ s h"ƃ1 jD EPjDSuxY_3VY_ZUjVvY^s pVY_MZA jVXY^spVnY_ZUBjV:ZYspVPYMAA$tUBtMA1uE%jVZYpC4VXMQG9yw* uv  2 uEdUS]x*E]EPEPDH1@t$Ћ]Ð hЋ]Ð}8uЋU}UWVSQ]ۋ} t\EwvUC҉t 9tAust?vCtA9uu1ۋEZ[^_CE1uEZ[^1_ÍvUhH4u u]ÐUWVSL] }0R@u|0e[^_Wj j PhWPS2 u> uZYPPWh_1 |0e[^_ShhhHWF j hhHPF떐UWVS ։J|Q@u8|e[^_É u9PVh_WI1 |e[^_ÍvUQQUPÐU=QUPÐUVSÉvQ|u?Q[^ÉWQ[D0^ÍvUWVS UEBty1ۃtME [^_ÉF9Au4AuA uAuAtxA}tcvCvP9X ~Gu009tC1ېP9X ~u009tCۍvAt;FuEE [^_ÉUWVSuUfB O~q hPVuu1 xYƍF;EwO V34$Ã3;] u;EuuRu1e[^_Íe[^_ÐUWVSu UfB;u w E ;Eve[^_ÍvUBUfB19tpe[^_Ív hPVu u0 xƍF;E w V24$2ZuuPSR t2OMUBS,1%UQNxBCNY0[x6N+N@N@N@ ÍvUWVSE:N@ } h !N@h5jjh._W 5u uDžM@u } ~ DžDžDžDž<Džx|qDžzM9P,Dž[M9H ` b҉tx LXtR1ۍ} LZYRuuWURVP u r_ C) 1ɅtL@zL@1L1x8$L@t,BtLR9P KxKRP KVjjQKZp Kd ;vStQKZ0~R jK@SE P.E E DžjPQKZ0lU 9 ufDžSPVQJZ0$uff)ffuÅ ux.;EAfff ! u5RPVShJY0t ff)ffuDž taEHf+EfftDf=vPSVQIZ05t~ff)ffu‹Uff9 J@uIa 5jjh=_dS 5E9Pu诡]IaCIx8I@ (I@IRP IPjjWH^p HU H@I@ m Ix tTFHpu2StQ{HZ0w cH@ju uSNHY0*;E  H~fHؙy DžDžjWm?B@GHtGfDžfDžDžDžDžQjVjV| <qDžPPjuuSFY0  DžvUff9F@uFa 5jjhZ_@P 5E9Pu苞;F jj_aSF@ u P~.F@ EEPuUE PROE@uEa  5jjhz_@<Džt<t|OE@tju uV'E[09 ;E QoZ0_f xPjjjhSt WS@Ph`5h$6VƅiDžlfDžjPjhPPID_0E5jjh`J 5E9Pu$b+kkZ0*`G k@@Dž(!@@r@a `@@uU@a t;hjhz5 5E9Pu t@@uz?@ to?Xv11!j\C)OT?ZYRuuu uP uh?a5jjh3`H |hXi=MQPh_5g="iiZ0C`ihh^0N`hh^0[`hVh[0f`h<zhm`h^0q`IW5h^0x` hZ0o UWVShSRjF- 1эA;M Qu SuG2^VNvh:hP5xZ=sSxM4F;E w-]RQRCP``%ED1ҍe[^_Íe[^_ÐA%t$` AtAHDRS"+'1IЍe[^_ËE1e[^_ÐuEu 1u׋UԉPjR]SZڃېPjR]SoZڃ UvUWVSu1[^_ÅCu؀8u؉CCUVSƋBCB RڅtۉuۋBF אe[^ÐUWVS\EEH1}:_<]w,EЍ_;uEE]sGG,t@x\FEE;us,t&]!Ћ]:u'uFEEE;urՐE9E~ ]}ĉ]?uEă\[^_ÉEyEx딋Eč}EEEEFE0vUWVSPu~] t{NE;9t3{t-uuxttfvttt2tA@9B@~&_[^_Ð{:_[^_ÐuxE9E|؅x ;E|ʊ8u9}_[^_Ív9{tЋB@9A@xBD9GD ,AD9BD AD9BDhZBD9GDIUPtEHt\PuP uPuxt t?ÉHtX tt@t޺tٺP Ð@ %=t=@%뵺x0W/ÐUWVS<] u}t UPRVjtpEPVHuyt<uE؉E1}ffEuMQe[^_Ð8u]S֋EPWډm+dɉ{WzrDž71;1C$;;+Q9u$+8+8@ 1Ƀ!v ": u A99p\ A{42uuWt01E uڋNt5Bt`t[e[^_ËE1e[^_ËMe[^0_ËU1؅DžytvuKz) S8ɋً1DžEEE)E&jj Wjj]SBF L -jjWPjSF  H;wL jPIRjHW@PKCHGH;v Dž9c1Qh8P$KCǃ9Ѓ9FF?ƃƃ-qDž@9ȉ}:vD8D~"44T5DD5TC9|ɋ9fDž:RjjP:P8P8R8WPSgKd1DžC1҃9 |O0  qu:uru zƃƃBBB Mhh*Dž9}7SF9|Ճ 1tO{tG jf @@@ @ug Sa1ۃe[^_-V'ٍvECe[^_ú먃 W봍vUWVS|EDž aDžDžDž‹‹@E (@u 1} EEЉUh ɻЉ1K hj jR %=y _ڍe[^_Ív; cvfэf0G v8fэf(fҍf0GfЍf(эA0G.KGNx0WOvURj P򋅌 _UЉEԋE؉DžE`Ue[^_;}3 ȃaG.aGG.KGNuՃ23:#B% /j#@#UWVSEPu] T11҅x7UtB txt+u1ۃ uZF;8ڍe[^_@9uͅtPjrSŐUWVSE}uE W\WVj]u$E9FuU tu v +uɋtLJLJe[^_à W\LJLJe[^_ÍvUSQZ1҅t@PSu u"1҅uډЋ]UWVS }]g@u @z@ hVjjjSu uj 0g@ @~uuWSV%Gu fGfub)@G e[^_Ív@uu ڍe[^_ÉSu uha vuhVSi Ã.fGRPGPhaG ha軣vE! @ +@u:3 hb.봐UWVS<u] @u @ @ux1҈щ߹ыLSVhMQz uuuu=e[^_Ð uutEPVhDb) j1эY.˃x<.t6뉸1bzuQSVQ+Ƅ bމbމu[H@EH CPd ʈd~@u@ Mv}t*} t} CEt< t< u}e[^_Ã0d_ZPhbQE럃 CP 0@ Y^0hbd3 C P~~@@ }_ZphbPQuShHcMT=@t hb莒 pVuuhlc?HH@EsH E]HEGHE1UWVSDžtDžpDžlDžhg=@@@ @@$Hc@ofx@{@@f@5@x@ ddǀ`0Lh?hb|{W|hQp<;t<#tϿcu< d< \Ku< < c u< < !cu< |< t< t< VW|hQVtddh ʃ d|x`lnhJHH1ҍe[^_Ãt< T< T ۋT= $ R%@ F ЁwѡD4ҍh Th\TTT t tT K;BTd# V%@uMTTt;Vhbju#;txwD4%@tTۍxWdhhxhb9jTxBTd R%@u8TTt&;t!xӁwšD4%@tȃTۉxPd<hl\DŽhhhl$Ah\p:< T< T ShTQC`$3ƀ_'`hQ:PJ TtDžlp< Ti< aTm dPhTP`$Gƀ_`j Pg Ttc`TUTPDpHDžx)< tPxtTDžxTT:`\9 T< uTDžx뺃 h*cGFT6c@@@{fx@kfC@pV1F?`CDCHthS)5Gj.SwfT+@PV`$t h:cGETBRhPP`$Nƀ_Džp`TuTPDpHDžx4 tdxtTDžxDžlTT:R\9 T  uTDžxXىptx vTT t t vTT t tvTT t tfwPPdjSHt xTh "\DŽBBB Bz8TxBTd R%@TT;ӁwD4#hhvlTt- t( t# TTt < t< t< u⋅T=xۋT&x /t(xdFJx d]yIhDŽh3hDŽl\$Ahى1׹j5hj SDžDžAPPSTA u~xuwxB[tVqqRxMtTQppRt P)hhShlTt$ t TTt< t< u担TDžl7PVdjHdtT1tShjRlvU- tÐU j juUVS] S軶t*Cst P蟶 S蓶u؉e[^ÐUPtEHt\PuP uPuxt t?ÉHtX tt@t޺tٺP Ð@ %=t=@%뵺x /ÐUWVS\EEH1}:_<]w,EЍ_;uEE]sGG,t@x\FEE;us,t&]!Ћ]:u'uFEEE;urՐE9E~ ]}ĉ]?uEă\[^_ÉEyEx딋Eč}EEEEFE0vUVSƋBCB R耴څtۉuۋBF אe[^ÐUWVSPu~] t{NE;.9t3{t-uuxttfvtt$t2tA@9B@~&Y[^_Ð{:Y[^_Ð} 9E|ԅx ;E|ƋP@@8Bu9vY[^_Ív9gtЋB@9A@hBD9GD AD9BDAD9BDhZBD9GDIU1ɉtdd 9t u1ÍvUSQu 1҉Ћ]Ív u蝘CuUWVS8hcUԉEI:tEQPRjHUԋB PkÃ1t_C MԉCRqjP MԋASACSCB}St!EP VpuR ؍e[^_ÐQ WEqPߍvEԃ8_~UMЉ%=9=.&EdUEUWVS 1҉t St te[^_ËShE>ui} twІЋuuC1e[^_Ív z e[^_EAPj EPV~$uUt :VLE3 뗋CfP1kC5t 8t1҃RV)ƒҸ RvUjÐUWVS<ƋE EU1҅t e[^_ÐF1҅t8t+PEPW3HUE e[^1҉_ÃEPWHuًF;t EPډE jUUtЅv@ujvF;tu[ EPډ-EtA jUIu+uGUЅ @uEu P Uuxtă Uu]륉UWVS1}DžpDžhMUȅɉtEEEEEEEEEMAyqY]QuFt9t/DžpvE}pe[^_}u]tyutrdDžldx_UllxG9u鋽lGt܋Ot9u9t͍vDžp e P^vM% ==YUt tuB}uMuEU E4p}u}u=dDžldllE}u󥋝ltϋU9t Ct…ul]N9tFtvluO9tGttuuEulBtEulAtEU9U Et/1҅ppttCvt@u= YUPMEU ҰtEEEtS]Pjjjg P[  jjjE P9 ]=dDžldll9}u󥋽l9Eu΋]G9tGttuluQ9tAttuutEulCtEU EtDžn1҅tp=tB,t@u"}DžpEu pDžp]t]u0hu&DžPË[PuPu1jDžhDžp@PjjSt/DžpE:1҅@9j%uP u`+E`8PuVCu E\dtX{t[틍\{9WG<Pj P\5Ɖ89G[WttCPjjuEh PU E1҅E1҅wE  pEC jU yE1҉$}PWuh\ehchahePw H#1҉PuVu UEƒ `dP) 4V豤XQljjj|VjjXSDžDžXDž\Dž`)Džd&  |jjVPjS |GH9ȉLwL jPգXRjHV@PkHCFH;Lv W袣DžTP9T]X@%[PT@9T@C@Cs@8󥋵@Fdž<t eQhjWDž@DžDDžT HPW( 8P$ D@<5RHPPHxPxP@W@x@3HDžHFn1҃@<u Wp W{ XjEu PTy1҃8Eu PB%1 \Xo p[hhPXfMȋP~5P1҉TXœTu X"tE@ jU Q[uB} `譟R@9sD2@AuH9r닕HH;D|@@뢋@APh jRDžlo0DžDžDž< HPPa QhIi W@UWVS$}ȉ1Eȃ} Džt ~} t1e[^_É} ufBxfB fH +PSd S 蹶:} \6} ,} xxDžtDžp;r;pxx; p +PS| x յt S#$| $N: uC1сЋMttdt }  UEE|} t7} t1} t(U 9|tE|?|-} uƒ|t|u̓|t | ||tu*1}u󥃽|tE` SEBput@upt UuhuDž\Džd/dvudd PřlluDž`5Nh1(lh#B9htGd9rŋ`l4ȉ|\u~ 9|~\`vx\d9\}J\Ox-l4F 9F~^FV VN^ Oy\d9\Dž`du9`#`lʉFAƋd`9|F lt |%ZYPu $$ j$Puhej%z hPS趰  R 1򮍅+9ȉuVPQGhej%y FZUWVSl EDž@}1Eȉh?haxPh R8#tփhHP{thMV{tGDžtt< l< d\hMWV{tGS|th룃 P覢!h?haoUEe[^@_}󫋕BEEEEPEPh VuBGB G tڃ t vG| PhUEDže[^@_Ë҉B@uUWVSlӉE}1UEUj u=Et@EhMu>y@t?Rt8 t( t#UhMPyt@tuE}PEPjuE*ukEu Lvt"t uEvuދEtU҉BEt @uEtEEEEuEe[^_ÉE$MuUWVSxEPJ1tvE@E}ȉUȉUUBtXtSEPUR1IQShcu UEe[^_ÃEPUR1IQShcu距 yu}UEEtE䐅Et@u uˑ0vEUetEp u螑77UWVS(EEEhBE~gFEF^ E܋FE3@ hujjjSuujj0@ @uuSuy;E؉~eWWxufGuKvЃE@uA67 ulEe[^_ÉW뢍vE^6ÉfGRPGPhco6SuuhaWvuhuSÃ@u ȕe[^_à ha"\΃}tN]tZ#}ujU@+vUWVS<ƍӉ@tۉWtzPVhc6ts1҈щ߹ыLwo SVhMhQ Ue[^_ø1b|1эYwt |1.Yt0QSVQƄ끍vUWVSE0@p1}]߱}Eȉlh讍n h蔍tGpBtr~+3 WyXtme[^_ÅuڋtuEE}E]uEEMEuEE}EDžTDžPDžLDžHDžD@u 2@1ۄ҉tv.@u9Dž\v x.PhxPVUBEhPUpuut lA WXtUkEe[^_Ív@C;vDžXd9v[\uQ\ru4uX$FXT EP1҉\~8=H WXtߊe[^_Dž\WPUpuut0rlɉAlW@uKeuEE/HTP#xeDž@PD`@DBDžDA<.LLt=Ht3``@uL빃 MQ`. 8="(Ht@)@%@cGuDHkL] EP1҉h=wTr蛿@ PGAz WK:\%25@ @5GXDžHFUEE jjE PujEP 1@t8 t ?v ̀rÐUWVS@jjj4ltGPju]S; Sh i V@t VU؍e[^_à V EP1҅xՋ]1ts t~t'u ut*e[^_Ívus*u~ɐUWVSUEuU P uV< uk6ut;^t΃3utt3uu㐋M tu v cuEt!Uǂǂe[^_à P] Uǂǂe[^_ÐUSP1҅t@PSu u1҅uډЋ]UWVS|uEEEEEfEEEEEEE}ȃjjVjjW@  u覄jjVPjW Uč9؉vǍ9wvEEEHE+EU4 EP&E{MMMMM1}Uč9؋ufEEǍ9uG TufEGtfW fUEUO`MuPMGAUBQPWhRuMAUADEMEA G`PuuG`EEeUMJVjPGPQEPEP@ƉUU W8 5E}( SԂjjVjjW+ e[^_G fEGfG O`EfEMG`MLMMEPAMLM S,;uyMU 1e[^_f}~fEf9G f}eGEWOE1MEM F;#EtMEt EEEf}~fMf9O @f}eG[UBMABAGAEEEWU1 FЉ#EtMEt EEE뼋E S輀1 S謀E u蓀1yE.MMM1M F#EtEEt EtEEMM뷄uMMEEU1U FlOM#EtUEt EtT tnUU봃uMUJPuuQ<EEҋMIA΋UĉEEFEMARuuPUU뒋EMAU:uQujPMMgRuuuvNUUSRËu ~ǃ]É P ~ǃ]ÐUSP]tC][[~Y[Uh4h^s YÐUSP@Yt Ћ]Éh4h$Y:u Yu 1҉Ћ]à 5^uhjӲ1҅tP5^t S}1룍vUWVS ۉ }XZEPEPPPh*f dž uuhhP[u(}e[^_ÐEPEPPPSh*fuS|tdže[^1҉_Ð P1҅e[^_ÉUSP] u&h?h:f(E ]Ð PE ]ÉUSP])ǃǃǃX[ÍvUWVS<u GqQ6hú<+% j bu P誊t hhPjdždžPP1IQPh*f蒆  hhz%Ê<#hHS_t}hMS_lC< t< thHfSs_APj PS˳G9: =UBFz BhMW_tuGtoti< t-< t)9v;hMW^t;G‰h?h:ft^1ҍe[^_Ë% PhKfhR dždžu PWP1IQRhQf tP|WP1IQRh*fӃ 5 hh,<+WUqtPu.UQt PaÍvUSP21҅t@PSq1҅uډЋ]ÐUWVS(hU WuEPR]ƃ 1x)u;$u"CHCx6.Ee[^_ÍvSj.iSWV;C}ŃSj.eUuhu uGÐUWVSu]SEuEPu :ƃ 1x#щJu1;M} f.Ee[^_À|.uvUVShVhu uuà 1tuV~؍e[^ÐUWVS ]Sҋu }t vsV\t Sute[^_Åte[^_ÍvUUhtnw(htbwdbtV..bt7wQit(vkbvtQRh ih ^} ^É itw\iΉ Ttv'@(itȸb@룸5i떸tFF뮉)9܍vUWVS u9Ér )e[^_h$qhhqhp )e[^_UWVSM uMM} uQM1RPu Et?uct |.tCU;wX.CuM9v?@@UE u؉e[^_Ë<u듉߽MEUe[^_ÍvUWVS } 9Ӌur%RSP6Ѷ؉<$1e[^_}UWVSÉEE E׋UUu u9s3D39u uIxn+Ee[^_ÐPh3qtu u5qx)u ux CNs苼UEE Ue[^_UWVS u} E]ۉEuBB9v;)ʍBvVWq`x8Ky1e[^_ÃVW4xָ͋EEUWVS|:E(M$M U01tuP*AU,E$M4E0QP7qDž#Pu4u0u!DžM4 QU0& uGPu PhYxPۈU4RM0Q‰ƍx DžU4PRM0QW35Džd}#}$pU4RM0Q‹EDž&E,t },?U|2.t0M4Q}0W6WDžFPE4PU0Rj~ǃDžo E PhqxQXZ}4E0WPxDžWM0Qu,E PU EDžbnxQSu u$X1߹ZE4PQM0Q뭃}$ u xnËE PU PpU xE $enE $VSL PhpqxQƃE4PU0Rx!Dž u99 u mE $c PhI7xQ~_ƍ}4XWE0PxDž4 u mE $ PhI7xR$Y[W}0Wx\Dž u ,m E PhqxPׁXZU4RWx Dž}4WE0Pu,E PU EDžahRU )PRDž w19}n1эE4PQM0QZ3)ڃ0~0}4WM0Q)09|}4WE0P=}$ u kU JM JZM JU $SPh|qxRhM4Q}0WxDžhXPU )PRHDž 19}n1}4WE0PэQ)ڃ0~0M4QX}0W09|SE4PU0Rq}$u4u0u jv}01э}4A<$}$Xu4u0u jpv}01эU4A$U0 U BE BPhqxQ~_ƍ}4XWE0PxDžE @E 1Dž; @E yvu/U4RM0QqwDž QWhxP*~XZU4RM0Qx]6GwE \}$ u i E PhqxW}[XE4PU0RDžuM4Q}0Wu,] SU EDžFE4PWDžM4QWu,SyM4Q}0WeU4RM0Qu,E PU EeDž] )߉1G9] )tȃ W PhxPn|[ƍU4XRM0Qxyy}$w u pgƋE E $]gËE E $JgE $SVhqS{}4WE0P }$ u gËE E $fE PShq8S{}4WƍE0PDžXE M0WQDž-{E WE0PuDžE M0WQDžE WE0PDžE M0WQ6DžmE E0WP}$u4u0u jq}01эU4A$U0J}4WE0Pu,] SU EpDžWM0Q,DžWE0Pu,SE ;}4WU0R0E ;E r뵃xSu )W}0Wf] r RsdE ^XWE0PqSDžQShxRxXZW}0WxDžPE4PWj@DžoM4Q}0W qDž@ u cE ^XE4PWqDžQu4u0SDž M4Q }4 WE0PjuDžU4RM0Q qDžu u bE XZ}4WE0PqDž6Pu4u0SDž WU0> W}0WjDžE4PU0Rq)Dž u bE ^_M4Q}0WúqDžmQu4u0SDžI E4Pq U4RWjDž}4WE0P q\Dž u @aE XZWM0Qq DžPu4u0S6Dž WU0[XWU0RqDžHQW}0WjDžE4PU0Rq mxU4RWHeQDžDžqG3}4E0WPq W}0WHeDžqDžq7UuuuuU  PPP:Mu6PA)PRaÐUWVS u É׉E~BWS]xAUҍXtP9w-H 9w&@R ЍN9w +Ee[^_蹥(e[^_ÉUWVS]E ؋}Ej0j^WwEK9GwvfC fGˍI;Mw[fC fG 1;Mw@QfA fDw FˍI~1vfDw fu.DF~;]t<(e[^_ÍvPVUx׉\G$G(G,e[^1_UWVS } u];~$tD~$F(F,zD~ 9mF(9~DF,F(1ك)VQWCF, F,^(huPv6@[ V,B;FV,<fR ‹EfV,BJ;FN,RfA ЋUfV,JN,B;FAR A A ‹EV,BJ;FN,BfQ ‹Mf V,V,E  ;FwkEN,F(1҉e[^_Éߢe[^_É^(ZMǁfǁ ǁF(1멐蓢(벐UWVSl11} MEAUAEEUȈÃEЈNJUE ÊE? Am ?nF r>F r>UF r>F}  EEڊUEȈUوE؋E 1EEE vDAB;U rM؈UوÃȈNJEڃ Ӏ?FE=F;us }7l[^_ÊUȈU؊EUEوUOt=뽊EȈE؊UEUوE2tUȈU؊UEUںE멐UWVS u1EvFӁ R${%@uЃ=cSh r StM t}9}# r(ȋ] };E1Fgv=uEe[^_ÍvD4Q} [MA;M- r] };л r(U D:M] <MA;Msr- r]} л r(UDME tE9Es*й r(] };dFt v t(Ӂvs Ry%@tFu؃=FtVӁv* RAy%@uظǡD4סD4뎋]KU fU M< P]KqUSPEM U]tRQPShdr5R Tq RQShr@U w BÍvBUWVS }EG}.+/€D4%tӁ R=61ƊGЁvq RD=wz6tpڋu E ؈EvGt E9EEe[^_à R?w3v4덡451UWVSQUҋ}] Utr~19}DB H0CB ,0Fu 9}.Bv9|EZ[^_É7ҍv7붺^U널UWVS }EEE1GtqÀ< S/v%wK5tAtCEvGuU~EuvE Ue[^1_ÉMvM Su%tv< S;ÃCw|$rD4BD4봐4č)ƍv4v4v4u1EE e[^_UWVSLRPh?qEPu }gÍ@;wEP7s)1ҍe[^_ÍvUWVS,E <1҉EE񹉈EUv)ƻ1󸫪U1ع%I$EЉ)UE1EE;gEu|E܅teK~RutHÀu8 Ss%tvo SaFuU +Ue[^_Åu}uuEPE PSEdxCaD4끐4됃EPE PWEvEPE PDCECEPE PHECvEPE PMClUVSMɍD x,D ҋst99H}pJu[^É9H}pJ@)[^ÐUWVS uu 1tmUB8HtiUBxp9u}s2vRSE0WǏU$蚐)ރuGEX9rPVU2W蘏E)p0Ee[^_Ð@UBy1B)uE1u e[^_ÐUVS$uu'Vuu u$á$u6e[^Ð VVuu uá$t͍v Ve[^ÐUVS$uu^u'e[^É V$^t܍v V迅e[^ÐUVS$uu^ u)e[^à V軄^ $tؐ V_e[^ÐUWS U1эAE܉UES:EM $E؅ɉEEuF@8Pu@EP5^tۃ $Kue[_à 5말 5螄e[_ÐUu uRPoÍvUuu uRP~UWVS uEӋ} uPR2t ËRWuP`e[^_QhtshsjvU1;EsE ÍvUWVS E1v&uSUZYt PU F9wۃ u1e[^_ÉUE E EEvUVS] usvuE Ee[^ve[^ÐUWVS1ۃ 9}؅uC9| 681e[^_É P1CӐUWVS 1a$j SaPu)t*G9rكj haEa-ae[^_Ë~uSj uVU^e[^_ËVF.UEPUWVS4]S} jCP Chpj5aate[^_Í S‰ jRhshS =jS/h%sPSPP҃t;@t PhshsjDžjhaapZYhpjaa'Vhshsj}vhjRPk떃 Dž$hsh9sj& WUS]3c.CtSu;@tE]z]Ívs s҃CϐUSQ$uihj aaaXZhjaaau]à haG]Ív haG녉UWVS$h}َhɉdt ha袆E$PhNst11҅a9E+h?hNsChj aaXZahjaaa 5NZYhpj aaaEaz҉t諍de[^_Phpj 5aaEiPl@`1;`lpE\E t8U t/1ېE 4p~ U uQhpj5aapt Pt&u\phshsj DžtG;`-h ha蒄Zde[^_à hac1҅s haQ$a]v\ xU|hjp pxPO @ tR$EVPtuҋlD GU DtT뺉lDž`?``Džu haft4j haZU hr. haւƃ븐UWVS<uÉ0DžE4!PP1IQSU4!4 PSr<ƄX(j S thM ËEM ACE@tZ`qe[^_Ð 4!P7.q̉Džu7QHu_@ t=uuJDžWujLHPU B@J r< t< uCvEUM ,,!EAhMS t @1򮋅+9ȉ QPSS< < E(;hMS t @1΋+9|URPSgRJCB蕇/e[^1_nUctcu uRVUWVS<]tt%tj.uVPShLtPuu Se[^_ÍvUWVS tD{\ps\`GPWU EIR\ۉpt1e[^_n1UWVS tE\p \`GRPWuU E[ۉpt1e[^_m1UMȃʃq1ÍvUSMȃʃ˃q13]UVSu]F9}Å~PSu 6~)^e[1^ÍvUVSp=H bt e[^ÍvPjhh4t]SEjEO jjuV5H{@t  b buPjhhEtSPO jjV5HC@tN b|Qjjj4H]RjjP=H9= b0QjhhRtSN jjV5H@u b 5H轃HvUMtbɉbttubÍv LtsbÍvUWVS u} u2 $uLDu\$fe[^_ÉSVhttj# $tv hbczDt;L `Dždjjhj`R. DJ \SL VhD7XZPS# Ph[tD7b bubtDPs6bbshZW PDžTjjhjPP.  t2<%uWm%SPj6GuЃSjU6$zƅPuWDXDy+d pb =bjSP5HX8 87t/Ht P舀H b jJjSR5H7 &= bt 贀87tbVjjhbtj>P@h)Ѓ )ÉlDžpeDžthjPV@w4$ hb[we[^_ 5LPj@PL(YXSRG3GDjjhkH^q{d PhotD4@ D%n+dH bjb*Hx)ЉH+H|DžS:DžPjxPjvKSj%3XZSj%G}3 Dw"UE Pu uÐUWVS $}u ]u9 ST5$u e[^_ÍvEbe[^_u hbSu뵉U$uQ 5H}$Hb buÍv hb#uÉ hbt띉UVS$uuDt5Du#e[^É hbt$ʐ hbte[^ÐUÐUu ukÐUÍvUht1UhtÐU帚tÉUM tvÉUht1Uht1Uhtt1UEt`|vb̀rÐw|vàrÐUWVS u F]Et01эyCt :EuPWVSuKe[^_Íe[^1_ÐUWVSQ]CU t/ MzvU҉tsv9tAuCuZ[^1_Z[^_UWVSLu1ۅ~E; Mɍ]E ̍v1KUEEuۋMxgK K:Ruh*u E uSu Fe[^_PuU4@u E;Er؍e"[^_K-SU hh buu bÉzɸ bÐUWVS1}Sƃ1t PSuVse[^_UWVS u} E3v PCEG=v: PyC9Eu8Ftp=wċU싄4EG=wƋU싄49EtӁw<4Wv> R C)Ã؍e[^_Ée[^1_à RBWw¡4)ÉUWVS uE }EU9 PBEUB=UvC PsB9EuIGt:Nt7=wU苄4EUB=UwU苄4뽐1e[^_=w*U苜4UB=v" PA)Ãă PAÃЋU苄4)É뤐UWVS ]ۋ} t*E48VuUt~E<Ku׍e[^1_Íe[^_ÐSD$L$ T$@AJt}tm8ui@AJtnt^8uZ@AJt_tO8uK@AJtPt@8u<@AJtAt18u-@AJt2t"8u@AJt#t8u@AJtt8t )[1[SD$L$ 8t@u1[ÐUS1 A ƒ~[áHjUPXSTX~"qvCSIPuDj1Ƀ)vpqP@AP9[ÐUWVS#É`tC_<:df؉֙t/vUt3t[MIMEE [^_EUu͋uV)ȉEMIMEE [^_ÉME@ O1ɃE~5EE4vt)AE9݋E љ}zKQ։)ƍˍ  )ÍL gfff)ȅۍ…6)@֙MA)Ep~$EEUtS9}A9Ή)EMIMEE [^_ÍvMuV)ȍMM ;ESP 0F UWVSMɉÉUEE1IˁMEUOut U;EE@@EU؉LǂPǂT}G}UҋEtsUD}G =w)Pu]LuSx6]}Cu1ҍe[^_E1VuuSB6};ωUB 뒋E4+EEv;tU'ú덉؉]+}É}iE-Eut'ZuZu<,M<;E#EX11ɃUPpA91Ƀ}9PuA91Ƀ~~UP}9\u E)DLP؅uA9<,<;Uú>vEU؉LǂPǂTE؉`ǂd}G}hBCUȉúC<,U8E@@EU؉LǂP}G}TE؉։Ӊ`ǂdǂhEEvuEPUEuURNjUE9~sC>C1Eu&dEיufEיu u)EE}hJv>C닋LUSSø(uu]à jڸ(uG]ÍvUx!1@jCu É@jU$u%$uÐ h$j_É h$j^ɉUWS hjuҎ~ShX1I1;ug@jDjHjqqqh(uhAAe[_ve[_Ð@jtڀ;:t j@jt@j1뱍ve[_YSh@6U$u%$uÐ h$j]É h$jO]ɉUWVS$M UMU 11IWʐ;LL*Iy躀Q؉љEE)yOvQEQй]Cй<CEљ]SEUxA1Eu)dEәfEә u;EmEәM}+UKҍ…ۉM܍<"QUԉEЋE))ƋE)؋]KDžۉQUԉEЋE))ƋE)؍)NjU)}UM€QM€Qx u;EE-lUB ]ȋMZAt9tv]C @)MC]9~EUM@B B J$$[^_ÐutpBC71tfp;HɿD@9LH@9PxIGkD@9LtWvp딍vUVSE DjɋuEto9Pjg~9PjB9pvV@jh@jLLESV CPF(e[^Ðq1҅t HjqB9}tB9|1늉UVS$uts h(jrYdxz h(jYX5dX h$j3Yj SjV$$jFYe[^ÐCPh jV e[^Ðh0hdbXi h(jX1ʉ j,&Ã1tS5dZPUSS $ɋ] u&RSju$u9؋]É h$jKXRSju$tʍv h$jKX؃]ÐUVSEE$u ]uGtZ $upSh EXZtC(Xe[^C(le[^É h jWuv  $t h jW{vUVS$ҋutN h,j9WhxQ h,jPWX5hVt[PSjVe[^Ph jV e[^Éh0hhRVy h,jV1͉ j,Ã1tS5hWyUS] Sju_؋]U h u uB ÍvUuEj U@u EPuP ÐUS 191[ÉUWVSSE ɉ׋]xșƉ)EY[^_볍v҉Й։)EY[^_뎉U@+Bu'A+BuA +B uA+BuA+Bu+vÉUWVS|ExtU Ep }|u]j<^jEĉYUj EZlEMą%]̋}ȁnO~F1u(dי4fי! u)MĺE+%Mān~']̋}EEMċ]̋}Dž4u%ؙdu ؙfu Dž4444t9~E)EčG vEȉDž4t444t9EICE̅8U;Džhvl=XhEEPEPtURxUEH;K)Efљu DžDD uMąɉME]u[}ȋũ~FDžDudљu뉍v u)MĺEe[^_jUSjEP]}xUtЋ]Ð5v̀rÐ5v̀rÐ5v!̀rÐUSMt]U vBCtIuE[ÐCIuE[ÐUWVu} S]tItBCuutBu[)^B_ÐUWVSEP]u ىt 9tJAu)ډӉ)u1эD[^_Ð>tvtJAG?u)[^_ÐUWVS u R%@t#>FwڡD4%@u݉<-U+EJ}}Mu10DEE1"Ewl1ҸuщEC< w4v;E}9Uxw;}wrtlE}NJFC< vύC<w`7;E|ǃ}3M tUҋEtFU e[^_Ív9~EF딉C<wW[0 FwڡD4%@u݉<-Y+EN}}Mu10DEE1"Ewp}-1uщEC< w2;E}9Uxw;}wrtlE}NJFC< vύC<w`7;E|ǃ}&M tUҋEtFU e[^_Ív9~EF딉C<wW[0 FZv 4$. $u2 V}e[^_v F P8뙍v ^ ST$  V蜵}e[^_nv̀rÐUWVS UEEMEtF}E9v1+uWVU ~]vFAKu+};}wϋEEMue[^_UWVS\}e] 1EEh] ] CP谴EȋMȃɸnUE} EĉUuuU Mȃuȉʃ3E EEȉEEE9Mĉ΋EȃU9ЉM̉uEEEu+EEċM9uMEЉEtEEE+EEĉE̋E9Es U9jU9UlMM܋ũ9MrM̋U uM9u_Eȋ}ĉEċE EE}ȃU9M9M uF1e[^_ËU܊BU܈MG9sU܊BU܈MG9rlM9M]U9Uv+m]SuU;EV]؋M9Mw׋u؋UE9UԉE=]vU9UrM܋mMuu9uE9EuuUlUM̉Uԋu܉MEEu4u;u\VuU;EFE}uEEESuU;EeU;]rڋ]+]9ދEU9ЉEvE)1uESuU;E]؋E9ErEEu9uUt3UMЃ9ʉUrM̋U u9uMuFuEG9ZuFuEG9rBM܋EЋuMԉEEE PE )EuEuE2XEZ+EċUȍDuĉEMPMVUUE9UċEȍHME;]EU+EEȃEE~E FAJu+uU9GM벍vUBUG9rM܊AM܈GMIM܊AM܈GMu3SuU;E]UPWU;Eu }E;}rփ}"};}s`W+]SU;Et;U+EEȃEE~ًUFAJu+M9r};}rE~+MUFAJu+M9r;}U+EEȉE1};uEFM$vM މMEtNM܋9MrumuumuuvU܊BU܈G9rMAMGMMAMGMukEW+EPUUE Eu uPVuQREăEC;D$T$@BtX8 uT@BtL8 uH@Bt@8 u<@Bt48 u0@Bt(8 u$@Bt8 u@Bt8 u @Bt8 t)ÐUVS juެÃ۸tL$u^V$JABKFC FCV$tXV$F$C$u Ce[^Ð F P,v F P둍vUVSuF$U  9St ue[^ÅtF9Ct\C jRP6C C FFKu:C]e[^v VotԋC9F|ʋC ;FuCBUVSuF$tv ؋P諫uF$e[^UWVS M9} ]uUt [^_vyt(t >1t:AwZ$wt >twf1 [^_c5 ,     UWVS u~V9|YFu1FFtNN uffAft]؋F)@9PFtyuFuȍe[^_ÉuFuFPvv 6yljF~V됍e[^1_ÉUVS$ҋut* ^ S.4$2$Le[^à Ve[^ÐUWVS ] E 5$tu C PE$tH} ur uYg UۉuOE1e[^_É S[tH}  tt U E  v̀rÐ v̀rÐUWVS ҋ}EPu sƃ1tfPjjW 0Ã1xPڃt E9ue]1t/fr Eu/fzRB$B,(B(<B PЍe[^_ÉủfB W 1ȐvỳrÐvÌrÐUuu jujhÐUVS$ҋ]u&CHCx30@$u:e[^Ð SCHCyΐ Sơ$tǐ Se[^ÐUVSUBrtC~wt\[1^Ívau<+u11ۊ<+tC=C<CCCBCAC@1҉DGDDDFDEDEDFDDDGSVSVB~jjjW!Ѓ@tWRhVWetB1=t NF<8t jjsP8S" t˸e[^_Íe[^1_kO`,ϐUWVS4jP31u-t1ۃ~8u=C9t P\ Vl1e[^_Ív PKC9믃 0H 4H@uσ 1L8@8,48eUWVSjpÉtMKjPjEt11K} B9|1e[^_0Y0܍vUWVS<} HuhjÃ1ǃDžt -8Džt:PuWV#E@WjjW#Et MAu PhSH$'&C%C$CC #C"C!C CCCC C C C C C CCCCCCCCCCCCC CC C CC C C CCC C C!C"C#C$C$C%C&C'C(C(C)C*C+C,C,C-C.C/C0C0C1C2C3C4C4C5C6C7C8C8C9C:C;CC?C@C@CACBCC1ҍDDADDADEADFDGfSfGSSB~Ou-;au%CHwj hw ;C@t Z Sj81e[^_DžC8CC C CCCC4 RhjCDPS1P(PV@1҅҉}tUB hS+10t t 4ǃ$j$DX@@$@ t@ X$@#@ %@e[^_ÃEPVB?AV83EP =t71^QPlg8CH{4@ P%@DDDHK C$j PAQS yOD?K0K(C,K@C<{ PR%9S}S1x18 P$C=C K{(ωǃ1[C K DD|C 88UVuStFk VL؍e[^ÍvUSQU ҋEu`tX41҅u Ћ]ÉPjjS9(u otЋ]Ívǃ01҉Ћ]0эvUS u]u #C,9C(}#C0]ÍvUWVS,EUp E@EԋUUjj PRuPu#Etp]]{K}ȉ}EE9E؉E}.UfZfvG);u-EEE9E|ҋEHy]ce[^_Ívffwà uuuuuƚ EFEEEPu袛fjuPu"EPUȉU M܃EE]s E0vjuUPu"EHMȉM]܃EE}w EE̋M9ɋuЉ}}7}>Suuu迃E`1ҍe[^_u uuuuMa1Ӌ}g_UbN]c=E@EȋUfDPfvrEȋ] }؋UzTz)ЉC\MMVuuuuu uuuAMa ju Ruu腛 }gvUVSUEҋu MXtu#t8M u҉[^Bǃ,e[^Qǃ,vUSPEXEM UuU MY1[ ǃ,Z[USSE}U Xw@tUE Yغ[ǃ,Z[ǃ,UWVS UEҋXtt $xmth1ɋ 2H(f|QtjHǃ(fyuTjPQPS u̺e[^_ǃ$ǃ(ǃ uf9uǃ $f9Uf(f|q qBU fqDq)ЋU B DqBUTqq)ЋUBf99syǃ $ǃ(1ҍe[^_Ë$S(9r7jjVS Hf9uyFǃ(S(9s9h$~1҉(떋C > juu PS葛 1e}ǃ,lS(딺ǃ$XvUWVSu~(GV0!~(UNU9;F9~~jv{UtLF( @P,‹F 9} DDDDV F,9sF0 F,PWuV裋e[^_Ív PMEútPuS譸E +EPM jR=XيEFUWVS u1ۅHHuXt[=wtIt.C>t P* S:1e[^_ÐTDžT\u`Dž\u Dž`d.Džd h$诉tRh$jPǃdǃ\`ǃ$$JƉC1 󫁻t ^F9F`UF @1F 1FdIFdF8EfE NePuu uE2OPjj@5EPUE XH  ǃǃ XLXyt!DL9sL‹T:11ҍGTf3fǃQj9+ Wjj3QjP3շE t @E@t E PvHDž\DžLDžHDždDžTDž`DžX==& e } =1 Phxh(P8l<$ (RWj.( $,t (P Pj(RjGv E=-DžXXHDžX9 VfX} PjhP`hb1 h$'h&i%j$kl #l"m!n oppqrsttuvwxxyz{||}~hb1u l]O/XSh6hD3PԳ8 R3r Q3P @@f@fGG tft Rj3 j  hx! ǃp=|_rX txUSPEXCu u&]ÉPjs37C]ÐUWVS EXCEPEPu S~ƃt}uQj63e[^_ÍvRjPujjVS !@u.Ce[^_ÍvPjs3kCbPj63P,yUUUUPUPUPPUUPUHQUQUQPUUPUHQUQUQP UUP UH QUQUQPUUPUHQUQUQPUUPHEAEAEAÍvUWVSDE ME EEEAEAEAAEEAEAEAEAAEEAEA EA EA A EEA EA EAEAfAfEEAEAfAfEEAEAQ A'tD[^_ÉAD[^_ft1fDyfEʊEˈDyEʈDyDyEĊELjEƈBEňBEĈBEEÈEˆBEBEBBt;EEEBEBEBEEEBEBEBtAEEEBEBEBEEEBEBEBvGfNf}1ۉfDYfEފE߈DYEވDYDYE؊EۈEڈBEوBE؈BEԊGGBGBEԈBt1 xK94;XtE{/E6Et+hV&={EPV1҃8IvEPV1҅/&E%=@Uj1jEUu1҉UvUj1jEUu1҉UjjUEtUUu jUEtUÐUWVSjdhP裹 jjh_xpxPjttPSS$#Dž\dRVd UUW@UdWt:V\G*hGGVdҊDD9D\\yDž`vWrWdL8VӉ$VDdD:$L`yZ e[^_ËīU҉u(1D@=~BīÐU ȫtÉ*ȫÉU$u1$uÍv h#É h뽉UWVSEEE E$!Tp1FȢªƠ؈E}EEEGªªª~$ue[^_Ee[^_Z h_UWVS $iBҊªªªªȊªªªªªҊªª NJªªȈªª ǠȊªӈۢªªЈªª ǡ$u"e[^_à hv he[^_ÐUM1@9rÐUE 1҅SMtXw $lxv[ÉAAAAAAAKtA닐UWVSE}EESEXtU 9S t1ۋEuEt5CBCCCe[^_ÉfEu^& jm1҅tj w mF vU V FU4MqFFF0҉ju1}Pu rWa E ]MEU OE I!MOꋇUMÃEEu0E|VPVF Vfft fDBfE6ۉ]؃t<_KF O!Ë00Eu  u~EX@]KoE;C bSfft fDBfEރujCBCBCXCKC C{e[^1_H jjs sWeb x1vF jQv vW2b 1҅^ Vk1US]C E HK}R[ÍvUWVS }1҅t[Í9tMK uCtUtCuTE t9Cu6SPS Shj9u1ҍe[^_Ív뜃 P?j뼉 jPs sWa t뼐UE SP]QP QPBP@@ @[UWVS\ExG }r!}te[^_ÐEE UZpf99w99]PSu WZ@tEEEVjSP谖M A EjEPEP蕖E؃ME Uu܋Zf9vS]SuW@EȉEEQjSP:MA EjEPEPEMEU r]f}TMSQu WdEEEUfR}fUvuEELUBM A EEfXfHE)9VFf;EEUAfBf+]fZMf\JӋU BMAEPr2CS U MZq1SG(tuU9Gcu"MYAH9EPRju7g} N e[^1҉_ÍvPjw77GG(   MMQuu W@Sju7ܖvQuuuuu uWV EPj7舘fGfO UBU B Ss)9r4\Cu fuwPVu W|LJVjS71ErLʉMMRjP7R+EPUMQPRPEfXfHUJ!f}LJfLJRjw7MEKfOfM6fGf;E@fGLJfEfPMAP0WI]CFH9wPVu W+{tKfG @fG f1ELJzktfLJfG 븐UVSƋBu@Cu 1e[^RjP6)ɸtCAPjQ6ȐRjP6ɸtCAPjQ6두UWVSǍ@,UE;EXۉQjp7蓕tWf[f]UDP0CuJFH>DuVWΐse[^_ÉC PW|@uQjV7f^Ãf+UfJtfAf;EsEffJuf^CfFPjV7ђU:t6UX1ۅt luWtSjR7腒1@ EF)RSPEP蓏UfVEfDFfENfUJf!ff;EsEffFfFF )UWVSUB(tMUDQCCUp B)WSPPڎMfqEUf|AJMftff9sfJfuUfZÃf+UfJtfAf9sffJuMfYCUfBMA(tu 9A1ҍe[^_Ë؃ Puz@ҋM9BB;Eփ} fE  uTEUBH;EMuUBrMAH;EEUMUfMtMNTC Puy@ CGfQ;EB1fAPjjjFPPEPuXt tMSQWE@uUfEvNEEfFEHfEPEPWMuMuNARjPE06hEUPRWufEuNPjSM1^RjPM1ߐE@HfEPEPWu'uuCN룋EfEPjjjSSURuM s EQjSU2kPjSE0UUWVSTtPj VugkvUWVSLÉU1UȉUEEEvUG~uA}U;}UvwX$xCt%utCECBZ$xUEEP TUG;}~tE9t RJSe[^_ËU܋UR  P SU9EEEU뚋U MEE;EU9U~EEUEBUE-MElE;E%U9U~EEUEBUMEE;EU9U~EEUEBU}MEE;EU9U~EEUEBU `Dž({ Dž({UȋEU$UȋEyM$\ȃO u%  PIA((Dž(  P! IA' P IA P PK IA (jj 0(OB X$(CE@EЃ$EQUȋExU$0$CE@EЃ$E u t1$ BE@EЃ$E Dۅ~n~8$@$E@EE)ȋ$YE@]Ѓ$E DL+(;~~-$(qE@uЃ$Ew)Å~4$BE@E$Ex̋$X$E@]ЃEUȋEU$UȋExU$UȋETM$gUȋE0M$1EE HPqEEHEEL9(v(u #$ CE@EЃ$EUȋETU$Dž jj VSz0Ot<t;jj VS3|у ÉuPIA \PIA \-eEA0FPSIA \A@ ODžB<VhhXS SP7IAP(SR PPVRȉƒ EE1ɉP[CLU؉MPLPHPDPQR6( @q @PI[CgEEU @P[CYw 0P&I 1 @;P[C @UPC[C LEE z1(эq@P{IAEE[,$UȋEE$h`Dž({ Dž({ƅ3JEEHEEH EEHEEEEHEEfEEEE0F,1HEEPҋv((,ƅWƅWxDž\zƅ pEE%ƅ9- PIA} PIAEEHC PIA EE HX XPqI PIA"UȋE7E$ PIA! P^I PI닋EEDžzL)Љ$YE@]Ѓ$E (8UȋEH]$UȋE']$9)Éu4Phh`SzSj4Pj;ƃ1(jj VS0(ADžjj oOÉP[CEE1EEP[CaEEOP[CPIA~EE EEEE1Pi[C|EE1EE1  PPPE P1EE)DžTEEEE EE7UȋED]$fEEEEEEAEEEE. B @PIAfUȋET]$UȋE+E$EЅuE1UȋEt vPt4IAMEE$EEΉ(эBf1 (tBЋ(ӍBЃ v$Pth[CPtP PPE H,녋EE뚋PҋtEv((, MfI @UfJ @ PPPE iPuEE념UVS$uu'Puu Vá$u4e[^Ív VGkPuu Vá$t͐ Vke[^ÐUEPuuu uelEUÐUEt Puju uà Puju uUEMU tEU M `EU M UEL1ÐUÉUU 1ҋMt}tt1:ÍvUMɋU tw zVɸUWVS u]Mt9IE 1tKtBt@IGuM e[^_PSjE 0Kbƒ҉tߋM +e[^_ËE ÉUWVS u]MtAIU 1t%KtwQFtYIGuߍvU  [^_ËU ۉttwKu [^)_yV븋E 뫐UVS@1ftK4fJu[^ÐUSjR0ItH RjP3G1҉Ћ]ÐUWVS EfӋ}fCfCG 4tmGFfCfCfC4E @ tK@U FC QjC SfCE0Ge[^1_É듍vE 봉UWVS Efփ fFfF0ECF U B< fFf)fFfF0U P7G PCS}CGu,F SjF fFVE0 F1ҍe[^_ËW E9@uvE H fFf)WRfFfF0QSCU CsJvUWVSLEUEEffEҋUffMffEfMfEfE]Cf9EfEEf9E[UB UHMEDA4 ~Ef9EwEDU9EUH9Uf9Ut+MfEfAf)fDQfARSVPAfEDUf9fEr t}tEMfEf9M"]UfCDPfCUBtM]9CEf9EUfEU܋Uf9UfEE֋M|Af]f9]UB HM4 fE֋M fAUf)fDQfARSVP@]fEf9]rU ]fBMf9]ҍHU fBE܍e[^_É MEDA41.toM4Bv]4FX )fEfE]1]EDC4FX U4M MfE֋]f)nUEDB41wfBE܍e[^_fJf;MrAfJf;MsUMAFfM] ]Cf+MfJUWVSǍEUPW?EPW?tmEEFCfCCFfFfCfFUB C F uuSVUU2U e[^_Íe[^1_ÉUWVSEEPu?ƃ1MfFU싂fFGFFG F GuEG9 EXCGCfCU싂fCG C Gt2QjP2BEUBQjRE0~@uuVSEE USW=9]tG SE8U 2Ee[^_ÐOfFUfE8U 2e[^_Ív}봃 Sz1SjVU2?1UWVSLE fEE 8}]SURMQEPU E6ƃvfFf)UfDVfFU 0UBGM Pr2CSy< EXw7Se<U :U,Uu >WMQEPURU EEMA zH1fFUf)fDVfFEDF0PWuS;UCUE 8u-U uu‹E@xPjuċM17> juE0%>U;EXۉMUMĉUVjpM1?fSBfUMA wH"UBЉE̋8 f^V)ʍG9nAfUf9CfFMEA fFf)UfDVfFEDF0EuMȋUMȊAWECuPEȃ PS%:Eȃ@ZP E@HPjuċU2< juM1<WGM Pw7CS9U :]M uuU Ew@/PjuE0A< juU2/<XMqie[^_Ét zb^fEfDF0UBCfFUf)fDVfFEDFM0ACUWjVE0s;PjuM1`; juE0N;e[^1_ËMAȉEȋ8E tkE@ub^ufvUUBDЋ U܉E؋UȋEԉЃ EЍEPEPщE 9s EuuU EBv)VQPBPR7f^WMQEPURE-\EPT`fEftTDF0EUċCfFUf)fDVfFEDF0EMCIEPTSURMQEPU Euu1?>UWVS ] SRPEUEM1E  E8pPjSM19Epf@fuTG]9tPjWE08PjwU2:U@fBHMfAPQuuuNU9_MfAfmMQ A9t;MQMQ1e[^_Ë9tQjWE088UrՋYRjQU28۸tPjSM19ǃtEf@8|M9t wPjSE07\USS]Cu!U C(SUfSC(]Ív PC CU C(SUfSC(]UWVSEpF]u_ w"${vF( w-$ |ge[^_ÉUfEv1t(؍e[^_ÉPjv66F눍vPEPE0V jPuPu EPV !@JEF늍~GEPEVPX4v@B %B\PjR66PjS67u2@)B 7DB\PjR65PjS67uE t P!YfPjv6D7ɸ`t0 fEމMfE@Wju653GfGf}A9uYPjQ64۸PjS66ɸfEovPjR64UBHfEGt)GMfGfEqEPEPU fff}t fMYPjQ64۸,WjS65ɸAHfEUWVSEU,JMQjSE05UBfE@ft8fMf4Efp Ruu P~FfuKfuG fuffEUfpDG\8PjW22QjSE04@1e[^_G tUEM  u#f}u GGU9t"MEfUfP MAe[^_ËGtVjwM1F4EtfEESPu uQjWE02EUMAQ EAPjw13EB@HfEPEPu u(u1PjWE01EURjuU21PjuU2|1UWVS|E ]U %=EE@u#UQju h +e[^_ÉcEEPEPu u?U E%EE]E% ?EmE]X|E} h|x|Mp|fE fEEmUmEE@tM}Ew#U~EEuJUE+]O E}EUEUU} vE1ۃ}Ã}~m1ۃ}EE$|E'}ut@Sju hH|e%E 3EUVju hL|%EE UUUU u)}EE~ }tE} ]EEUM ߉~tt EB EuUEt2Eu'E~ E kɋEEMUBR $\|]؋Em@Q%`|EEEEU EEE]]ME}uU~}fEִ EfE?J]MB0EEA@MLM9MK kE]Em]m֋UR $ɃEUt뗋MɋuEEt,U3EE EEj[5E~E~U9U~uM)M))MEȅ~8Euuv6E[_uP 5Yu2] j4U҉E~uP46E1ۃ}~Et }EE@EEt +EE}mUUU}̅~uu7EM~uu6EUEJEE~Vu6EEۉEEiUEĈMB9MUQjj ug2EE9EePjj uH2 Ejj u62EEuu/&0EY[uu7XZuuM7Ë@  S 1u}tEu E|"}EUBuz~N}~EtA}~3juv5E^_uPd69Eă}:EMĈ@EvPjj u#1EE]Euu%0EĈUBuz~kM9M|}T}t&ju4E[^uP5ME89uU9U%MM99tEE u/Mt+UtM9Mt u}/ uo/ ua/EE@UE tEM Ee[^_ÐSu5ƃ Rjj P/EEk]E荈2 M~^@+M⍈E ‰1RP,$]mm3E}REMMM> +MU몃}+EM)MىME߉}Euu1EVuu3MPjj u.EEEEU Bt/M)MFu EMU:0tBUE6M)M@EEEHɉMMEEEEEE5 ]-ً})[U}4}fEeش k]EfE6EEU9U.]UmUm֋UR$$B0U]EEBEUuك}~]t}EUE@MU:9uM9MME89tEEE]E ODEE4듃}t }Ex9jjue,EPu^1~M1EAM؋U҉U}REE|`|Et뭃 p-*UJlj֍  ^_jP/E E}}fEMش [k]EfEEEUmUm֋UR$$E@]uEEB0UEB9EUuEEEEtEMU:0tBUutqى ~]t^tEMB]Eދ]g}9uWU9BUE<0EEE1@EEBEċM@AMEU0X}9tEEPjj u)E)UWVS0EpXuEUM؉]܋}E%->@EȋE؉EЋE܉EVSQw $|'vEuWuu EPEPuh ?t:e[^_ÉEÍvE뷍vE뫍vE럍ve[^_ÐUSzÍJt @[19t I<u9u[UWVS ƉӋ}t&~t;v [^_Hu<uD uډ{tӋE ˍvtUWVS4U] EUU EUEډEEMSQw$|%EUEU EL|e[^_EUEU EH|e[^_j%-UMuEEE}E uU܉ÍL@ I9rS99vI99w%U} U<E EtU  UI9se[^_É%ƒ I9wyuЉ]E p}]Ћ}ԉ%u-EUEU E e[^_ E{ ?vME|ME|tuPRUWVS@m}MM]EUu ۉE؉U܋}QRP}mw$(}L#؋MPju$hL|Ee[^_؋EWju$hH|E%-@Uuf} VÍT0@J9rK99v E؉EJ9щE9wE܃ <;u$;tM$ MJ9se[^_ p}}E%-B-؋MPju$h 9rE܃EJ9ډEwZ{iO|;KO|;t>uEPR.VWt$ |$L$)9rу_^ʃON_^ÐUP}E x}ÐUUuÁuÍvUSM ÁUu% Ѓ[Áu% Ѓ[ÍvUMEMEEU UuE EÍvUUu UÐUWVS E }@DButaCE ;Fv+jPRFP3C P6CGM1҅CU uE!@!C@U;Bv,PRQt7UC@BPs؃ PM1CUBM1ҍe[^_ËE!@ GC F FPVGPC Pu uvE PEuPC Pu tUMcv P7 P'CUBC +vUWVS Ef@fuuJuJ toDBBt? ҍ}tC PPGPRV u*EB E}EWu Íe[^_ÐUWVSEM qx9v ]8]]u@AJu[)^_U[^)‰_UWVSVMQUE x;}vU 8uCAFJu9}E[[^_[[^_ÐUWVS} u]jWEPZ jGPEPHUE9s'RP-txEEU;BvE]9vPSFPW jVU2E)؃Et>F߉ERjuE0iue[^_à Rbe[^1҉_ÍvUWVSUE MEUx&UBPjRM1)twMM]MQutqECCC fCfCu9vPVuCPEwU)uQjSE0ve[^1_Íe[^_UVSu] jSEPv jSEPd ju6ƒҸtFB uSPju6t$)]BERVW9]w1e[^Íe[^PjR6ސUWVSUEσ} x 1҃$}vM 1]9ʉM@;U| PtEHtU 9v) v2J tt BAt)à ] t]}SEEPua PU Pju$h Je[^_ÉE Sju$hH|׉] Vju$hL|뿃EPu!]E% ?EUX|ELM h|Qx| $p|ɍ]5~V} $}fEִ fEEmUmu1EE@t$MPSE})E؍DEC}w#]~EEuK]E)ʉNEEuEUEUU} vE}~m0ۃ}Ew(E$}EE UUUU uD |EEP J҉Ut:xt +EE}VNEC}9EݕhhlMEt7Eu.~*E ɋU kUEUɺR $\|]؋Um@G %`|EEEEE Eua]U҉UE uMUtE9Et u u؋|U]uEMx }ẺEEuEEtE}uN9u_E)ƋU҉UE EEjEE~E~E]9~؉E)E)E)E}ȅ~K]\~1Vu3EZYtPXt]E)( j}E~uPE1ۃ}]uUB҉Ut )ЉEEEEEEM̅~uuEU~uuEEEy}u~uu|EEۉEE SsuEuMu E uEuMv~ }UEMB9MUOPjj u]9]EVjj u Ejj uEEuu 0E^_uu~Y[uuP ҉ÿPuNǃEM~?}fEִ EEfEE;E@E km]m֋UR $MɍB0]EEA@Mu؃ uUE@M E$t]$UE |e[^_EEUUBEEUnEb}Mm]m֋EЃEEEE-Wjj SEEQtBEESjj uEE]Euu0EE9E|ËM}UBME M99u|9]ZME89tEEM9M)MىMEމuEًE؃}EME U:9u|9MM];9tEEuuMPjj unEEEEM At8U)(utE}}EQjjuEPu(|E 1EAM}UB@;EEE|+uuu1E]{}Eu,$EWjj uLE[^uPN0Euu/AUEBUPjj uM9MuE뗃juE^_uPbERUBHEM];0tC]C~:juEZYuPsE}:E ]{WEUEBUPuEUE@u $E5}EE9`|EvR2 p UJlj֍  ZYjPrE}9M9AME+EE])‹K@9})ύGE=@M)щMEE |E1C]9E}:E qE]@E C]E[U}4}fEeش k]EfE0E6E@;EE]mUm֋UR$$B0U]EEBEUuE@:MY1%؋U}}fEMش ]EfE.R$$]B0UEB;EUt$k@MEUmUm֋UЅuE[EE1EMU:0tBU$E|0p}9EE MA1C]uEkYPjj u EDE@USPM1ۃv BC9v S ]ÍvUVS u]u ƒCBCute[^ÍvUEHPJBU UWVSE逋EHEPR7UBtMfQ RWuPoM)y9uRVuPOE)p0)u[ uP 6E9RVuPE0$! RVuPM1 $ USQM I]wʸ Z1[fZ[ÍvUSPM I]wʸ![1[&[[ÍvUU1@~1ÍvUU1@~1ÍvUSQM Iw˸UZ[Z[ÐUuPQ$5Ðcv̀rÐOvT̀rÐ;v%̀rÐ'v̀rÐUVSuu V̹t e[^Ét V蓹e[^ÐUj$= u u~UWVS ǡ$yhۉK~x$ h$;5h $ Sɸ$hKʋDGD GDG DAC$u e[^1_à h@䐃 h@ h'9e[^_Ð h@;5h(Chމh h@Sv h@k h@&hۉw` dhUEEEEEEÐUEEE EEEEEÍvUWVS $5hv~O vOxrD3tUt U9T3uE؋D3 E܋D3ED3ED3$uLE؃t\H$t h@Oyv6j$uCe[^_à h@E؃u uU܃띃 h@ h@e[^_UhW|$D$ L$uG_Ð1_ÐUSR ]fS ¨uHK0tC@9t Q蝵fS C0CC]Ct=¨u1ҨuSS1]ÍvC؉C1Ck SfS 뱉CfS w ]ÐUWVSl]fSfҋu }xaEPP xJU1 Eȅt:CLte[^_É{(<uf̉UVS]C tCCCCe[^ÐEQPEPS1ZutJ pCECE΀u f s e[^à CP tf s fK tUWǍ@VS)P荳EU1t\]G4ËExX3vPjXhS s8hhV XƔOy͋Ee[^_ÉUSS$uY u1غ”XHy p u]à h ]à h $U VS$^F f{ tLXHy6u$ 1$05^fC $C8CCCCCfCC0C4CDCH@C8VhjP ؍e[^à hb hZ h h USQ +~Jt+P~9u~/Lt"$u2$u]à h"]à h Uh\]ÐUWVS }G 1Ҩt6wt/)7uWWPSVWk ~)ƅ1҉e[^_fO @UUt+B u ɸÐ RkÉE\vUVS]tt $uZC t" S-$҉u$e[^Ð $Ҿt܃ See[^Ð S똉Ee[^\UVS$uu# Vá$u0e[^Ív V3 Vwá$tѐ Ve[^ÐUVSuËF89Xt) PMF8XF8@ e[^Ív@ e[^ÉUvUWVS uWËF819Xt? Pte[^_ÐF8XF8@ e[^_É@ e[^_ÍvUSQ]S89BtX[ÍvB ~HB X[B C8@C8EZ[UWVSQE9UÉ}/+uECMDC ‹EfC@9E|ڋUSMfSX[^_UWVSMU EE]u u41ҋ EEEtMqEUe[^_9vE؉EEȉuEEEE]fEڋEfE܋EMfEދEUUfEEfM̅ҋMfEfUfEfMEuM}-EUfztEM)MEfxEMUfztuփ vMfqNy+EUBUEMfIفfVwGEvE~3UUuEUEuJ_XEf@fVVEpMIEtPPffXfVPf9XfQfqX 1ptȉlj 9%pOwt 9wڋu1ۅ~RM@EHMq))ډӋ@UfB)N؅Pf fXX)؉ËPftDO1ۋu/UM ADU rDӋMfAN͋PfUMf,EE 48W(x(X E@ DžD,Plt  ,(wcݝP݅P[EEE ݕHݝPE̋U‰@Uu ;EEPEPTPNjE ~PWǃEu Ft[XWuEVMJɉUu"9P]9hME W4$uEE9@SME) 8cZ4WX,KX(?3CX"xDžpvC]@<0tAEX|]pu|0uCt]p0tFσt~Љ\xDžtAEE@G@DžtC]p~Ѓ ntttx~Iv}<;urUBM +AU9։U>M‹M<%EUfFf>;urEtMA;AtMD@AEe[^_ËA @PE EH} ƍ  $߸U UB뢐UÍvUWVSDEX$S4CLUE} CXjP?+K(S,KXS\ΉЃ -@BA‰΁?BS\ɉsXM؋C\ȉE܋K4ɍUCȉEC HȉEEEEPjjREP( HE؋U܉CLC4SPECDECT[GjWPXuWQ 1҅uWe[^_jjREP'H{h j`ce[^1҉_ËC0CHCTrGjWPts@ uWM 1҅e[^_ËUẼE̋WPWR1҅F]ȍUȋGRWP1҅(UB EăEċWPWR1҅E UGRWP1҅OUWVS,E M1҃x Y$t e[^_ËPEЃEԋBjjEEPAP&H7EЍU@E؍sXEԹȉ׉Eu*EC0C4뒃hHja1|htjUWVS}_$Cs4u_GW{hC`Sd1}щMC`WPEPs-$xrC`SdV FFe[^_É hPlPs$pC(P sChjaUhȋj`e[^1_ÍvUVSu^$ 3#~Xs~C$u0hu>luL S}ue[^} P}htĉ P}lt P} S}ue[^}UWVS} j(jLshtj0w@@$ǀhǀlǀp@(@,Q7w@hP$ugt V|tHQC2C$hl S|e[^1_Ð1уKAQj1}1эAC XZQj҉C@8E}1QjӰ‰C$}1PQuReCC@WPPRFC @Pus3ECMrMQVFF $0(u2((1,010l34484F (^$jVǃpe[^_Ívhj}] Pzl Pz v Pzv Pzv PkzvEt}MpC h1 h1$ FPh,hpj\UChpvUWVS$uSVdt=1щjuuu PVe[^_SVhj[e[^1_UWVS ]td1҈߹щM5ыEL 1ҁv e[^_Ð Su VhŒu?e[^_à EPh1҅u]낉UWVS<uE 1ʋ} щ)ҋL1ҁv e[^_Ð Vu Sȟu臧e[^_à P譢1҅uXhW } DUSS] uQjjS]ÍvRjPSb]ÐUVS] SuV791҅ttHtH1ҍve[^ÍvPhCPV<;1҅tQjCPV81҅tRjCPjCPV81҃UVSu] PjSV81҅u e[^ÐPjCPV81҅e[^U<ÐUVS0֍URURURURURMQhՌP[R ~C1^T؍ @ ڃ~EE֋EEPjFPE։VFPى1ҍe[^ÉUWVS ҉~-1Ӑ 47vYt7vZt7 v Ku؍e[^_UWVSLUDžDžDžDžDžDžM EB]tu1e[^_Ë]1%,DžQ1t1ې 0"PhhP$$[+$J[+$5[+FQG t |1 v 2PhhP$[+$JZ+$8Z+FAG t |]DžDžDž1҉=Džq1I19ωvh8t3{Zuh5t3]ZuG ;}ttRDž]tЃRQSShPNhhP1 htX1e[^_ÉjjPjhV tDžDžDž@RhPqjh8pjW  DžjPAt Pt GWP jtj+tA]3tm= ~@9Љ)9vًU Be[^_Ð1 hPWz GWPXZQPRShhQ|Lh]S 1PjjEU:h\<jߙ<$c jVT@.<!PjQDž+ U|Dž>J)!IDž-1҅n u61҅KDžDžjVjjSP艚 @ Huʰ PjjSPf$J y 8tDžPPjjRlƃ F`[U@tÍvc=v@Ív@ÐUWVD&fjhDEPj腔e^D_ÐU,EEEPURjEEE蘗xEt E@E‰ËEUEM t.~tOt91ÉHuQÉQ,׍v,ƉUWVSjjjhP, jjjQBjƅif1jIhhɉMEjEVjjjZYPPjhEPS{ tPFjjVPe[^_à S=$5Xt,$ jX\e[^_ÉDž`D\v \HC XTtJXuCw Sx P3`s J8up\Xa h1v h1`t} `0EJXZ\$D\bhUjFM $u1K h114wˍvUWVS $DžE 5`t7 6tuSvaKvu1p WjjjhVj' t6ut s;PU $e[^_ËF Ev6iERvvP$E̅$`Dž tFUЉ]̉B p9ۋ P҉uȋ $ uhEPb]1EEEEEEB tD< $PShB Ⱥ$u؉CECWjjjhVjE؉EG% [u$@ P԰/ h1e h1` h13 h1L1 jhg UjhhBP˒MDžtVz 8jf dM<$ZMC1t :M Cj ZfljC tACt:t6tKt%F GPfGC @}]UM h1菿U 0eXreB _pe^p eBuJ tlB B ye dz1 PPeZ 1EB`RvvP訿$t h1裾d8`CB`d$ h1M5`1ƋFu 6dXvdXF p}dXv tdFu*t4G`C` VHdm P7dȉ`CҍvUWVS\]ۋ}E1t-WS{Eu! FVP1e[^_ËEEȋE E̋EPhj ]S]؋V55EPhdtEPh4jV$FVPXuUcEe[^_ÉW1vE1dUVSP]E1thEE؅ۋE EtaEE@$Phj ]S]V55EPhdtEPh4jV$FVPEe[^ÉE@뛍vUWVSS;Ð S?ddB tٺ D<ƉuƋd S; jjjxVh jjjFÃ1xgƅyPjhhBzW蠍1I xQVSFx Se[^_à Sv1e[^_UWVS]DžpDžtDžlDžhMEcEp J*fEEUr5 h8\@ EPڋEvp$,;p1pPBhjRPp PEPj pRUE UEUr5(EEpPEp0EPhrEPh@jp @vtEp D< VUE UȉEE@UEЋBpDžxapDž||VBWj RP]ԅpQBhjRPpBUr2xWh6uVh4j p0ox1tHsEpwu(s Ur _uCU9B>[ulWh6] pBSjRPXZSlExt'pt pBRPDžpUvpEEԅt=@t P^le[^_ÃWh6pUBEԅuE@pPBhjRPh||u!D|H|pPBWj RPpBUr2tRhwVh4jp0v upPEPpR}w_|H|xlt lBu1pX^_PpSpp BRPDžpv EPUEpvfEffEPpPEPjpR$ \lt u[lB pX^_PpSl l[DžlE@&8PuTƃkpZQ^_PpSDžl.o pBRP EPUEp[Ep pBRPo@DžhJRuuPlBfUfPElB hT莹 V8t2Ep s vuփ EPڋEp V0pKt8zPuy^_ltPhw`lt^pQBURjpPXZEPRF14)@iYUVSujjuuu uPà 1t0C;w2RPsvQCF^sX$Xe[^É sX$Xe[1^ÐUWVSjUE EEtw@55}Wh`5jh8pjV tBw]PFSj VP}t8^Y_PVS FVPEe[^_EPFSj VPF55Wh`5jh8pjV0u믐UWVSXjE UÃ۸WCh8jSPEEȋEE̋EEЋE E؋EE܋E(EE$EEE}ȍvMVCQj SPCu0u,URhx8WhX7jS0uM4uHFw EHEw CSPEu e[^_ÃEPhwvuuctc@M4;w/RPwqGU4BXwEV<$=V| w*V<$VU4BRE4@>vUWVS u1t>u u &e[^_Ð h=# j‰6u S訵u SŶ1tG55u hDpjh8pjWÍ@ v. GWP1e[^_1)uPGVj WP}uEPGVj WPG55u hDpjh8pjWÃ0|*UVSEu EtWtD~1t0C55URhwVh8jSCSPEe[^>1/1ېUVSEE tq1tKj j輈tcC55Vh8U RhwjS u CSPe[^É VS11e[^à CSP1u1ܐUWVS 1EEpNXxf{ ~ SU ǃXNyEEuύe[^_ÐUWVS EE 8 =p~3hKu9te5lhK69tI1ۃ~ 5lu49tKC9Eththh!e[^_uhNshj4e[^_MV uuhNsh8j4e[^_ÉUVS ȋ 5 ) PQt[  ҍp PRQt#   DX  1ҍe[^Ív''N 5 )һ'IPR;QC PPdvUWVS       EfE Ut x E`t xUv \g   - t!xf; we[^_Ë tE @) C$9 ; rBL Љ] UfP  J B  JH ?91 ?5 )Ɖ5 E)E uPuL EfF  J B [1xv?2t]x ?};5 r  B EfB B  B( h   x: ;EU]P  ; r1u? Љ] UfP J  BO h9     hlp x  x hh M  A멉 tNA x] N ? 0zx A!x 1 U AQ 墔UWVSQ5  ;5 =Et Ef U`9t4 :~֊Uf U`9uUǣF;5hZ[^_UÉUM9tBt)PP ÐUUt0BBB@BBBB$;t^UWVS u] V1F Xt"$ u#CP ~~e[^_ÉS[؍vU PhvG5I`$UP|IÉUWVS u }v|7t e[^1_Ív|7u(tHFC {{CCCCC C$SWe[^_ø;묐UWVS u F}EBt>1B9|D33uS(tCe[^_øD붸ܚ׉UU1:@<uPRgÐUVS(u tVs FCtCuSe[^ÉpJCuSe[^øp$랉USP]tS5]h5ES5j]UWVStOu u ,V] ]5 f ]  :~f `9u5f EfE5 A5P1ۅu!E܅@$M܍@PD Q A EU5v5H @t  B9MϋEU죬)ЋM   t*1 9} @9}< u@9|w,$h51e[^_ËE+ HEU A$u!A@$ Q9@5 9؉׉oA )Kp]H p5j5 5 聄 e[^_à 5 s*1E]P P%t = P n]E1I9ME=wUD4룍e[^_Íe[^_Íe[^_Íe[^_Íe[^_Íe[^_Íe[^_ËM䋄4\ 5 )K1҉]FGB;U|x$]X Л~ ~ p*1APJ҉Pxy@ 4@U܈ F9 $t 5茚붸  p 5蒜뀋$@ @1"v 5B5Sj@EP $B@ @MhPj#2@XUF j M] b9Ⱦt;:~ 4f Ѝ`9uf :55؋ ]Ef 5  5 E 5U] 5 C]u15@UPP?ÉUSP]t;tCu![[ΉY[CtvC[[륐U5 u5hNshj!USP]t( CǃD!P]]>v]ÍvUhXth,胖ÐUSQ薖t Ћ]ÉhthJu u 1҉Ћ]à 5,uhL!jr1҅tP5,ȗt S=1룉UWVS,ƉmUzB j.V!J=5U ,U ,!t'ʁw 5u .@uۀx.Pu VWbaPhVhE ƀ-E .UE BU RǂBЃUBs@ ~1e[^_É=6j:V] ,t+ʁw 6u:t .@uրx.tyPu VWM` WhVSgE ƀ-UE BE ǀ@@E B薄1:E u uWVhhhahj 01HtЍe[^_øPhPVes/PPu]UӃyvUWVS EE} u]q@t] uE [^_t@uw [^_UWVS }u ]mq@ut@tKZq@ u] ue[^_SvSV?1҅uʍe[^_UWVS }}u ]p@t`t{9uuSVuhhhah@j 0He[^H_s@uSe[^_Ãu?t|uOut,WlGaG V=K }6Er5/bG%r裁KvUS ]u S ]]UuFUSP1҅tPCPSu1҅uډЋ]ÉUSP1҅t@PSu u>1҅uډЋ]USPz1҅t! @PSuu u 1҅uډЋ]ÉU=tPuUt P ÐUSP] ,!u*h?ha N,!E0!]Ð PCE0!]ÉUSQ],!t 0!t]Ív P賐ǃ,!]ÐUWVS<Nj,!P,!hPM8#tЃhHPthMStPSjZFPSjZiMDž`~e[^_Ãh?haL,! ~뽍vDžȃIAGG W< t< uFv,,!GhMVxtC1򮋅+9ȉ$RPV`ރ< < (;hMVtC1򮋅+9ȉ|AWPVR`ʉKFO}e[^1_ÃVDž*|vUVSu] j@% E[^USP1҅t@PS1҅uډЋ]ÍvUWVSE‹U‹Ux0Wj jFEu]F;Eutpu6t<^tu3ttu3u WB}e[^_i@ tF0F0RUF F]UWVS$E‹U‹U‹U@PjEv jU=Eu(CE܋E9EuًC0E9}uŃ}t" ul}e[^_h@ tӃC0C0|TC C뮐UWVS ljh@ue[^_ےVW>ʒe[^_ÐUWVSMEDž\X} |t4~} tye[^_Ã} uDžTP DžThfGhUM fG,,!;|xwHzx )PRV|I N T4t;|$} } }EǠtǀUzM8pA8zhhDždDž` ;| TލF ;|] VI4$I} l VI؍|9Љ<lƉhh,;| `x )PRV|YG `똋1PӁbPEPڋPM+ VH } t`} tZ} ;} t7 W裺ZYPu 蘺$ jOPuhj%| <uE(;t hQV|8F  WT;<Ftt1Ӂډˋx)9YMWRhUdtpcdtd~ } !EuU1}ˋx)98,uRgU؉)c@ t1 hQV|{D " WE;<1ˋx)9WRgډXpvPxPuN} } S}7E9X  dM1ʉЃP;xkE;p\\#5Dž@d89@DDžH1)/aDƋ al#9htGad9rċHfM@u~M9~@HdD9Hq@9@@;f}f}f9~)f}f}8DTOy@d렃} Xt-uhj% <7܋x )PRV|_A x] AtH;<wdueUCt(1Ӂ``d4xڸNxE(;tvttzppPSVRj<wډj UVSutMt8@@ CPSVuU Eu Ѝe[^1@@ /p1֐UWVS E‹U‹8@EE WG h& hPujuR xk=v V&ڸe[^1_uWuu‰É4$k&e[^_ÐEV V:&ڸa o腇/o륉UWVS,Eƒ:‹‹@\@@SvPPhyVTƃKyShh aRQ h$%{ hPj jPRL o=j R‰ V$P P RW<@@tgwme[^_^@SmډPGPGPGPhPS 0[@ tFBB ^ V#ڸ5O V#]EU싇 E䋷;u sF;]vtCAJ;]ru:jEPVW'uMF;u r1ҍe[^_à RCPPRPQpjEPVWf'te[^_Á e[^_ÍvUWVSE EE;u s=9sLډ]C9s;Eu)ЉEjEPVu&u4CF;u rËEe[^1_ËE e[^_Íe[^_ÐUWVS M UDQCtCPuP/@U B3)ÃRSPPBM fqEU f|AJJftff9sfJfuE fXÃE )ȃfJtfAf9sffJuU fZCM fAE1ҍe[^_ÐUWVSjRPXt%R@PSVuQjS6D1ҍe[^_ÐPjS6De[^_ÐUVSEXCuuOtNtdCue[^ÐE t9rJDuԁ Pjs3 DC똍vC(tɸtS$JuK$믐UWVS<]{G} 0 ('jjjtփ ƹG$EEEE!juVURSSu3vQvus;F:jVEPSStЋu@w$tHjjj}s!Ѓ@t(PRSju 1ɍe[^_Vjw7BG} vjS著e[^_ÐjW@띍vEEujVURSSvEE؋FERjEPiVB9ujVURSSt$UWVS u^CunjV@tE 1ugu"@ jt V苗@t e[^_ÐPjs3;ACvit n ZquUWVS ]ۋu}t'EC1҅U RTPC!@@;v2 Pt3@P3CPb=G1ҍe[^_Éur jhtԉ‰džGC뮃 PPGPCPVi' uvjP%닃PRUWVS E,UE쉂BE1EPjuU2.A@ $@1 ;E wADCf9э4uUUEAfBUv}ur}jQjDC PjSE0>PjuU2w@I]o}8u"FDCPjSE0N>U;EtqptdRjpU2@tK}uFDC 맋EXE f)UfB Ee[^_DCVjSU2-n8e[^1_ÐUWVSf0ƋJf\Gf)Q2PF:fGUBf)à P2FP:֍؍DfWf7fDWf\We[^_ÉUWVSEEU EUErfщUfDFffE}UfDVNjEHf+};EttLFPE)ȍPSR9];]D^vffBfB;]$fJftffB9fB;]~ffDFUf|VfVGfDVEfEH8UJe[^1_Íve[^_|UfB $UWVS}G EtEu$U ffG fBG fBe[^1_ËEuEw<jO t1RPS6l!Ѓ@Vuu SlU fMu~u f>uuffG fFG fF[M G޺ uEEP3UB@E9F PuEFP u$LJ LJ(jSDAPW虃ú}Hf@ fEfIfMfE=NSUWVS ËBE@{ )NjEfR fUEUfBfuv uktL uu jVSs u.E9F PWUBFPEuUe[^_Ív PyvjVUDBPSgt!Ruu u‰Ete[^_RUVSQuuuU j]C@t 1ҍe[^ÐUWVS(jEPEP]Su Quuuj];E_ZE܍EPu ..., where is one of: %s: %s not compiled in ۊRRRRRRRRRRRRRR5F%6d stdoutstdinusage: cat [-benstuv] [file ...] benstuvbb bb1bb1bXXusage: chmod [-fhv] [-R [-H | -L | -P]] mode file ... HLPRXfghorstuvwxthe -R and -h options may not be specified together.invalid file mode: %sfts_open: 0%o [%s] -> 0%o [%s]fts_readHLPRfinprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too longdirectory %s does not exist%s is not a directory%s: directory causes a cycle%s%s: name too long (not copied)chmod: %s%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).%s -> %s %sutimes: %schown: %schflags: %sunlink: %smknod: %smkfifo: %sreadlink: %ssymlink: %sfailed to get acl entries while setting %sfailed to set acl entries for %s%s not overwritten (y/n [n]) overwrite %s? %s%s -> %s %3d%% failed to get default acl entries on %sfailed to set default acl entries on %sfailed to get acl entries on %sfailed to set acl entries on %s cp [-R [-H | -L | -P]] [-f | -i | -n] [-pv] source_file ... target_directoryusage: cp [-R [-H | -L | -P]] [-f | -i | -n] [-pv] source_file target_fileBƨP*^D@@Ѥ@@ϧt    \\ t +  (    % ,@2p:`B PI@0PW \b 7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ0123456789fillcharibsifiseekoseeklcasenoerrornotruncoldasciioldebcdicoldibmosyncparevenparnoneparoddparsetsparseswabucaseunblockunable to allocate space for the argument "%s"no value specified for %sunknown operand %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsseek offsets cannot be larger than %jdneed exactly one fill charunknown conversion %s%s: illegal conversion combination%s: illegal numeric valueobs must be between 1 and %jdibs must be between 1 and %jdfiles must be between 1 and %jdcount cannot be negativecbs must be between 1 and %jd%s: short input record%s: seek error creating sparse file%s: end of device%s: short write on tape device%s: short write on character devicefiles is not supported for non-tape devicesinput bufferoutput buffertruncating %s%ju+%ju records in %ju+%ju records out %ju odd length swab %s %ju truncated %s %ju bytes transferred in %.6f secs (%.0f bytes/sec) iseek/skip%s: illegal offsetskip reached end of inputoseek/seek%s: write failureư>_ %6s SizeAvailUsedFilesystem%-*s %-*s %*s %*s Capacityifree %*s %*s %%iused Mounted on%-*s %*jd %*jd %*jd %5.0f%% %*jd %*jd %4.0f%% total %sufsBLOCKSIZE=512BLOCKSIZE=1gBLOCKSIZE=1k-l and -t are mutually exclusive.vfs.conflistsysctl(vfs.conflist)malloc failedBLOCKSIZE=1monly one -t option may be specifiedusage: df [-b | -g | -H | -h | -k | -m | -P] [-aciln] [-t type] [file | filesystem ...] abcgHhiklmnPt:%s stats possibly stale/tmp/df.XXXXXXstrdup failedmkdtemp("%s") failed-n(:%&)*+%-/*+-/:<=>:%&)*+-)/%&)*+-/<=>%&*)<=>/%&)*+-:/&|)+-<=>&)<=>&)+-|<=>&|)&|)<=>&)&)<=>|<=>|<=><=>|&)%&|*+-/|<=>:<=>||%&|*+|-/:<=>%*+-/||:<=>                       !"   B[aim3O (ETapmalloc() failed|&=<>+-*/%:()syntax errornon-numeric argumentdivision by zeroyacc stack overflowEXPR_COMPATusage: expr [-e] expression %jd unknown signal %s; valid signals: kill -signal_number pid ... kill -signal_name pid ... kill -l [exit_status]usage: kill [-s signal_name] pid ...-l-soption requires an argument -- sillegal signal number: %s--illegal process id: %s link source_file target_file ln [-Ffhinsv] source_file ... target_dirusage: ln [-Ffhinsv] source_file [target_file]replace %s? not replaced %s %c> %s Ffhinsv&0DN$'3=%I!UB[jyJ1um\\""ab f n r t vLS_COLWIDTHS %lu : %ld : %lu : %u : %u : %i : %jd : %lu : %lu fflagstostrMAC label for %s/%sCOLUMNSCLICOLOR1ABCFGHILPRSTWZabcdfghiklmnopqrstuwxCLICOLOR_FORCEcolor support not compiled in%*lu , total %lu %e %b %T %Y %b %e %T %Y %e %b %R %b %e %R %e %b %Y %b %e %Y %s %*u %-*s %-*s %-*s %3d, 0x%08x %3d, %3d %*s%*jd %5s ls: %s: %s -> usage: ls [-ABCFHILPRSTWZabcdfghiklmnopqrstuwx1] [file ...] usage: mkdir [-pv] [-m mode] directory_name ... m:pv mv [-f | -i | -n] [-v] source ... directoryusage: mv [-f | -i | -n] [-v] source target%s: set owner/group (was: %lu/%lu)%s: owner/group changed; clearing suid/sgid (mode was 0%03o)%s: set mode (was: 0%03o)%s: set flags (was: 0%07o)%s: set times-PRpv-PRp/bin/cp-rf/bin/rm%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) statusoverride %s%s%s/%s for %s? %scannot resolve %s: %scannot rename a mount pointrename %s to %sfinv%s: destination pathname too long:------,--,"/" may not be removed%s: malloc unlink fileusage: rm [-f | -i] [-dIPRrvW] file ...recursively remove %d dirs and 1 file and %d filesremove %d filesremove %s? %s: -P was specified, but file is not writableoverride %s%s%s/%s %s%sfor %s? %s: is a directory"." and ".." may not be removeddfiIPRrvWPOSIXLY_CORRECTusage: rmdir [-pv] directory ... usage: sleep seconds VRY|YYZunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660vinumraidjfsSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyCCDVinumDOC2KRaid%s is not a valid file or linkcannot get disk geometrydisks with more than 2^32-1 sectors are not supported%s read%s: no valid label foundread mbroffsetverbgeom (to restore label and install boot program) bsdlabel -R -B [-n] [-b boot] [-m machine] disk protofile (to write label and install boot program) bsdlabel -w -B [-n] [-b boot] [-m machine] disk [type] (to install boot program with existing on-disk label) bsdlabel -B [-b boot] [-m machine] disk (to restore label with existing boot program) bsdlabel -R [-n] [-m machine] disk protofile (to edit label) bsdlabel -e [-n] [-m machine] disk (to write label with existing boot program) bsdlabel -w [-n] [-m machine] disk [type] (to read label)usage: bsdlabel disk%s %s %s %s %s %s %s %s %s %s %s %s %s %s # %s: type: %u disk: %.*s label: %.*s removeable ecc badsectbytes/sector: %lu sectors/track: %lu tracks/cylinder: %lu sectors/cylinder: %lu cylinders: %lu sectors/unit: %lu rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %lu # milliseconds track-to-track seek: %ld # milliseconds drivedata: %u partitions: # size offset fstype [fsize bsize bps/cpg] %c: %8lu %8lu %8.8s%8d %5lu %5lu %5.5s %5lu %5lu %5u %5lu %5lu %5d%20.20s # "raw" part, don't editwrite to disk label supressed - label was as follows:/boot/bootcannot open %sread error %sboot code %s is wrong sizecannot open file %s for writing labelwrite labelwrite bootcodewrite %s%s: unknown disk typesector size 0 sectors/track 0 tracks/cylinder 0 cylinders/unit 0 revolutions/minute 0boot block size 0 boot block size %% sector-size != 0number of partitions (%lu) > MAXPARTITIONS (%d)Too many '*' partitions (%c and %c)unknown multiplier suffix '%c' for partition %c (should be K, M, G or T)partition %c not an integer number of sectorstotal percentage %lu is greater than 100 %ld sectors available to give to '*' and '%%' partitions Cannot find space for partition %c Need more than %lu sectors between %lu and %lu Offset %ld for partition %c overlaps previous partition which ends at %lu Labels with any *'s for offset must be in ascending order by sector Offset %ld for partition %c doesn't match expected value %ldpartition %c: size 0, but offset %lupartition %c: offset past end of unit partition %c: partition extends past end of unit partition %c is not marked as unused!partition %c doesn't start at 0!partition %c doesn't cover the whole unit!An incorrect partition %c may cause problems for standard system utilitiespartitions %c and %c overlap! unused partition %c: size %d offset %luline %d: syntax error Warning, unknown disk typeline %d:%s %lu line %d: %s: bad flag drivedata%lu partitionsline %d: bad # of partitions bytes/sectorline %d: %s: bad sector size sectors/tracksectors/cylindertracks/cylindersectors/unitrpminterleavetrackskewcylinderskewline %d: %s: bad %s headswitchtrack-to-track seekline %d: %s: Unknown disklabel field line %d: partition name out of range a-%c: %s line %d: %s: bad partition size line %d: %s: bad partition offset line %d: missing file system type line %d: Warning, unknown file system type %s line %d: too few numeric fields i386amd64ia64pc98alphaUnsupported architectureABb:efm:nRrs:wa -m option must be specified/dev/can't create %scan't reopen %s for readingEDITOR/usr/bin/viyou have too many processesre-edit the label? [y]: fopen %susage: clri special_device inode_number ... %s: can't read superblockcannot find file system superblock%s is not a valid inode numberclearing %d usage: dmesg [-a] [-M core [-N system]] aM:N:sysctl kern.msgbufkvm_nlist: %s%s: msgbufp not foundkernel message buffer has different magic numberkvm_read: %sPrimary DOS with 12 bit FATXENIX / file systemXENIX /usr file systemPC-UXExtended DOSPrimary 'big' DOS (> 32MB)OS/2 HPFS, QNX or Advanced UNIXAIX file systemAIX boot partition or CoherentOS/2 Boot Manager or OPUSFreeBSD/NetBSD/386BSDVENIX 286DMCP/M or Microport SysV/ATGBSpeedISC UNIX, other System V/386, GNU HURD or MachNovell Netware 2.xxNovell Netware 3.xxPCIXMinixparameters extracted from in-core disklabel are:cylinders=%d heads=%d sectors/track=%d (%d blks/cyl) Figures below won't work with BIOS for partitions not in cyl 1parameters to be used for BIOS calculations are:sysmid %d (%#04x),(%s) start %lu, size %lu (%ju Meg), sid %d beg: cyl %d/ head %d/ sector %d; end: cyl %d/ head %d/ sector %d system Name %.16s Information from DOS bootblock is:can't read fdisk partition tableinvalid fdisk partition table foundwrite PC98%ss%dFailed to write sector zeroSupply a decimal value for "%s" [%d] %s is an invalid decimal number. Try again. %s [n] yesYESThe data for partition %d is: Do you want to change it? The static data for the slice 1 has been reinitialized to:sysmidsyssidsystem nameSupply a string value for "%s" [%s] Explicitly specify beg/end address ?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorAre we happy with this entry? fdisk -f configfile [-itv] [disk] usage: fdisk [-Baistu] [-12345678] [disk] Ba:f:istuv12345678statfs("/")^(/dev/[a-z]+[0-9]+)([sp][0-9]+)?[a-h]?$regcomp() failed (%d)mounted root fs resource doesn't match expectations (regexec returned %d)can't get file status of %sdevice %s is not character specialcan't open device %scan't get disk parameters on %scannot open disk %sread_s0%s: %d cyl %d hd %d sec StartPart %11s %11s SID %4d: %11u %11u 0x%02x ******* Working on device %s ******* Do you want to change our idea of what BIOS thinks ?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choiceMedia sector size is %d Warning: BIOS sector numbering starts with sector 1Partition %d is marked active Active partition number must be in range 1-8. Try again.Do you want to change the active partition?active partitionDo you want to change the boot code? We haven't changed the partition table yet. This is your last chance.Should we write new partition table? -t flag specified -- partition table not written.usage: mknod name [b | c] major minor [owner:group] %s: illegal %s namenode must be type 'b' or 'c'%s: non-numeric major number%s: non-numeric minor numbermajor or minor number too largegroup must be specified when the owner isowner must be specified when the group issetting ownership on %sasynchronousNFS exportednoatimenoexecnosuidnosymfollowwith quotasunionnoclusterrnoclusterwsuiddirsoft-updatesmultilabelaclsffsext2fs%s on %s (%s, mounted by , writes: sync %ju async %ju, reads: sync %ju async %ju, fsid %s,%s-oasync%s %s %s %s %u %u 1 1 2 2 0 0forceupdatemsdosexec: mount_%s/sbin:/usr/sbinexec mount_%s not found in %sstatfs %sno mount [-dfpruvw] [-o options] [-t ufs | external_type] special node mount [-dfpruvw] special | nodeusage: mount [-adfpruvw] [-F fstab] [-o options] [-t ufs | external_type]noroadF:fo:prwt:uvgetmntinforqnoautonot currently mounted %s%s: unknown special file or file system%s has unknown file system type/var/run/mountd.pidsignal mountduserquotagroupquotadevrdonlyusage: mount_ufs [-o options] special node %s on %s: mount table full%s on %s: specified device does not match mounted device%s on %s: incorrect super block-o %s: option not supported%s: not a directoryextattgensrripstrictjolietusage: mount_cd9660 [-begjrv] [-C charset] [-o options] [-s startsector] special node cd9660_iconvcannot find or load "cd9660_iconv" kernel moduleUTF-16BEbegjo:rs:vC:could not determine starting sector, using very first sessionusing starting sector %d shortnameslongnamesnowin95 [-W table] special node [-M mask] [-m mask] [-o options] [-u uid]usage: mount_msdosfs [-9ls] [-D DOS_codepage] [-g gid] [-L locale]msdosfs_iconvcannot find or load "msdosfs_iconv" kernel moduleunknown user id: %sunknown group id: %siso22dosiso72doskoi2dosKOI8-Rkoi8u2dosKOI8-Usl9u:g:m:M:o:L:D:W:malloc()stat %sajt}vm.stats.vm.v_swappgsinhaltusage: %s [-%slnpq] [-k kernel] dk:lnpqcannot dump (-d) when halting; must reboot instead/boot/nextboot.confnextboot_enable="YES" kernel="???halted by %srebooted by %sshutdownSIGTSTP initSIGTERM processesWARNING: some process(es) wouldn't die (can't restart init): j9v˪ڪ*9^9v9ȫ9ԫ7%+7+J%1a[F0nSnnSUI[~[-b blocksize] [-f file | -P pipecommand] [-s fileno]restore -x [-dhmNuvy]restore -t [-dhNuvy]restore -r [-dNuvy]restore -R [-dNuvy]restore -i [-dhmNuvy]usage: %s %s %s %s %s %s %s %s %s %s %s %s option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0-P and -f options are mutually exclusive%c and %c options are mutually exclusiveillegal dump number -- %sdump number must be greater than 0b:df:himNP:Rrs:tuvxynone of i, R, r, t or x options specified/dev/sa0Begin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c ./canonname: not enough buffer space Warning: undefined file type %d restore > %s: out of memory %s %s: no such file or directory %s: not a directory %s: not on extraction list extract directory is used If no `arg' is supplied, the current help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sls: out of memory directory reopen failed %s%s: name exceeds %d char %*d verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continuedir %10d %s %s: not on the tape ./%uMark entries to be removed. Delete whiteouts %s: REMOVE |ONTAPE|INOFND|NAMEFND|MODECHGcorrupted symbol table name/inode conflict, mktempname %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: %s [%s] %s: Extraneous name %s: (inode %d) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %d: bad first %s: not found on tape expected next file %d, got %d unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %d type should be LEAFMangled directory: reclen not multiple of 4 reclen less than DIRSIZ (%d < %d) bad seek pointer to rst_seekdir %ld error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s Set directory mode, owner, and times. TMPDIR/tmp/%s/rstmode%dmodefile not defined fopen: %s cannot open mode file %s directory mode, owner, and times not set set owner/mode for '.'cannot find directory inode %d error setting directory modes Cannot find directory inode %d named %s write error extracting inode %d, name %s read: %s Extract directories from tape %s/rstdir%d-XXXXXX%s - cannot create directory temporary fopen%s - cannot create modefile fopenopendirfile: %s Root directory is not on tape no memory directory table addino: out of range %d duplicate inumdeleteino: out of range %d deleteino: %d not found %s is not a directory %s: pathname too long cannot find entry in parent listnot marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundbad name no space for string table cannot move ROOTno memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry Check pointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Cannot allocate space for tape buffer /dev/ttycannot open %s: %s /dev/nullCannot allocate space for magtape buffer Dump date: %sthe epoch Dumped from: %sLevel %ld dump of %s on %s:%s Label: %s End-of-input encountered while extractingWarning: %s %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s write error extracting inode %d, name %s write: %s seek error extracting inode %d, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s hole in map Unknown conversion character: %c Format of dump tape is too old. Must use a version of restore from before 2002. Note: Doing Byte swapping Checksum error %o, inode %d file %s 8l4s1q8l2q17l2l4qgethead: unknown inode type %d Volume header begins with record %qdDumped inodes map headerUsed inodes map headerFile header, ino %dFile continuation header, ino %dEnd of tape header; predicted %ld blocks, got %ld blocksChanging volumes on pipe input? Otherwise, begin with volume 1. have no further files to extract. can quickly skip tapes that and work towards the first; restore start with the last volume If you are extracting just a few files,You have not read any tapes yet. You have read volumes%s%ldSpecify next volume #: Volume numbers are positive numerics Mount tape volume %ld Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) none RESTORE_VOLUMECannot set $RESTORE_VOLUME: %s Cannot open %s header read failed at %ld blocks tape is not dump tape Wrong volume (%ld) Wrong dump date got: %s wanted: %slast rec %qd, tape starts with %qd Skipping %ld duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %ld should be %ld Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %d continuation failed: %s End-of-tape encountered partial block read: %d should be %d unexpected tape header unknown tape header type %d resync restore, skipped %ld blocks ran off end of tape not at beginning of a file Missing address (header) block for %s at %ld blocks %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract fifo %s %s: cannot create fifo: %s extract special file %s %s: cannot create special file: %s %s: cannot create file: %s Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%d) Tape block size is %ld Tape is not a dump tape cannot stat .: %s bad block size %ld Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list maxino = %d no memory for active inode map Cannot find file dump list no memory for file dump list warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump corebad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s NODEentry type: %s inode number: %lu flags: %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s removeleaf: not a leafwarning: %s: %s Remove leaf %s removenode: not a noderemovenode: non-empty directoryRemove node %s newnode: not a nodeMake node %s not on ino listRSTTMP%s%ld%lumktempname: called with TMPNAMEwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d symbolichardCreate %s link %s->%s Lost connection to remote host. on %s: %s%stcpshell/tcp: unknown service who are you? invalid user name %s RMT/etc/rmtlogin to %s as %s failed. Connection to %s established. IP_TOS:IPTOS_THROUGHPUT setsockoptTCP_NODELAY setsockoptW%d Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). I%d %d ioctlL%d %d R%d C O%.226s %d %s: device already in use%s: NSWAPDEV limit reachedusage: %s -a | file ... [-AhklsU] [-a file ... | -d file ...] swapoffAadlhksUswremov%s: %sing %s as swap device vm.swap_infosysctlnametomib()%ld-blocksUsed:Device:%-13s %*s %*s xswdev version mismatch/dev/%-8s %*lld %*lld sysctl()Total: %*lld %*lld callocstrdupcan't get net id for hostFSID:%d:%dunmount of %s failedretrying using path instead of file system ID%s: unmount from %s udpRPCPROG_MNTRPCMNT_UMOUNTcannot remove mounttab entry %s:%s%s:%.*s%s: statfs%s/..%s: stat%s: not a file system root directory%s: unknown file systemfstab reading failure umount -a | -A [-F fstab] [-fv] [-h host] [-t type]usage: umount [-fv] special | node | fsidAaF:fh:t:v/var/db/mounttab%ld %s %s bad mounttab %s field '%s'can't open %s can't write to %swrite mounttab entry %s:%scan't remove %s by hostdelete mounttab entry%s %s:%stoggle verbose modesend new user informationshow command usageunset an optionget (set) umask on remote sideset file transfer typetoggle packet tracingset tenex file transfer typeshow remote system typetoggle store unique on remote machineset file transfer structureshow current statusshow size of remote filesend site specific command to remote server Try "rhelp site" or "site help" for more informationset or display optionstoggle use of PORT/LPRT cmd for each data connectiontoggle store unique for local filesshow status of remote machineremove directory on the remote machineget help from remote serverrestart file transfer at bytecountclear queued command repliesrename fileshow or set options for remote commandsget file restarting at end of local fileset socket send/receive buffer sizeset transfer rate limit (in bytes/second)send arbitrary ftp commandprint working directory on remote machinesend one fileissue command on alternate connectionforce interactive prompting on multiple commandstoggle transfer progress metertoggle preservation of modification time of retrieved fileslist contents of remote directory in a machine parsable form through your pagerlist contents of remote path through your pagertoggle use of passive transfer modeset translation table for default file name mappingset templates for default file name mappingget file if remote file is newer than local file get multiple files restarting at end of local filesend multiple filesshow last modification time of remote fileset file transfer modelist remote path in a machine parsable formlist contents of remote directory in a machine parsable formmake directory on the remote machineget multiple fileslist contents of multiple remote directoriesdelete multiple filesdefine a macroprint local working directoryview a local file through your pagerview a remote file through your pagerchange local working directoryget (set) idle timer on remote sideprint local help informationtoggle printing `#' marks; specify number to set sizetoggle metacharacter expansion of local file namesreceive filetoggle gate-ftp; specify host[:port] to change proxyconnect to remote ftp serverset file transfer formatget files using a localfile as a source of namesshow FEATures supported by remote systemtoggle use of EPSV/EPRT on IPv4 ftptoggle command line editinglist contents of remote pathdelete remote filetoggle/set debugging modetoggle carriage return stripping on ascii getsterminate ftp sessionchange file permissions of remote filechange remote working directory to parent directorychange remote working directorytoggle mget upper/lower case id mappingterminate ftp session and exitset binary transfer typebeep when command completedset ascii transfer typeappend to a filesend account command to remote serverexecute macroescape to the shellABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/                       !  '  E                    ` 6    KMGTP***************************************************************************************************************************************************************************************************************************************tenex%s %s [anpqy?]? EOF received; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list usage: %s [ | Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.usage: %s usage: %s mode-name We only support %s mode, sorry. usage: %s format We only support %s format, sorry. usage: %s struct-mode We only support %s structure, sorry. nmap: unbalanced brackets. local-fileremote-fileusage: %s local-file [remote-file] APPESTOUSTORContinue withlocal-filesusage: %s local-files mput%s: not foundusage: %s remote-file [local-file] Restart is not supported by the remote server. local: %sRETRr+remote-filesusage: %s remote-files mregetSkipping non-relative filename `%s' mgetusage: %s localfile Cannot open source file %s and logged inConnected %sto %s. Not connected. Connected for proxy commands to %s. No proxy connection. (none)Gate ftp: %s, server %s, port %s. Passive mode: %s; fallback to active mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Get transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. Socket buffer sizes: send %d, receive %d. Use of PORT cmds: %s. (disabled for this connection)Use of EPSV/EPRT cmds for IPv4: %s%s. Command line editing: %s. Macros: 20050514NetBSD-ftpVersion: %s %s usage: %s [ on | off ] %s %s. Bell modeEditing modePacket tracingusage: %s [ on | off | bytecount ] mark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [port] ] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD command not recognized, trying XCWD. XCWD %susage: %s [local-directory] lcd %sLocal directory now: %s Unable to determine local directory usage: %s remote-file DELE %susage: %s [remote-files] mdeletefrom-nameto-nameusage: %s from-name to-name RNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTLISTusage: %s [remote-path] usage: %s [remote-path [local-file]] pagermoreoutput to local-file:usage: %s remote-files local-file mlsusage: %s [command [args]] SHELL/bin/sh-cTry again laterusernameusage: %s username [password [account]] USER %sPassword: PASS %sAccount: EOF received; login aborted. ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameusage: %s directory-name MKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %sarguments to SITE commandusage: %s line-to-send SITE command line to sendusage: %s mode remote-file SITE CHMOD %s %susage: %s [umask] SITE UMASKSITE UMASK %susage: %s [seconds] SITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:usage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingusage: %s [inchars [outchars]] Ntrans off. Nmap off. mapoutusage: %s [mapin mapout] usage: %s [ on | off | auto ] EPSV/EPRT on IPv4Store uniqueReceive uniqueusage: %s (all|get|put),maximum-bytes[,increment-bytes]] usage: %s (all|get|put) [maximum-bytes [increment-bytes]] CDUPCDUP command not recognized, trying XCUP. XCUPusage: %s [restart-point] restart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %susage: %s [remote-file] STATSTAT %sLocal file "%s" is newer than remote file "%s". usage: %s local-file usage: %s size sndbufrcvbufxferbuf%s: size must be positive. usage: %s [option value] %-*s %s No such option `%s'. Setting `%s' to `%s'. usage: %s option Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %susage: %s command [options] OPTS is not supported by the remote server. OPTS %sOPTS %s %sanonpassftp_proxyhttp_proxyno_proxyrpromptaccountbyecdupnrdisconnectepsv4featuresfgetglobhashidlelcdlpagelpwdmacdefmlstmodtimemsendnewerntranspassivepdirplspmlsdpreservequoterecvremoptsrhelprstatusruniquesendportsitestructsuniquethrottletraceumaskunset Must be logged in to complete. unknown complete type `%c'usage: %s macro_name [args] '%s' macro not found. parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'parse_url: user `%s' pass `%s' host %s port %s(%d) path `%s' HTTP fetch aborted. Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'fetch_ftp: user `%s' pass `%s' host %s port %s path `%s' dir `%s' file `%s' *?[]{}Can't connect or login to host `%s'fetch_ftp: unknown transfer type %ddir `%s', nextpart `%s' ftp: The `CWD ' command (without a directory), which is required by RFC 1738 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'no file after directory (you must specify an output file) `%s'savefile `%s' copiedCannot open file `%s'Can't lseek to restart `%s'Copying %s (restarting at %lld)retrievedproxy URLMalformed proxy URL `%s'Scoped address notation `%s' disallowed via web proxyTrying %s... Can't create socketConnect to address `%s'Can't connect to %sRequesting %s (%svia %s:%sGET %s HTTP/1.0 Pragma: no-cache GET %s HTTP/1.1 Host: [%s]Host: %s:%uAccept: */* Connection: close Range: bytes=%lld- restarting at %lldCache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestReceiving HTTP replyreceived `%s' Content-Length:parsed len as: %lld Content-Range:bytesparsed range as: %lld-%lld/%lld Received unexpected Content-Range headerLast-Modified:%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %Yparsed date as: %sLocation:parsed location as `%s' Transfer-Encoding:Bogus transfer encoding - `binary' (fetching anyway)chunkedusing chunked encoding Proxy-Authenticate:WWW-Authenticate:Basicskipping unknown auth scheme `%s' parsed auth as `%s' Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s No authentication challenge provided by serverAuthorization failed. Retry (y/n)? auth_url: challenge `%s' realm="Unsupported authentication challenge - `%s'Username for `%s': Error retrieving file - `%s'Unknown error retrieving fileCan't run `%s'already done Size of `%s' differs from save file `%s'Can't open `%s'got chunksize of %lld Reading fileCan't change modification time to %sUnsupported transfer encoding - `%s'Unexpected EOF reading chunksizeUnexpected data following chunksizeWriting `%s'Unexpected data following chunkImproper response from `%s'about:tnftpThis version of ftp has been enhanced by Luke Mewburn for the NetBSD project. Execute `man ftp' for more details. lukemLuke Mewburn is the author of most of the enhancements in this ftp client. Please email feedback to . netbsdNetBSD is a freely available and redistributable UNIX-like operating system. For more information, see http://www.NetBSD.org/ versionVersion: %s %s%s `%s' is an interesting topic. auto_put: target `%s' auto_put: URL `%s' argv[2] `%s' %c%c%c421 Service not available, remote server timed out. Connection closed 421 Service not available, user interrupt. Connection closed. 421 Service not available, remote server has closed connection. %s:---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command.connect to address %sgetsocknameIPTOS_LOWDELAYsetsockopt %s (ignored)fdopen failed.Connected to %s. SO_OOBINLINE receive sendabortxfer called with unknown direction `%s' aborted. Waiting for remote to finish abort. runique: can't find unique file name. use of scoped address can be troublesomeSO_DEBUGEPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! %c%c%c%d%cparse error! connect for data channelSO_REUSEADDRsetsockopt %slistenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dIPTOS_THROUGHPUTpoll waiting before acceptpoll timeout waiting before accept remote abort aborted; closing connection. Lost control connection for abort.%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s sentlocal: %s %s: not a plain file. netoutreceivednetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %susage: %s [-46AadefginpRtvV] [-N netrc] [-o outfile] [-P port] [-q quittime] [-r retry] [-T dir,max[,inc][[user@]host [port]]] [host:path[/]] [file:///file] [ftp://[user[:pass]@]host[:port]/path[/]] [http://[user[:pass]@]host[:port]/path] [...] %s -u URL file [...] no such option `prompt'ftp> no such option `rprompt'Sorry, input line is too long. usage: %s [command [...]] Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue() invoked with NULL namegetoptionvalue() invoked with unknown option `%s'setupoption()FTPSERVERPORThttpftpgateNETRC$NETRC `%s': %scan't create socketunable to get default rcvbuf sizeunable to get default sndbuf sizeFTPMODEactiveunknown $FTPMODE '%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbbad quit value: %sbad retry value: %s-Tbad throttle value: %s46AadefginN:o:pP:q:r:RtT:u:vVHOMEanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTFTPRPROMPTRetrying in %d seconds... %lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %cB/s) ETA: %02d:%02d (stalled)xsignal_restart called with signal %d %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %c%c %3lld.%02d %cB/s --:-- ETA - stalled -%02d:%02d ETApasswordpasswdmachineMissing macdef name argument. 4K macro buffer exceeded. Unknown .netrc keyword %sError: .netrc file is readable by others.Remove account or make file unreadable by others.Macro definition missing null line terminator. Remove password or make file unreadable by others.MDTMREST STREAMTVFSRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. features[FEAT_FEAT] = %d features[FEAT_MDTM] = %d features[FEAT_MLST] = %d features[FEAT_REST_STREAM] = %d features[FEAT_SIZE] = %d features[FEAT_TVFS] = %d sorry, arguments too long. (%s) PWDgot remotecwd as `%s' ftpXXXXXXXXXXunable to create temporary file %scan't find list of remote files, oops. can't find list of remote files, oops.SIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %04d%02d%02d%02d%02d%02dCan't parse time `%s'. got localcwd as `%s' Unable to determine real path of `%s'crankrate invoked with unknown signal: %demacsContext sensitive argument completionftp-complete^Iunable to set sndbuf size %dunable to set rcvbuf size %disipv6addr: got %d for %s Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistxstrdup() called with NULL argumentUnable to allocate memory for string copyUnknown port `%s', using port %dftp_login: user `%s' pass `%s' host `%s' Name (%s:%s): Name (%s): Password:Login failed.$initAlready connected to %s, use close first. usage: %s host-name [port] gateserver not defined (shouldn't happen)Connecting via pass-through server %s non-printstream$tI{{||{{{{{{| |{{{{ԈԈpppppppA~ppp1`Z9JæҦYKR=DDefine an environment variableundefineUndefine an environment variableMark an environment variable for automatic exportunexportDon't mark an environment variable for automatic exportSend an environment variableList the current environment variablesPrint help informationUse local special character definitionsimportUse remote special character definitionscheckVerify remote special character definitionscrmodlogouttoggleslcenvironopieautoflushflushing of output when sending interrupt charactersflush output when sending interrupt charactersautosynchautomatic sending of interrupt characters in urgent modesend interrupt characters in urgent modeskiprcdon't read ~/.telnetrc fileskip reading of ~/.telnetrc filesending and receiving of binary datainbinaryoutbinarysending of binary datacrlfsending carriage returns as telnet mapping of received carriage returnsmap carriage return on outputlocalcharslocal recognition of certain control charactersrecognize certain control charactersturn on socket level debuggingnetdataprinting of hexadecimal network data (debugging)print hexadecimal representation of network trafficprettydumpoutput of "netdata" to user readable format (debugging)print user readable output for "netdata"viewing of options processing (debugging)show option processingtermdata(debugging) toggle printing of hexadecimal terminal dataprint hexadecimal representation of terminal trafficcharacter to toggle local echoing on/offcharacter to escape back to telnet command moderloginrlogin escape charactertracefilefile to write trace information toThe following need 'localchars' to be toggled trueflushoutputcharacter to cause an Abort Outputinterruptcharacter to cause an Interrupt Processcharacter to cause an Abort processcharacter to cause an EOF The following are for local editing in linemodecharacter to use to erase a charactercharacter to use to erase a linelnextcharacter to use for literal nextcharacter to cause a Suspend Processcharacter to use for line reprintworderasecharacter to use to erase a wordcharacter to use for XONcharacter to use for XOFFforw1alternate end of line characterforw2aytalternate AYT characteraoSend Telnet Abort outputSend Telnet 'Are You There'Send Telnet BreakbreakSend Telnet Erase CharacterSend Telnet Erase LineSend current escape characterSend Telnet 'Go Ahead' sequenceSend Telnet Interrupt ProcessintpintrnopSend Telnet 'No operation'eorSend Telnet 'End of Record'Send Telnet 'Abort Process'Send Telnet 'Suspend Process'Send Telnet End of File CharacterPerform Telnet 'Synch operation'getstatusSend request for STATUSDisplay send optionsdontwillwontDisable LINEMODE option(or disable obsolete line-by-line mode)Enable LINEMODE option(or enable obsolete line-by-line mode)These require the LINEMODE option to be enabledEnable signal trapping+isig-isigDisable signal trappingEnable character editing+edit-editDisable character editingEnable tab expansion+softtabs-softtabsEnable literal character echo+litecho-litechoDisable literal character echokludgeline%s sequence challenge /usr/bin/opiekey^?%-15s %s usage: send %s "value" must be from 0 to 255Valid options are: '%s': ambiguous argument ('send %s ?' for help). '%s': unknown argument ('send %s ?' for help). '%s': bad value ('send %s ?' for help). ?Need to be connected first.setsockopt (SO_DEBUG)Will send carriage returns as telnet .Will send carriage returns as telnet .Already operating in binary mode with remote host.Negotiating binary mode with remote host.Already in network ascii mode with remote host.Negotiating network ascii mode with remote host.Already receiving in binary mode.Negotiating binary mode on input.Already receiving in network ascii mode.Negotiating network ascii mode on input.Already transmitting in binary mode.Negotiating binary mode on output.Already transmitting in network ascii mode.Negotiating network ascii mode on output.%-15s toggle %s display help informationenabledisable%-15s %s %s Need an argument to 'toggle' command. 'toggle ?' for help. '%s': ambiguous argument ('toggle ?' for help). '%s': unknown argument ('toggle ?' for help). WillWon'tTelnet rlogin escape character is '%s'. Telnet escape character is '%s'. '%s': unknown argument ('set ?' for help). Format is 'set togglename [on|off]' 'set ?' for help.Format is 'set Name Value' 'set ?' for help.'%s': ambiguous argument ('set ?' for help). %s set to "%s". %s character is '%s'. Need an argument to 'unset' command. 'unset ?' for help. '%s': unknown argument ('unset ?' for help). '%s': ambiguous argument ('unset ?' for help). %s reset to "%s". ?Need to have LINEMODE option enabled first.'mode ?' for help.format is: 'mode Mode', where 'Mode' is one of: 'mode' command requires an argumentUnknown mode '%s' ('mode ?' for help). Ambiguous mode '%s' ('mode ?' for help). won't%-15s [%s] %-15s "%s" ?Ambiguous argument '%s'. ?Unknown argument '%s'. Deprecated usage - please use 'set escape%s%s' in the future. new escape character: Deprecated usage - please use 'toggle crmod' in the future.%s map carriage return on output. Fork failed ExeclConnection closed.fromquitNeed an argument to 'slc' command. 'slc ?' for help. '%s': unknown argument ('slc ?' for help). '%s': ambiguous argument ('slc ?' for help). Need an argument to 'environ' command. 'environ ?' for help. '%s': unknown argument ('environ ?' for help). '%s': ambiguous argument ('environ ?' for help). only Need %s%d argument%s to 'environ %s' command. 'environ ?' for help. DISPLAYunix:USERLOGNAMEPRINTERCannot send '%s': Telnet ENVIRON option not enabled Cannot send '%s': variable not defined %c %-20s %s notmuchOperating with LINEMODE optionLocalNo%s line editing %s catching of signals Operating in obsolete linemodeOperating in single character modeCatching signals locallyRemote%s character echo %s flow control No connection.Escape character is '%s'. need at least one argument for 'send' commandNeed %d argument%s to 'send %s' command. 'send %s ?' for help. 'send ?' for helpThere is not enough room in the buffer TO the networkto process your request. Nothing will be done.('send synch' will throw away most data in the networkbuffer, if this might help.)Unknown send argument '%s' 'send ?' for help. Ambiguous send argument '%s' 'send ?' for help. Telnet 'send' error - argument disappeared! SENT%s> ?Ambiguous command?Invalid commandCommands may be abbreviated. Commands are: ?Ambiguous help command %s ?Invalid help command %s ?Already connected to %s (to) -ausage: %s [-l user] [-a] [-s src_addr] host-name [port] hostname too long for unix domain socket: %sBad source route option: %s setsockopt (source route)telnet: setsockopt (IP_TOS) (ignored)Unable to connect to remote host/.telnetrc?Ambiguous command: %s ?Invalid command: %s ?Need to be connected first for %s. telnet: socketConnection closed by foreign host. [host-name [port]][-r] [-s src_addr] [-u] [-e char] [-l user] [-n tracefile] [-4] [-6] [-8] [-E] [-L] [-N] [-S tos] [-c] [-d]usage: %s %s%s%s%s rlog; will try to use default TOS: Bad TOS argument '%s: Warning: -f ignored, no Kerberos V5 support. %s: Warning: -F ignored, no Kerberos V5 support. %s: Warning: -k ignored, no Kerberos V4 support. %s: Warning: -x ignored, no ENCRYPT support. %s: Warning: -y ignored, no ENCRYPT support. 468EKLNS:X:acde:fFk:l:n:rs:uxySetSockOptsleep(5) from telnet, after select: %s UNKNOWNlm_will: no command!!!lm_will: not enough room in bufferlm_wont: no command!!!lm_do: no command!!!lm_do: not enough room in bufferlm_dont: no command!!!lm_mode: not enough room in bufferslc_import: not enough roomremote defaultremoteSpecial characters are %s values slc_end_reply: not enough roomenv_opt_start: malloc()/realloc() failed!!!SYSTEMTYPEJOBACCTenv_opt_add: realloc() failed!!!%c%c%c%c%s%c%cNo room in buffer for terminal type. %c%c%c%c%ld,%ld%c%cz Remote side does not support STATUS optionIn SUBOPTION processing, RCVDclose SYNCHBRKIPAOAYTEORABORTSUSPRPLNEXTFORW1FORW2MCLMCRMCWLMCWRMCBOLMCEOLINSRTOVERECREWREBOLEEOLBINARYRCPSUPPRESS GO AHEADTIMING MARKRCTENAOLNAOPNAOCRDNAOHTSNAOHTDNAOFFDNAOVTSNAOVTDNAOLFDEXTEND ASCIILOGOUTBYTE MACRODATA ENTRY TERMINALSUPDUPSUPDUP OUTPUTSEND LOCATIONTERMINAL TYPEEND OF RECORDTACACS UIDOUTPUT MARKINGTTYLOC3270 REGIMEX.3 PADNAWSTSPEEDLFLOWLINEMODEXDISPLOCOLD-ENVIRONAUTHENTICATIONENCRYPTNEW-ENVIRONTN3270ECHARSETCOM-PORTKERMITNOPDMARKGASBWILLWONTDONTIACCannot open %s. (standard output)%c 0x%x %c%.2x%s IAC %s%s IAC %d%s %s EXOPL%s %d %dresp DO_DONT %s: %d resp DO_DONT %d: %d want DO %s want DO %d want DONT %s want DONT %d DO %s DO %d resp WILL_WONT %s: %d resp WILL_WONT %d: %d want WILL %s want WILL %d want WONT %s want WONT %d WILL %s WILL %d %s IAC SB (terminated by %d , not IAC SE!) (Empty suboption???)TERMINAL-TYPE TERMINAL-SPEED (empty suboption???) IS SEND %d (unknown) ?%d?TOGGLE-FLOW-CONTROL OFF ON RESTART-ANY RESTART-XON %d %d (%d)LINEMODE WILL WONT DO DONT (no option???)Forward Mask %xSLC NOSUPPORT CANTCHANGE VARIABLE DEFAULT|FLUSHOUT|FLUSHIN|ACK %d;(no mode???)|LIT_ECHO|SOFT_TAB|TRAPSIG|EDIT (0x%x) ?0x%x? IS IS %s %d SEX-DISPLAY-LOCATION IS "%.*s"- unknown qualifier %d (0x%x).NEW-ENVIRON SEND INFO " VALUE " VAR " ESC " USERVAR " %03o %s (unknown) %02x+AG:KQ:U[:_e:inz Aa:3a=Ka:%!_$:U6:0123456789abcdef01234567u|""#R###"#$$$$$$%D%.&%M&&M&%&'888888DNZfq{T????? c$.5>E]9.cKS`k vXeXeXeekcd4edeeed@;e^.e %r+6e? FP@[en@ye@ ef [f f fs\  M/ / h}ho "P6%&2,*072W4":'7*876>oZ=B<"'?.?I6N9I<K?LMQpXp_pfpmptp*P1bgBB=!===!1  >ߠKds  wZa H3a? B #J\1 [l? B -aֿ1ߠ $)0K% KN"z~j  4 B+LSVnBu$wRmhm  % #S SZhh 1ߠ: B 66  Ta4  v B$A  a(  $Nd UZi%|s  | H+;1  OsT 4HT 4Hz_ >\ߠ8IN qazPDx ߠ\y! 1HK U#83& ?BR\Mߠt Ha H+S0 Na 6 y| : ? V(%@ ߠCM@ ߠfM4 Bs+r q ߠi *q ߠ -Fj ߠMYj8 4Hnx @ͼ  : H,Sm m !-S [k\s $S $S $S9Mi $QL@ ptbH ` H+=ia{h X1wX=w    ) 0<T Yl 3G^   k  v     v    ! ) > G P g o w     B $ 2 ; D M ١    ȡ  "@T    6 @ X [ w                D! +  DF P  f i  HDz   D  A D     ޥ  @  +    5 8 H U X ? o y ^          @  Ȧ     D5 @   ,a      Y D  T "@D  w& (C' "@DLU "@Dkt HD  DA HD6  "@;I  @ [[ vt  D  ,  , "@2@  S[·  mv.  D'+  Dm  F- HER[ Ekt  P   E E "@-~  -6]  KU y  a  F!  '  D7@/  Xi2   @D  @D:  D @DB < "B(0  @I.  D`i  {  +  D  F  D6?)  W` DxA D  D`  "@-h    '  J]  r  F!  :'  D.  0  0N0 @w "@D^  D "@D  - 1 5 9 = A E I             y y                 ;          y  l" u" ~" " " " " " d  ,c3 3 3 w3 3 3 3 3 3 3 3 3 WE uE ? fG E |/-\smcupError: move: l(%u) c(%u) o(%u)xterm]0;%susage: ex [-eFRrSsv] [-c command] [-t tag] [-w size] [file ...] usage: vi [-eFlRrSv] [-c command] [-t tag] [-w size] [file ...] signal-resettcgetattr%s: No terminal database found %s: %s: unknown terminal type lines=%lucolumns=%lurmsotcsetattr016|Vi's standard input and output must be a terminalLINES%s: unknown terminal typekcud1jakcub1hakcuu1kakcuf1lakil1insert linekdch1keldelete to eolkindscroll downkllgo to eolkendkhomego to solkich1insert at cursorkdl1delete lineknppage downkpppage upkriscroll updelete to end of screenkf%d233|This terminal has no %s keyfunction key %dstderr046|messages not turned on: %s045|messages not turned off: %stigetnum: linestigetnum: cols002|Line length overflow/tmp240|%s: remove241|%s: close242|%s: remove243|%s: remove265|File is a temporary; exit will discard modifications264|File modified since last complete write; write or use ! to override244|Read-only file, not written; use ! to override245|Read-only file, not written246|%s exists, not written; use ! to override247|%s exists, not written248|Partial file, not written; use ! to override249|Partial file, not written250|%s: file modified more recently than this copy; use ! to override251|%s: file modified more recently than this copy258|%s expanded into too many file names259|%s: not a regular file260|%s: not owned by you261|%s: accessible by a user other than the owner252|%s: write lock was unavailable254|%s: WARNING: FILE TRUNCATED256|%s: new file: %lu lines, %lu characters315|%s: appended: %lu lines, %lu characters257|%s: %lu lines, %lu characters266|File readonly, modifications not auto-written262|File modified since last complete write; write or use ! to override263|File modified since last complete write; write or use :edit! to override%s/vi.XXXXXXXXXX237|Unable to create temporary file238|Warning: %s is not a regular file239|%s already locked, session is read-only-c option276|Unexpected character event277|Unexpected end-of-file event279|Unexpected interrupt event280|Unexpected quit event281|Unexpected repaint event285|Unexpected string event286|Unexpected timeout event316|Unexpected resize event287|Unexpected write event008|Error: unable to retrieve line %lu007|unable to get last line006|unable to store line %lu005|unable to insert at line %lu004|unable to append to line %lu003|unable to delete line %lu009|Log file015|%s/%d: log put error267|Log restarted013|Logging not being performed, roll-forward not possible014|No changes to re-do/usr/src/usr.bin/vi/../../contrib/nvi/common/log.c012|Logging not being performed, undo not possible010|Logging not being performed, undo not possible011|No changes to undoex/vi: %s%.*snviewc:eFGlRrSst:vw:-s option is only applicable to ex.window=%sonly one -c command may be specified.only one of -r and -t may be specified.only one tag file may be specified.017|Mark %s: not set018|Mark %s: the line was deleted019|Mark %s: cursor position no longer exists268|confirm? [ynq]269|Press any key to continue: 270|Press any key to continue [: to enter more ex commands]: 161|Press Enter to continue: 275| cont?271|Press any key to continue [q to quit]: 317|%d files to edit021|new file022|name changed023|modified024|unmodified025|UNLOCKED026|readonly028|empty file027|line %lu of %lu [%lu%%]029|line %lu293|added294|changed295|deleted296|joined297|moved298|shifted299|yanked300|line301|lines020|Error: , %d: LC_MESSAGESLANGVI_MESSAGE_CATALOG030|The file %s is not a message catalogaltweraseautoindentautoprintautowritebackupbeautifycdpathceditcommentedcompatibleescapetimeerrorbellsextendedfilecflashgtagsmodehardtabsiclowerignorecasekeytimeleftrightlispmagicmatchtimemodelinemsgcatnoprintoctaloptimizeparagraphsrecdirredrawremapreportrulersearchincrsectionssecureshellmetashiftwidthshowmatchshowmodesidescrollslowopensourceanytabstoptaglengthtersetildeoptimeoutttywerasew1200w300w9600warnwindownamewraplenwrapmarginwrapscanwriteanyaibfcolimodelinesnuparaslowsmsmdttytypewawiwlwm033|set: no %s option: 'set all' gives all option values305|No %s edit option specified%s=%ld%s="%s"set %s set no%s set %s=%-3ld set 032|Usage: %s291|set: the %s option may not be turned off313|set: the %s option may never be turned on034|set: [no]%s option doesn't take a value035|set: %s option isn't a boolean036|set: %s option: %s037|set: %s option: %s: value overflow038|set: %s option: %s is an illegal number314|set: the %s option may never be set to 0039|set: %s option isn't a booleanCDPATHcdpath=%sdirectory=%sescapetime=6keytime=6matchtime=7/usr/share/vi/catalog/msgcat=%sreport=5paragraphs=IPLPPPQPP LIpplpipbp/var/tmp/vi.recoverrecdir=%ssections=NHSHH HUnhshshell=%sshellmeta=~{[*?$`'"\shiftwidth=8sidescroll=16tabstop=8tags=%sscroll=%ldwindow=%lu031|Unable to set default %s option040|Screen columns too small, less than %d041|Screen columns too large, greater than %d042|Screen lines too small, less than %d043|Screen lines too large, greater than %d044|The lisp option is not implemented048|The paragraph option must be in two character groups049|The section option must be in two character groups053|The default buffer is empty054|Buffer %s is empty078|Searching...072|File empty; nothing to search073|Reached end-of-file without finding the pattern074|No previous search pattern075|Pattern not found076|Reached top-of-file without finding the pattern077|Search wrappedrecdir: %sX-vi-recover-file: X-vi-recover-path: 066|%s: malformed recovery file%.24s: %s vi: no files to recover.067|%s: malformed recovery file068|No files named %s, readable by you, to recover069|There are older versions of this file for you to recover070|There are other files for you to recover055|Files with newlines in the name are unrecoverable%s/vi.XXXXXX056|Modifications not recoverable if the session fails/usr/sbin/sendmail071|not sending email: %s%s -t < %s062|Information on user id %u not found%s/recover.XXXXXX063|Unable to lock recovery filePrecedence: bulkSubject: Nvi saved the file To: From: root (Nvi recovery program)Reply-To: root%s%s %s%s %s %s %s%s %s%s %s -r : to this file using the -r option to You can recover most, if not all, of the changes , when it was saved for recovery. on the machine was editing a file named , the user On %s%.24s%s%s%s%s%s%s%s%s%s%s%s%s%s%s 064|Recovery file buffer overrun065|Recovery file060|File backup failed: %s061|Copying file for recovery...057|Copying file for recovery...058|Preservation failed: %s059|Modifications not recoverable if the session fails099|Address value overflow100|Address value underflow101|Illegal address combination102|Illegal address: only %lu lines in the file103|Illegal address: the file is empty104|The %s command doesn't permit an address of 0$0123456789'\/?.+-^095|No mark name supplied096|\ not followed by / or ?097|Reference to a line number less than 0094|The second address is smaller than the first!#&*<=>@~080|Unknown command name1bca1098|The %s command is unknown082|%s: command not available in ex mode085|Internal syntax table error (%s: %s)086|Usage: %s088|Flag offset to before line 1089|Flag offset past end-of-file090|@ with range running when the file/screen changed091|Global/v command running when the file/screen changed083|Count may not be zero084|%s: bad line specification092|Ex command failed: pending commands discarded093|Ex command failed: mapped keys discardedscript170|Interrupted105|No abbreviations to display106|Abbreviations must end with a "word" character107|Abbreviations may not contain tabs or spaces108|Abbreviations may not mix word/non-word characters, except at the end109|"%s" is not an abbreviation273|Entering ex input mode.111|No more files to edit112|No previous files to edit113|No previous files to rewind114|No file list to display115|No previous command to replace "!"116|No filename to substitute for %%117|No filename to substitute for #289|Shell expansions not supported when the secure edit option is setfdopenvfork118|Error: execl: %s119|I/O error: %s304|Shell expansion failed!%s 303|File modified since last write.120|File modified since last complete write; write or use ! to override121|Unable to find home directory location122|New current directory: %sscroll lines[line [,line]] ! commandfilter lines through commands or run commands[line [,line]] # [count] [l]display numbered lines[line [,line]] & [cgr] [count] [#lp]repeat the last subsitution* [buffer]execute a buffer[line [,line]] <[<...] [count] [flags]shift lines left[line] = [flags]display line number[line [,line]] >[>...] [count] [flags]shift lines right@ [buffer][line] a[ppend][!]append input to a lineab[brev] [word replace]specify an input abbreviationargsar[gs]display file argument listbgput a foreground screen into the background!ca[line [,line]] c[hange][!] [count]change lines to input!f1ocd[!] [directory]change the current directorychdirchd[ir][!] [directory][line [,line]] co[py] line [flags]copy lines elsewhere in the filecscope!scs[cope] command [args]create a set of tags using a cscope command[line [,line]] d[elete][flags] [buffer] [count] [flags]delete lines from the filedisplay b[uffers] | c[onnections] | s[creens] | t[ags]display buffers, connections, screens or tags[Ee][dit][!] [+cmd] [file]begin editing another file[Ee]x[!] [+cmd] [file]exusage[exu]sage [command]display ex command usage statementf[ile] [name]display (and optionally set) file namefg[Ff]g [file]bring a backgrounded screen into the foregroundglobal[line [,line]] g[lobal][!] [;/]RE[;/] [commands]execute a global command on lines matching an REhe[lp]display help statement[line] i[nsert][!]insert input before a line!ca1[line [,line]] j[oin][!] [count] [flags]join lines into a single line[line] k keymark a line position[line [,line]] l[ist] [count] [#]display lines in an unambiguous form[line [,line]] m[ove] linemove lines elsewhere in the file[line] ma[rk] key!Wmap[!] [keys replace]map input or commands to one or more keysmkexrc!f1rmkexrc[!] filewrite a .exrc file!fN[Nn][ext][!] [+cmd] [file ...]edit (and optionally specify) the next file[line [,line]] nu[mber] [count] [l]change display to number lines[line] o[pen] [/RE/] [flags]enter "open" mode (not implemented)[line [,line]] p[rint] [count] [#l]display linesperlpe[rl] cmdrun the perl interpreter with the commandperldoperld[o] cmdrun the perl interpreter with the command, on each linepre[serve]preserve an edit session for recovery[Pp]rev[ious][!]edit the previous file in the file argument list[line] pu[t] [buffer]append a cut buffer to the lineq[uit][!]exit ex/vi[line] r[ead] [!cmd | [file]]append input from a command or file to the linerecover[!] filerecover a saved fileresizec+resize [+-]rowsgrow or shrink the current screenrew[ind][!]re-edit all the files in the file argument listrtag!w1o[Rr]ta[g][!] [string]edit the file containing the tag[line [,line]] s [[/;]RE[/;]repl[/;] [cgr] [count] [#lp]]substitute on lines matching an REsc[ript][!] [file]run a shell in a screenwNse[t] [option[=[value]]...] [nooption ...] [option? ...] [all]set options (use ":set all" to see all options)sh[ell]suspend editing and run a shellsourceso[urce] fileread a file of ex commandsst[op][!]suspend the edit sessionsu[spend][!][line [,line]] t line [flags][Tt]a[g][!] [string]tagnexttagn[ext][!]move to the next tagtagpoptagp[op][!] [number | file]return to the previous group of tagstagprevtagpr[ev][!]move to the previous tagtagtoptagt[op][!]discard all tagstcltc[l] cmdrun the tcl interpreter with the commandu[ndo]undo the most recent changeunabbreviateuna[bbrev] worddelete an abbreviation!w1runm[ap][!] worddelete an input or command map[line [,line]] v [;/]RE[;/] [commands]execute a global command on lines NOT matching an REdisplay the program version informationvisual2c11[line] vi[sual] [-|.|+|^] [window_size] [flags]enter visual (vi) mode from ex mode[Vv]i[sual][!] [+cmd] [file]edit another file (from vi mode only)viusage[viu]sage [key]display vi key usage statement[line [,line]] w[rite][!] [ !cmd | [>>] [file]]write the file[line [,line]] wn[!] [>>] [file]write the file and switch to the next filewq[line [,line]] wq[!] [>>] [file]write the file and exit[line [,line]] x[it][!] [file]bca[line [,line]] ya[nk] [buffer] [count]copy lines to a cut buffer3c01[line] z [-|.|+|^|=] [count] [flags]display different screens of the file[line [,line]] ~ [cgr] [count] [#lp]replace previous RE with previous replacement string,Add a new cscope databaseadd file | directoryQuery the databases for a patternfind c|d|e|f|g|i|s|t buffer|pattern c: find callers of name d: find all function calls made from name e: find pattern f: find files with name as substring g: find definition of name i: find files #including name s: find all uses of name t: find assignments to nameShow help for cscope commandshelp [command]Kill a cscope connectionkill numberDiscard all current cscope connectionscd '%s' && exec cscope -dl -f %s312|%d: no such cscope sessionNo cscope connections. %2d %s (process %lu) %s doesn't match any cscope command Command: %s (%s) cscope commands: %*s: %s cscope.outcscope.tpathCSCOPE_DIRS :309|Use "cscope help" for help310|No cscope connections runningsgdct efi311|%s: unknown search type: use one of %s%d%s cscope: %d lines%1[ ]%s: "%s" 278|No matches for query (line mode) (character mode)********** %s%s buffers123|No cut buffers to displaydefault bufferfilterfilter readparent-writer124|The %s command can't be used as part of a global or v command125|%s/%s: not sourced: not owned by you or root126|%s/%s: not sourced: not owned by you127|%s/%s: not sourced: writeable by a user other than the owner128|%s: not sourced: not owned by you or root129|%s: not sourced: not owned by you130|%s: not sourced: writeable by a user other than the owner/etc/vi.exrcNEXINIT.nexrc131|No following lines to join.?!132|No input map entries133|No command map entries134|The %s character may not be remapped135|"%s" isn't currently mapped136|Mark names must be a single character137|%s exists, not written; use ! to overrideabbreviate map map! 138|New exrc file: %s139|Destination line is inside move range140|The open command requires that the open option be set141|The open command is not yet implemented142|Preservation of this file not possible143|File preserved %6lu TOOBIG 147|Reading...148|%s: %lu lines, %lu characters145|Only regular files and named pipes may be read146|%s: read lock was unavailable149|No background screens to display151|No command to executescript-shell150|The script command is only available in vi modepqrs0123456789abcdefemacs:TERMCAPEMACSError: timed outError: shell: EOFAbort trapAlarm clockBus errorChild exitedContinuedEMT trapFloating point exceptionHangupIllegal instructionInformation requestInterruptI/O possibleIOT trapKilledBroken pipeProfiling timer expiredQuitSegmentation faultSuspended (signal)Bad system callTerminatedTrace/BPT trapSuspendedStopped (tty input)Stopped (tty output)Urgent I/O conditionUser defined signal 1User defined signal 2Virtual timer expiredWindow size changesCputime limit exceededFilesize limit exceededUnknown signal: %d; core dumped%.*s%s: received signal: %s%s%.*s%s: exited with status %d%s -i152|shiftwidth option set to 0RE error: %s([ ]|/\*([^*]|\*/)*\*/)*\^.[]$*+?()|{}^.[]$*[[:<:]][[:>:]]153|Count overflow154|Count underflow156|The #, l and p flags may not be combined with the c flag in vi mode169|Confirm change? [n]157|No match found155|Regular expression specified; r flag meaningless164|%s: the tag's line number is past the end of the file165|The tags stack is empty166|%s: search pattern not found159|Less than %s entries on the tags stack; use :display t[ags]160|No file %s on the tags stack to return to; use :display t[ags]292|Display too small.%2d ... %*.*s %*.*s255|Already at the first tag of this group282|Already at the last tag of this group158|No previous tag enteredrxglobal -%s '%s'162|%s: tag not found163|%s: corrupted tag in %smunmapTo see the list of vi commands, enter ":viusage" To see the list of ex commands, enter ":exusage" For an ex command usage statement enter ":exusage [cmd]" For a vi key usage statement enter ":viusage [key]" To exit, enter ":q!" The %.*s command is unknown Command: %s Usage: %s The %s key has no current meaning Key:%s%s Usage: %s 167|%d more files to edit168|Buffer %s is empty144|%s: expanded into too many file names283|The %s command requires the ex terminal interface272|That form of %s requires the ex terminal interface274|Command failed, no file read in yet.173|The %s command requires that a file have already been read in171|No previous buffer to execute172|No previous regular expression230|This screen may not be suspended290|The %s command is not supported when the secure edit option is set284|That form of %s is not supported when the secure edit option is set174|Usage: %sVersion 1.79 (10/23/96) The CSRG, University of California, Berkeley.175|The visual command requires that the open option be set%luz%c%lu%luz%c253|Writing...---------------------------------------- 302|Vi was not loaded with a Tcl interpreter306|Vi was not loaded with a Perl interpreter177|Empty file178|No previous F, f, T or t search179|%s not found[count]^A^A search forward for cursor word[count]^B^B scroll up by screens^C^C interrupt an operation (e.g. read, write, search)[count]^D^D scroll down by half screens (setting count)[count]^E^E scroll down by lines[count]^F^F scroll down by screens^G^G file status[count]^H^H move left by characters[count]^J^J move down by lines^L^L redraw screen[count]^M^M move down by lines (to first non-blank)[count]^N^N move down by lines[count]^P^P move up by lines^R^R redraw screen^T^T tag pop[count]^U^U half page up (set count)^V^V input a literal character^W^W move to next screen[count]^Y^Y page up by lines^Z^Z suspend editor^[ ^[ exit input mode, cancel partial commands^\ ^\ switch to ex mode^]^] tag push cursor word^^^^ switch to previous file[count]' ' move right by columns[count]![count]motion command(s) ! filter through command(s) to motion[count]# +|-|# # number increment/decrement [count]$ $ move to last column % move to match & repeat substitution'['a-z] ' move to mark (to first non-blank)[count]( ( move back sentence[count]) ) move forward sentence[count]+ + move down by lines (to first non-blank)[count], , reverse last F, f, T or t search[count]- - move up by lines (to first non-blank) . repeat the last command/RE[/ offset] / search forward 0 move to first character:command [| command] ... : ex command[count]; ; repeat last F, f, T or t search[count]<[count]motion < shift lines left to motion[count]>[count]motion > shift lines right to motion?RE[? offset] ? search backward@buffer @ execute buffer[count]A A append to the line[count]B B move back bigword[buffer][count]C C change to end-of-line[buffer]D D delete to end-of-line[count]E E move to end of bigword[count]F character F character in line backward search[count]G G move to line[count]H H move to count lines from screen top[count]I I insert before first nonblank[count]J J join lines[count]L L move to screen bottom M move to screen middle N reverse last search[count]O O insert above line[buffer]P P insert before cursor from buffer Q switch to ex mode[count]R R replace characters[buffer][count]S S substitute for the line(s)[count]T character T before character in line backward search U Restore the current line[count]W W move to next bigword[buffer][count]X X delete character before cursor[buffer][count]Y Y copy lineZZZZ save file and exit[[[[ move back section]] move forward section ^ move to first non-blank _ move to first non-blank`[`a-z] ` move to mark[count]a a append after cursor[count]b b move back word[buffer][count]c[count]motion c change to motion[buffer][count]d[count]motion d delete to motion[count]e e move to end of word[count]f character f character in line forward search[count]h h move left by columns[count]i i insert before cursor[count]j j move down by lines[count]k k move up by lines[count]l l move right by columnsm[a-z] m set mark n repeat last search[count]o o append after line[buffer]p p insert after cursor from buffer[count]r character r replace character[buffer][count]s s substitute character[count]t character t before character in line forward search u undo last change[count]w w move to next word[buffer][count]x x delete character[buffer][count]y[count]motion y copy text to motion into a cut buffer[line]z[window_size][-|.|+|^|] z reposition the screen[count]{ { move back paragraph[count]| | move to column[count]} } move forward paragraph[count]~ ~ reverse case207|The Q command requires the ex terminal interface180|No previous file to edit307|No ex command to execute%+ld0X%0*lX0x%0*lx%#0*lo182|Resulting number too large183|Resulting number too smallabcdefABCDEF181|Cursor not in a number184|No match character on this line185|Matching character not found186|No characters to replace308|Enter to execute a command, :q to exit187|No other screen to switch to190|Search wrapped to original position189|No previous search pattern188|Characters after search string, line offset and/or z command194|No more characters to erase193|Already at the beginning of the insert191|Abbreviation exceeded expansion limit: characters discarded192|Illegal character; quote to enterUnmatched %s201|Buffers should be specified before the command209|The file is empty202|Already at end-of-file203|Already at end-of-line204|%s isn't a vi commandWindow resize interrupted text input mode205|Usage: %s195|Movement past the end-of-file196|Movement past the end-of-line197|No cursor movement made198|Already at the beginning of the file199|Movement past the beginning of the file200|Already in the first column206|No characters to delete[count]~[count]motion ~ change case to motion235|Number larger than %lu234|Only one buffer may be specified208|No command to repeat210|%s may not be used as a motion command212|Cursor not in a word211|Already in command mode214|Windows option value is too large, max is %u110|Vi command failed: mapped keys discarded231|Interrupted: mapped keys discarded236|Interrupted%d screens backgrounded; use :display to list them%7lu +=+=+=+=+=+=+=+215|Append216|Change217|Command218|Insert219|Replace%lu,%lu220|Movement past the end-of-screen221|Movement past the beginning-of-screen222|Screen must be larger than %d lines to split225|You may not background your only displayed screen228|The screen cannot grow227|The screen cannot shrink226|The screen can only shrink to %d rows223|There are no background screens224|There's no background screen editing a file named %s'   <   ^   ^    you are not a member of group %s chown [-fhv] [-R [-H | -L | -P]] :group file ...usage: chown [-fhv] [-R [-H | -L | -P]] owner[:group] file ...usage: chgrp [-fhv] [-R [-H | -L | -P]] group file ...HLPRfhvthe -R%c and -h options may not be specified together: %ju:%ju -> %ju:%ju: %ju -> %juusage: chroot [-g group] [-G group,group,...] [-u user] newroot [command] G:g:u:no such group `%s'too many supplementary groups providedno such user `%s'setgroupssetgidsetuid(@ (@-G"'H" """"5 7 w,5 W 7 7 76 777777 7@8 8888"8 *80868<8 B8I8@P8V8^8e8k8B r8@x8888Ȍ8l88888@8@8 888 888PDp~> 9@9e%C C@i99 E919 C9 S9e9h9Zu99Ikgh9W999j9\99 99 :k:/*:::=: M:ne:oq:: :::::::::u:"v;;x&;3;B; X;f;/v;;;ъ;;,;,;;;_[<<<*<-<"H@   !G=@" "" """   !"G""""0""" ""> I"""""TRZeS"""Y98O< AP^"F""VN"X\`b"Jd""" D"7Q;?BK"E "U"M"W[_aCLc""]":""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""2 ' "("   !-.60""("""""""""""""""""""""""""""""$""""""""""""""""""""""""#&"1"""""/"""""5"%""""""""#&"1"""""/""""""5"%""""""=<M8IK<NpIY<OIj<Qw<<JI<L<<:J<;<=FLJ=W|J#=X3=I=[J\=\o==<==E==7J=8$K=?=>AHK>BK+>a3>G>=KW>eK_>@Ls>H0L>GxL>Z>>Y>>UL>VL?KM?PHN+@94@K@^hN^@Cj@@DN@RN@'N@&O@6DO@-hO@.O@%O@*O A1,PA5PP(A#P8A/PFA2RAiA)zAA4QA00QA3TQA$AA+B-B,Q@B(QTBcB[CxBBQBBB BB R C ,RCTR-C R:CRGCRTCSeC0SnCCC"CCCCCD*DFDUDhDwDD!TSD DD DDQDtSEE1ES?ESSEScEsEETETTEEEEEFL  D. T  ر      t   H    l D 5 |  4   Բ ij ̳  Գ ܳ     D \    о  5 4  ̺     ,    E E K C 0D DE  DK F G 0F F LL M E HD H G I DB H B dA |A A I A 8O tI I H H tD D |H dH D E J K 4I TI F J ,K  K `G  "F)F@0F7F>F"F@)F@0F7F >Fa"F@)F0F7F>Fն   ¶        ʶ ն    %-15s-> %s                                                                       /.editrc%s %d E j j j j j  j j  j j j   j j j j j j j j j j E j j j E j E j j j j j j j j j j j j j j j j j j j j j j j j j j j j j j j  j j j j E j j j j E j j j E [1~[4~OAOBOCODOHOF ~ ~ ~  ~ ~ ~ ~ ~   ~ ~ ~ ~ ~   ~ ~  & )) & ' ) ) |' ) G) 4) fwdbck 4  0 &4  0 &4  0  0  0  0  0  0  0  0  0  0  0  0  0  0  0  0  0  0  0  0  0  0  0  0  0  0  0  0  0  0  0  4  0  0 4 3 tty_stty; ; ; ; ; ; ; : : ; ; ; |; r; h; ^; T; J; @; : : : : 9; 2; = = )= j= z= z= z= z= z=  > = = = ? > > = ? ~? a? D? '? echotctelltcsettcsettyignbrkbrkintignparparmrkinpckistripinlcrigncricrnlixonixanyixoffimaxbelopostonlcrocrnlonocronoeotonlretxtabscignorecstopbcreadparenbhupclclocalccts_oflowcrts_iflowmdmbuficanonechoeechokechonlnoflshtostopechoctlechoprtechokeflushopendiniextennokerninfoextproceol2erase2discardminhas automatic marginshas physical tabsNumber of linesNumber of columnskmHas meta keyTab chars destructivexnadd new blank lineblaudible bellclear to bottomclear to end of linecursor to horiz posclear screendelete a characterdelete a linestart delete modeend delete modeeiend insert modecursor from status linehome cursorinsert characterstart insert modeinsert paddingkdsends cursor downklsends cursor leftkrsends cursor rightkusends cursor upbegin boldend attributesnon destructive spaceend standoutbegin standoutcursor to status linecursor up onebegin underlineend underlinevbvisible belldelete multiple charscursor down multipleinsert multiple charscursor left multipleRIcursor right multiplecursor up multiplekhsend cursor home@7send cursor endvi-paste-nextvi-paste-prevvi-prev-big-wordvi-prev-wordVi move to the previous wordvi-next-big-wordvi-next-wordVi move to the next wordvi-change-casevi-change-metaVi change prefix commandvi-insert-at-bolvi-replace-charvi-replace-modeVi enter replace modevi-substitute-charvi-substitute-lineVi substitute entire linevi-change-to-eolVi change to end of linevi-insertVi enter insert modevi-addvi-add-at-eolvi-delete-metaVi delete prefix commandvi-end-big-wordvi-end-wordvi-undoVi undo last changevi-command-modevi-zerovi-delete-prev-charvi-list-or-eofvi-kill-line-prevvi-search-prevVi search history previousvi-search-nextVi search history nextvi-repeat-search-nextvi-repeat-search-prevvi-next-charvi-prev-charvi-to-next-charvi-to-prev-charvi-repeat-next-charvi-repeat-prev-charvi-matchVi go to matching () {} or []vi-undo-lineVi undo all changes to linevi-to-columnVi go to specified columnvi-yank-endVi yank to end of linevi-yankVi yankvi-comment-outvi-aliasVi include shell aliasvi-to-history-linevi-histeditVi edit history line with vivi-history-wordvi-redoem-delete-or-listem-delete-next-wordem-yankem-kill-lineem-kill-regionem-copy-regionem-gosmacs-transposeem-next-wordem-upper-caseem-capitol-caseem-lower-caseem-set-markSet the mark at cursorem-exchange-markExchange the cursor and markem-universal-argumentem-meta-nextem-toggle-overwriteem-copy-prev-wordCopy current word to cursorem-inc-search-nextEmacs incremental next searchem-inc-search-prevem-delete-prev-chared-end-of-fileIndicate end of fileAdd character to the lineed-delete-prev-worded-delete-next-charDelete character under cursored-kill-lineCut to the end of lineed-move-to-ended-move-to-beged-transpose-charsed-next-chared-prev-worded-prev-chared-quoted-inserted-digited-argument-digitDigit that starts argumented-unassignedIndicates unbound charactered-tty-sigintTty interrupt charactered-tty-dsuspTty delayed suspend charactered-tty-flush-outputTty flush output charactersed-tty-sigquitTty quit charactered-tty-sigtstpTty suspend charactered-tty-stop-outputed-tty-start-outputTty allow output charactersed-newlineExecute commanded-delete-prev-chared-clear-screened-redisplayRedisplay everythinged-start-overed-sequence-lead-ined-prev-historyed-next-historyMove to the next history lineed-search-prev-historyed-search-next-historyed-prev-lineMove up one lineed-next-lineMove down one lineed-commandEditline extended commandiflag:oflag:cflag:lflag:chars:*?_-.[]~=%d %s""no input "%s..." Unbound extended key "%s" %-4s to %-7s-> %s %-15s-> is undefined %-15s-> %s Out of termcap string space. settc: Bad value `%s'. baud%s: Invalid switch `%c'. Standard key bindings Alternative key bindings Multi-character bindings Arrow key bindings %s %s %s: Invalid command `%s'. %s -> %s Your terminal has the following characteristics: It has %s meta key not It can%suse tabs hasdoes not have It %s automatic margins It %s magic margins (empty) %25s (%s) == %s ^D / ? : *[]?edit: Bad value `%s'. %c%s %s: Invalid argument `%s'. %*sc-- != 0/usr/src/lib/libedit/tty.cc != -1%s: Unknown switch `%c'. ()[]{}/tmp/histedit.XXXXXXXXXXnewline ignored at right marginVi paste previous deletion to the right of the cursorVi paste previous deletion to the left of the cursorVi move to the previous space delimited wordVi move to the next space delimited wordVi change case of character under the cursor and advance one characterVi enter insert mode at the beginning of lineVi replace character under the cursor with the next character typedVi replace character under the cursor and enter insert modeVi enter insert mode after the cursorVi enter insert mode at end of lineVi move to the end of the current space delimited wordVi move to the end of the current wordVi enter command mode (use alternative key bindings)Vi move to the beginning of lineVi move to previous character (backspace)Vi list choices for completion or indicate end of file if empty lineVi cut from beginning of line to cursorVi repeat current search in the same search directionVi repeat current search in the opposite search directionVi move to the character specified nextVi move to the character specified previousVi move up to the character specified nextVi move up to the character specified previousVi repeat current character search in the same search directionVi repeat current character search in the opposite search directionVi comment out current commandVi go to specified history file line.Vi append word from previous input lineVi redo last non-motion commandDelete character under cursor or list completions if at end of lineCut from cursor to end of current wordPaste cut buffer at cursor positionCut the entire line and save in cut bufferCut area between mark and cursor and save in cut bufferCopy area between mark and cursor to cut bufferExchange the two characters before the cursorMove next to end of current wordUppercase the characters from cursor to end of current wordCapitalize the characters from cursor to end of current wordLowercase the characters from cursor to end of current wordUniversal argument (argument times 4)Add 8th bit to next character typedSwitch from insert to overwrite mode or vice versaEmacs incremental reverse searchDelete the character to the left of the cursorDelete from beginning of current word to cursorMove cursor to the end of lineMove cursor to the beginning of lineExchange the character to the left of the cursor with the one under itMove to the right one characterMove to the beginning of the current wordMove to the left one characterAdd the next character typed verbatimAdds to argument or enters a digitTty disallow output charactersClear screen leaving current line at the topErase current line and start from scratchFirst character in a bound sequenceMove to the previous history lineSearch previous in history for a line matching the currentSearch next in history for a line matching the currentkey_add: sequence-lead-in command not allowed key_add: Null extended-key not allowed. key_delete: Null extended-key not allowed. Some extended keys too long for internal print bufferechotc: Warning: Too many required arguments (%d). echotc: Warning: Missing argument. echotc: Termcap parameter `%s' not found. echotc: Warning: unknown termcap %% `%c'. echotc: Bad value `%s' for rows. echotc: Bad value `%s' for cols. echotc: Warning: Extra argument `%s'. %s: Invalid \ or ^ in instring. %s: Invalid \ or ^ in outstring. using dumb terminal settings. No entry for terminal type "%s"; Cannot read termcap database; It has %d columns and %d lines unknown errorfirst event not foundlast event not foundempty listno next eventno previous eventcurrent event is invalidcan't read history from filecan't write historyhistory size negativebad parametersrequired parameter(s) not suppliedfunction not allowed with other history-functions-set the default599WGW]WrW}WWWbWWW XW0XW_HiStOrY_V2_ 3Z Y Y Y Y Y uY eY [ [ [  Z [\ {[ \ >Y Y W KV ;V V U U  ` ` ` {` ` b ` b b ` Xa a a {` ` \b Mb ` {` ` qb ` Mb {` ` b b b Gb kb Dump of gctl request at %p: error: NULL param: "%s" (%d) [%s%s%d] = error: "%s" %d] = "%s"0] = %pDump of gctl request at NULL Could not allocate memoryNULL request pointer/dev/geom.ctlcan't allocate %u bytes: %s/dev/mem/dev/kmemexec file name too longbad flags arginvalid address (%x)short readkvm_readkvm_writekvm_write not implemented for dead kernelscannot mmap corefilekernbaseCannot read PDPTcannot read PDPTcannot read IdlePDPTcannot allocate vmcannot read IdlePTDbad namelistcannot read PTDvatop called in live kernel!_kvm_vatop_pae: lseekinvalid address (0x%lx)_kvm_vatop: lseek_kvm_vatop: pde not valid_kvm_vatop: pdpe_pa not found_kvm_vatop: pde_pa not found_kvm_vatop: read_kvm_vatop_pae: read_kvm_vatop_pae: pte not valid_kvm_kvatop: pte not valid_kvm_vatop: address not in dump_kvm_kvatop_pae: pde not valid_kvm_vatop_pae: pdpe_pa not found_kvm_vatop: bootstrap data not in dump_kvm_vatop_pae: bootstrap data not in dump_kvm_vatop_pae: pde_pa not found_kvm_vatop_pae: address not in dump%03d{ z z z z z z z z z z z z z z z z z z z z z z z z z z z z z z z z z z z z X{ z z z z z ({ z z 1{ z z z z f{ z z z z z z z z z z z{ z z z { z { z z z z z z z z z z z z z z z z z z z z z z z z z z z z z z z { z z z z { z z z z { z z z { CCCMvshdtimhmkmraei1i3kbkCktkDkLkMkEkSk0k1k;k2k3k4k5k6k7k8k9kIkAkHkNkPkFkRkTl0l3l4l5l6l7l8l9monwSFSRpkpxpfpouciPK1K3K2K4K5pOrPkBSXRXSARAXNXFeALOLF@1@2@3@4@5@6@8@9@0%1%2%3%4%5%6%7%8%9%0&1&2&3&4&5&6&7&8&9&0*1*2*3*4*5*6*7*8*9*0#1#2#3#4%a%b%e%f%g%h%i%j!1!2!3RFF1F2F3F4F5F6F7F8F9FAFBFCFEFGFHFIFJFKFMFNFPFQFUFVFWFXFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFrcbMCMLMRLfDKCWWGHUQDTOPUfhPAWAu0u2u3u4u5u6u7u8u9IcIpSfSbZAZBZCZDZFZGZHZIZJZKZLZMZNZOZPZQZRZSZTZUZVZWZXZYZaZbZcZdZeZfZgZhZiZjZkZlZmZnZoZpZqZrZsZtZuZvZwZxZyKmMiRQGmdvciXyZzYvYwYxYyYzYZS5S6S7S8XhXlXoXrXtXvsAsLbxNllhlwMWCoNCYaYbYcYdYeYfYgYhYiYjYkYlYmYnBTYoYpbwxbxshcdamimshzxonxHCNRNPhlYAYBYCYDYEYFYG*9Hfm/ \j_ n@"_E _7_H{wu_k___u/_"v /::x/; _o _oW _\____:______________<``:` ``:```:*`f9` `#`&`)`,`/`2`5` ъՊ,8`,;;`_[>`A`D`G`%HNT|_Nf9ۆJ`/M`P`S`V`Y`\`_`b`}e`h`k`n`q`t`w`z`}````````*<````````````````````````````````````aaa a aaaaaaa"a%a(a+a.a1a4a7a:a=a@aCaFaIaALaOaRaUaXa[a^aaagdagamhtjamapasaxpvaya|aaaaaaaaaaaaaaaaaaaaaa%avaaaaaaaaaaXaaaaaaaaaaabbb b b bbbbbb!b$b'b*b-b0b3b6b9bZ8cK;c>cZAca/DcGcJcMcPcsA8ScVcYc\c_cbcechckgߎNCURSES_NO_PADDINGCOLORFGBG[4%p1%dm[4%?%p1%{8}%>%t9%e%p1%d%;m[3%p1%dm[3%?%p1%{8}%>%t9%e%p1%d%;m A  ^ 3   x2d2d2dJ2d<2d,2d2d  Out of memory 3 2 2  3 2 2 2 2 2 2 2 2 2 3 :4 2 2 2 2 2 2 2 2 2 2 2 +4 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 4 2 2 2 2 2 2 2 2 2 2 4 4 2 2 2 2 2 2 2 2 2 2 4 2 2 2 4 2 2 2 2 4 4 f4 f4 f4 f4 4 4 f4 f4 4 4 f4 4 f4 4 f4 f4 f4 f4 f4 f4 f4 f4 f4 f4 f4 f4 4 4 4 f4 f4 4 f4 f4 f4 f4 f4 f4 f4 f4 f4 f4 f4 f4 f4 4 4 f4 f4 f4 f4 f4 f4 f4 [4 f4 f4 f4 f4 f4 4 f4 f4 f4 f4 [4 [4 f4 f4 4 f4 4 f4 f4 4 4 f4 [4 42 f4 f4 4 f4 f4 f4 f4 [4 f4 f4 4 4 f4 4 5 5 5 5 5 5 5 5 5 5 5 5 5 \6 6 5 5 5 5 5 5 5 5 5 5 5 6 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 6 5 5 5 5 5 5 5 5 5 5 6 6 5 5 5 5 5 5 5 5 5 5 6 5 5 5 6 5 5 5 5 6 ? v7 v7 v7 X? B= = v7 v7 i@ 7> v7 @ v7 : v7 v7 v7 v7 v7 v7 v7 v7 v7 v7 v7 v7 ? > ? v7 v7 < v7 v7 v7 v7 v7 v7 v7 v7 v7 v7 v7 v7 v7 = = v7 v7 v7 v7 v7 v7 v7 6 v7 v7 v7 v7 v7 I9 v7 v7 v7 v7 6 6 8 v7 E< v7 %< v7 v7 ): 9 v7 6 ; v7 v7 6; k8 v7 v7 v7 6 v7 v7 8 7 v7 7 NCURSES_NO_SETBUF'%s': unknown terminal type. terminals database is inaccessible TERM environment must be <= %d characters. '%s': I need something more specific. TERM environment variable not set. Not enough memory to create terminal structure. '%s': I can't handle hardcopy terminals. TERMPATH/usr/share/misc/termcap|:.termcap /usr/share/misc/termcap2Kn,X   `  %Kterminal names must start with letter or digitset_color_pair but no initialize_pairenter_underline_mode but no exit_underline_modeexit_standout_mode but no enter_standout_mode``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~display_clock but no remove_clockenter_alt_charset_mode but no exit_alt_charset_modeexit_alt_charset_mode but no enter_alt_charset_modeenter_bold_mode but no exit_attribute_modeenter_blink_mode but no exit_attribute_modeexit_alt_charset_mode but no acs_charsenter_alt_charset_mode but no acs_charsremove_clock but no display_clockenter_am_mode but no exit_am_modeexit_am_mode but no enter_am_modeenter_xon_mode but no exit_xon_modeexit_xon_mode but no enter_xon_modesave_cursor but no restore_cursorrestore_cursor but no save_cursorfrom_status_line but no to_status_lineto_status_line but no from_status_lineenter_reverse_mode but no exit_attribute_modeenter_protected_mode but no exit_attribute_modeenter_secure_mode but no exit_attribute_modeenter_insert_mode but no exit_insert_modeexit_insert_mode but no enter_insert_modeenter_dim_mode but no exit_attribute_modeenter_delete_mode but no exit_delete_modeexit_delete_mode but no enter_delete_modeexit_ca_mode but no enter_ca_modeenter_ca_mode but no exit_ca_modeexit_underline_mode but no enter_underline_modeenter_standout_mode but no exit_standout_moderesolution of use=%s failedName collision between %slabel_off but no label_onprtr_on but no prtr_offprtr_off but no prtr_onmeta_off but no meta_onmeta_on but no meta_off/usr/share/misc/terminfoTERMINFO%c/%.*sTERMINFO_DIRSWi*(j\ -m/.zA::2no8"K_<fAۆ U  kcbtkclrkrmirkICkentkhtsprimary name%s `%.*s' may be too longnumericunknown capability '%s'%s$<%d>unknown token typeno value for ko capability %sextended capability '%s'wrong type used for %s capability '%s'acsc string synthesized from XENIX capabilitieshardware tabs with a width other than 8: %dunknown capability `%.*s' in ko string%s (%s) already has an explicit value %s, ignoring koacsc string synthesized from AIX capabilitiesko translation table is invalid, I give up%s (%s termcap extension) aliased to %s%s (%s terminfo extension) ignoredEntry does not start with terminal names in column one%s (%s terminfo extension) aliased to %s%s (%s termcap extension) ignoredhardware tabs with a non-^I tab string %s%s/.terminfoVery long string found. Missing separator?Non-octal digit `%c' in \ sequenceIllegal character %s in \ sequenceCan't backspace off beginning of lineIllegal character (expected alphanumeric or %s) - %sMissing separator after `%s', have %swhitespace in name or alias fielddubious character `%c' in name or alias fieldslashes aren't allowed in names or aliasesSeparator inconsistent with syntaxIllegal ^ character - %sAllow ^? as synonym for \177Premature EOFIllegal character - %sempty longname field$[]!*?no value given for `%s'Missing separatorpremature EOFx / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / / /  / / / / / / / / / / / / /  / / / / / / / / / /  / / / / / / / / / / / / / / / / / / / / / /  /  / /   / /   / / / / /  /  / / /    @%&*!#font0s0dsIBMfont1s1dsfont2s2dsfont3s3dskbtabkselksltBOAT&TCICVXSEEXENIXGSCFCOHMLDPNPSG6G7G8GrGuGdGhGvGcGGkqIRISKATekKBKCKDKEKFBCxsbxhpxenlmsgresloknxonmc5ichtsnrrmcnpcndscrcccbcehlsxhpacrxmdaisyxvpasamcpixlpixxmcwslnlabwnumncvbufszspinvspinhmaddrmjumpmcsnpinsorcorlorhiorvicpswidcsbtnsbitwinbitypecsrcmdchcivismrcupcnormcvvisdslsmacsblinksmdcdimsmirinvisprotsmulechrmacssgr0rmdcrmulfslis1is2is3kbsktbckctabkf0kf1kf10kf2kf3kf4kf5kf6kf7kf8kf9rmkxsmkxlf0lf1lf10lf2lf3lf4lf5lf6lf7lf8lf9rmmsmmpadindnrinpfkeypflocpfxmc0mc4mc5rs1rs2rs3tsliprogka1ka3kb2kc1kc3mc5prmpacscplnsmxonrmxonsmamrmamxoncxoffcenacssmlnrmlnkbegkcankclokcmdkcpykcrtkextkfndkhlpkmrkkmsgkmovknxtkopnkprvkprtkrdokrefkrfrkrplkrstkresksavkspdkundkBEGkCANkCMDkCPYkCRTkDCkDLkENDkEOLkEXTkFNDkHLPkHOMkLFTkMSGkMOVkNXTkOPTkPRVkPRTkRDOkRPLkRITkRESkSAVkSPDkUNDrfikf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63el1mgcsmglsmgrflnsclkdclkrmclkcwinwingohupqdialpulsewaitinitcinitpscpsetfsetbcpilpichrcvrdefcswidmsdrfqsitmslmsmicmsnlqsnrmqsshmssubmssupmsumrwidmritmrlmrmicmrshmrsubmrsupmrummhpamcud1mcub1mcuf1mvpamcuu1pordermcudmcubmcufmcuuscssmgbsmgbpsmglpsmgrpsmgtsmgtpsbimscsdrbimrcsdsubcssupcsdocrzeromcsnmkmousreqmpgetmsetafsetabpfxldevtcsinsmglrsmgtbbirepbinelbicrcolornmdefbiendbisetcolorslinesdispcsmpchrmpchsmscrmscpctrmscescscesaehhlmelhlmelohlmerhlmethlmevhlmsgr1slengthOTi2OTrsOTugOTbsOTnsOTncOTdCOTdNOTnlOTbcOTMTOTNLOTdBOTdTOTknOTkoOTmaOTptOTxrOTG2OTG3OTG1OTG4OTGROTGLOTGUOTGDOTGHOTGVOTGCmemlmemubox1/5:>D:IO:TZ:_(:ej:އPo_rw@rzEr{R_rLa`r}`r}_r_Zp_H@E*<<_4 `G`D`a`͊`_[:f1`:_ć_LJˇ(aLJ·+aLJч.aLJԇ1aLJׇ4aLJڇbLJIaaLJ<|Dl̶$dL اDlе$L0س4TIJdTؤ(`تd,04@\$lPԢ|p ĩģ̪hPp̰PTXhЯ(pԫH8Dtx4th X,xܵ0p@p`Ţ<@L|tPУx\ܲh|,TD<0tXвĦx\|ذ `$<ܯ4(TP̭ hd8ءȷ< L|H 8XXԱh dld<\xЩ@hȮ0,L8`x@` \ح`ĵضȴt,p8Է(̳HLPXHԥD̡̤ԨP,0,Xp$(`4|ȫDȢdPܩtȱDH \įtD8Ԯ`,cE/c2c9&&5ce9>Z  8c K ;c >cZAca/DcGcJcMcPcsA8ScVcYc\c _c!bc"ec#hc$  Tb8ڍbb b Վ b b %bbbbccc ccccccc c#c&c)c *9Hfm/ \j_   n @ "_E _7_H{wu_k__ !_"#$u/%_&"v' (/)::*x+/,;-. /_0fo 1_23o4W5 6_7\8_9_:_;_<:=_>_?_@_A_B_C_D_E_F_G_H_I_J_K<L`M`N:O`P `Q`R:S`T`U`V:WX*Y`Z[f\#9]`^ `_#``&`a)`b,`c/`d2`efx5`g hъiՊjk,l8`mn,o;po;`q_[r>`stA`uvD`wG`x%yHzN{T||}~_Nf9ۆJ`/M`P`S`V`Y`\`_`b`%}e`h`uk`n`q`t`w`~z`}````````*<```t``a`m```d` ``v````W`````````````````````aaa a aaaaaaza"a%a(a+a..a'1a4a7aX:a(=a@aCa/FaIaALa5Oa6Ra7Ua8Xa9[a:;^a<aa=g>da?ga@mhAtBDjaEmapasaxpvaya|aaaaaaa^aaaaaaa a a a a aaaa%avaaaaaaaaaaX a!a"a#a$a%a&a'a()*a+a,-a.b/b0b1 b2 b3 4b50b6b7b8b9b:!b;$b<'b=*b>-b?0b@3bA6bB9bCZ  8c K 4 ZAca/8  %* 0!5"9#>$TCb8ڍGKb b Վ P  UY._ekqwV{ D)H./$  IB %<  Lƈ`V̈{҈_ֈ܈: !>"@#$%& '()3*+,-./0!1;%2L34j5 6)7-8-9b2:z;<A=2>?@8A<B@CEDIEMFQG=UHYI]JaKLMiNKOPQR_ST7UiAVUWQeXjYoZs[w\|]^!_`abc^defgh1ijMk\lmvnRoWpq\rs3tuvʼnwɉxy͉zщ{Չ|~|}~;5/^hىJ`/݉( $*05:?DINS6<X]bgFlqv{O6PeƊˊЊԊj؊݊ 8H #(-27<@EJOTY+^chmrw |!"#$%&()*+,-.‹/Nj0̋ы2֋3ۋ456789:<= >?@A!B&C+D05 F: G? HD II MQOVL[_dio%tz~:$/aX a!a"a#a$a%a&a'a()*+,-.E/012345Č6ʌ7ό8ӌ9ٌ:ތ;<N=>?@ABCDpEFG#H(I.J4K5:L?M/ENLOQPVQ[R`SdTiUoVuW{XYZ[X\]^|_`ab[c%defWǍg͍hӍi؍jݍk5lDmOnmZopqrstuv wxyt#z){/|5}R:~?EKQW]djpv{!%&'"# ()$Ď%Ɏ&Ύӎ؎*ݎ+ <y#I'm confused%'%{%{127}%^string too complex to convert%{96}%^string may not be optimal%Pa%ga$</>%2d%3dsaw %%r twice in %ssaw %%n twice in %ssaw %%m twice in %s%-%c%+%c%\%{2}%*%-%{10}%/%{16}%*%{10}%m%+%?%>%t%+%;%/\%03o%>%%?%%{%d}%%>%%t%%{%d}%%+%%;%%?%%{%d}%%>%%t%%'%c'%%+%%;%%?%%'%c'%%>%%t%%{%d}%%+%%;%%?%%'%c'%%>%%t%%'%c'%%+%%;%%{%d}%%+%%c%%'%c'%%+%%c%n%B%D%.doxX.%runknown %% code %s (%#x) in %s      8   l    ' V           =                                      g  Z              = 6  D                 , ^ ^ ^ ^ ^ ^ ^ ^ ^ ^           ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^   ^ ^ ^ ^  ^ ^ ^ ^ ^ ^  ^ ^  ^@^K^O^Q^S^X^[^_`~@~A~B~C~D~E~F~G~H~I~J~K~L~M~N~O~P~Q~R~S~T~U~V~W~X~Y~Z~[~\~]~^~_, = X     ( ~M /f   2 5 8  5 U ;v  >   Aߠw> Ieq3IHy6eH   #aa`8B`LhH-g03Y) okcYaUuK ^gwaL5qBDaau aaaaaa6$Z- Z)?H:: bՍFILORUX[^adgjmpsvy|   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bd(null)(cancelled)\%03lo, line %d, col %d, terminal '%s'back_tabchange_scroll_regionclear_all_tabsclear_screenclr_eoscommand_charactercursor_addresscursor_downcursor_homecursor_invisiblecursor_leftcursor_mem_addresscursor_normalcursor_rightcursor_to_llcursor_upcursor_visibledelete_characterdis_status_linedown_half_lineenter_alt_charset_modeenter_blink_modeenter_bold_modeenter_ca_modeenter_delete_modeenter_dim_modeenter_insert_modeenter_secure_modeenter_protected_modeenter_reverse_modeenter_standout_modeenter_underline_modeerase_charsexit_alt_charset_modeexit_attribute_modeexit_ca_modeexit_delete_modeexit_insert_modeexit_standout_modeexit_underline_modeflash_screenform_feedfrom_status_lineinit_1stringinit_2stringinit_3stringinit_fileinsert_characterinsert_paddingkey_backspacekey_catabkey_clearkey_ctabkey_dckey_dlkey_downkey_eickey_eolkey_eoskey_f0key_f1key_f10key_f2key_f3key_f4key_f5key_f6key_f7key_f8key_f9key_homekey_ickey_ilkey_leftkey_llkey_npagekey_ppagekey_rightkey_sfkey_srkey_stabkey_upkeypad_localkeypad_xmitlab_f0lab_f1lab_f10lab_f2lab_f3lab_f4lab_f5lab_f6lab_f7lab_f8lab_f9parm_dchparm_delete_lineparm_down_cursorparm_ichparm_indexparm_insert_lineparm_left_cursorparm_right_cursorparm_rindexparm_up_cursorpkey_keypkey_localpkey_xmitprint_screenrepeat_charreset_1stringreset_2stringreset_3stringreset_filerestore_cursorsave_cursorscroll_forwardscroll_reverseset_attributesset_tabset_windowto_status_lineunderline_charup_half_lineinit_progkey_a1key_a3key_b2key_c1key_c3prtr_nonchar_paddingacs_charsplab_normkey_btabenter_xon_modeexit_xon_modeenter_am_modeexit_am_modexon_characterxoff_characterena_acslabel_offkey_begkey_cancelkey_closekey_commandkey_copykey_createkey_endkey_enterkey_exitkey_findkey_helpkey_markkey_messagekey_movekey_nextkey_openkey_optionskey_previouskey_printkey_redokey_referencekey_refreshkey_replacekey_restartkey_resumekey_savekey_suspendkey_undokey_sbegkey_scancelkey_scommandkey_scopykey_screatekey_sdckey_sdlkey_selectkey_sendkey_seolkey_sexitkey_sfindkey_shelpkey_shomekey_sickey_sleftkey_smessagekey_smovekey_snextkey_soptionskey_spreviouskey_sprintkey_sredokey_sreplacekey_srightkey_srsumekey_ssavekey_ssuspendkey_sundoreq_for_inputkey_f11key_f12key_f13key_f14key_f15key_f16key_f17key_f18key_f19key_f20key_f21key_f22key_f23key_f24key_f25key_f26key_f27key_f28key_f29key_f30key_f31key_f32key_f33key_f34key_f35key_f36key_f37key_f38key_f39key_f40key_f41key_f42key_f43key_f44key_f45key_f46key_f47key_f48key_f49key_f50key_f51key_f52key_f53key_f54key_f55key_f56key_f57key_f58key_f59key_f60key_f61key_f62key_f63clr_bolclear_marginsset_left_marginset_right_marginlabel_formatset_clockdisplay_clockremove_clockcreate_windowgoto_windowhangupdial_phonequick_dialflash_hookfixed_pausewait_toneuser0user1user2user3user4user5user6user7user8user9orig_pairorig_colorsinitialize_colorinitialize_pairset_color_pairset_foregroundset_backgroundchange_char_pitchchange_line_pitchchange_res_horzchange_res_vertdefine_charenter_doublewide_modeenter_draft_qualityenter_italics_modeenter_leftward_modeenter_micro_modeenter_near_letter_qualityenter_normal_qualityenter_shadow_modeenter_subscript_modeenter_superscript_modeenter_upward_modeexit_doublewide_modeexit_italics_modeexit_leftward_modeexit_micro_modeexit_shadow_modeexit_subscript_modeexit_superscript_modeexit_upward_modemicro_column_addressmicro_downmicro_leftmicro_rightmicro_row_addressmicro_uporder_of_pinsparm_down_microparm_left_microparm_right_microparm_up_microselect_char_setset_bottom_marginset_bottom_margin_parmset_left_margin_parmset_right_margin_parmset_top_marginset_top_margin_parmstart_bit_imagestart_char_set_defstop_bit_imagestop_char_set_defsubscript_characterssuperscript_charactersthese_cause_crzero_motionchar_set_nameskey_mousemouse_inforeq_mouse_posget_mouseset_a_foregroundset_a_backgroundpkey_plabdevice_typecode_set_initset0_des_seqset1_des_seqset2_des_seqset3_des_seqset_lr_marginset_tb_marginbit_image_repeatbit_image_newlinebit_image_carriage_returncolor_namesdefine_bit_image_regionend_bit_image_regionset_color_bandset_page_lengthdisplay_pc_charenter_pc_charset_modeexit_pc_charset_modeenter_scancode_modeexit_scancode_modepc_term_optionsscancode_escapealt_scancode_escenter_horizontal_hl_modeenter_left_hl_modeenter_low_hl_modeenter_right_hl_modeenter_top_hl_modeenter_vertical_hl_modeset_a_attributesset_pglen_inchtermcap_init2termcap_resetlinefeed_if_not_lfbackspace_if_not_bsother_non_function_keysarrow_key_mapacs_ulcorneracs_llcorneracs_urcorneracs_lrcorneracs_lteeacs_rteeacs_bteeacs_tteeacs_hlineacs_vlineacs_plusmemory_lockmemory_unlockbox_chars_1init_tabslines_of_memorymagic_cookie_glitchpadding_baud_ratevirtual_terminalwidth_status_linenum_labelslabel_heightlabel_widthmax_attributesmaximum_windowsmax_colorsmax_pairsno_color_videobuffer_capacitydot_vert_spacingdot_horz_spacingmax_micro_addressmax_micro_jumpmicro_col_sizemicro_line_sizenumber_of_pinsoutput_res_charoutput_res_lineoutput_res_horz_inchoutput_res_vert_inchprint_ratewide_char_sizebuttonsbit_image_entwiningbit_image_typemagic_cookie_glitch_ulcarriage_return_delaynew_line_delaybackspace_delayhorizontal_tab_delaynumber_of_function_keysauto_left_marginno_esc_ctlcceol_standout_glitcheat_newline_glitcherase_overstrikegeneric_typehard_copyhas_status_lineinsert_null_glitchmemory_abovememory_belowmove_insert_modemove_standout_modeover_strikestatus_line_esc_okdest_tabs_magic_smsotilde_glitchtransparent_underlineneeds_xon_xoffprtr_silenthard_cursornon_rev_rmcupno_pad_charnon_dest_scroll_regioncan_changeback_color_erasehue_lightness_saturationcol_addr_glitchcr_cancels_micro_modehas_print_wheelrow_addr_glitchsemi_auto_right_margincpi_changes_reslpi_changes_resbackspaces_with_bscrt_no_scrollingno_correctly_working_crgnu_has_meta_keylinefeed_is_newlinehas_hardware_tabsreturn_does_clr_eol9V ,8IUhv:1@Rdy -ANXivp "*18?FMT[bkry %zzD,5FW`k|zz &5AP_nv$ )7DRaqzis{ &09GS_kv !)3@JTaoz&.6>FNV^fnv~&.6>FNV^fnv~:)5?EKQW]ciou{#/EYl%7JZk&7EUg~%<KWfp{ ):Lfr  0@Qj}/GUbo|)H./$B%<Lƈ`V̈{҈_ֈ܈:>@ 3!%j )--2zA28<@EIMQUY]aiK_AUejosw|1M\vRW\ʼnɉ͉щՉ|;5/^hىJ`/݉( $*05:?DINS<X]bglqv{O6ƊˊЊԊj؊݊8 #(-27<@EJOTY^chmrw|‹Nj̋ы֋ۋ !&+05:?DIMQV[_diotz~:$/aXaaaaaaaaČʌόӌٌތ#(.4:?ELQV[`diou{%Ǎ͍Ӎ؍ݍ5DOZ #)/5:?EKQW]djpv{Ύӎ #]9 0AS^kw ,;K[p+TCb8ڍGKbbՎPUY_ekqwV{ĎɎC@T`u0ERnhw+;Rbr,cE݇&&5ce9>Z8cK4ZAca/8  %*059>؎ݎ/var/log/wtmpinvalid hostnamehumanize_numberBkMGTPEBKMGTPEKMGTPEkMGTPE%lld%s%s%s%d%s%d%s%s%sscale >= 0suffix != NULLbuf != NULL/usr/src/lib/libutil/humanize_number.c\\#0123456789%s: illegal option -- %c %s: option requires an argument -- %c %Y-%m-%d%m/%d/%y%H:%M%H:%M:%S M M M M M M M M M M M M M M M M M M M M M M M M M M M M M M M M M M M M  M M M M M  M M M M M M M M M M M M M M M M M M M M M       M _ _ M M M  M  M M "  *"  M  y  5 M M M M M M   _   M M  M 3 _ _ s M M  M  Y M M M    REG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEtrailing backslash (\)REG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTREG_EMPTYempty (sub)expressionREG_ASSERTREG_INVARGREG_ILLSEQillegal byte sequenceREG_0x%xrepetition-operator operand invalid"can't happen" -- you found a buginvalid argument to regex routine*** unknown regexp error code ***/etc/mac.confMAC_CONFFILEdefault_labelsdefault_ifnet_labelsdefault_file_labelsifnetdefault_process_labelspacket.=security.mac.security.mac@3 T3 T3 @3 T3 @3 @3 @3 T3 @3 @3 @3 @3 @3 @3 @3 T3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 @3 T3 connect to address %s: RSHrcmd: socket: %s rcmd: too many files rcmd: getaddrinfo: %s rcmd: %s: %s rcmd: accept: %s .rhosts fstat failed/etc/hosts.equiv.rhosts lstat failed.rhosts not regular filebad .rhosts ownerrcmd: socket: All ports in use rcmd: write (setting up stderr): %s rcmd: select (setting up stderr): %s socket: protocol failure in circuit setup. select: protocol failure in circuit setup .rhosts writeable by other than ownerPOSIXUS-ASCIIL L L L L ~L nL `L `L `L `L `L `L `L RL RL RL RL RL RL RL DL DL DL DL DL DL DL DL DL DL DL DL 3L 3L 3L 3L 3L 3L 3L 3L 3L 3L 3L 3L  L  L  L  L  L L cM WM GM 7M 'M K M 0%XQ HP HP HP HP HP HP Q tQ gQ ZQ MQ @Q 3Q HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP HP &Q T #T T S S S S R XU U U U U U U U U U U U U U U U U U U U U U U U U U XU U U U U U U U U U U U hU hU hU hU hU hU hU hU U U U U U U U U U U U U U U U U U U U U U zU U U U U U U U U U U U U U U U U T U U U U U U U U U U U U U U U U U U U U U U U U __libc_allocate_tlstcbsize >= 2*sizeof(Elf_Addr)/usr/src/lib/libc/gen/tls.cnosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenosunlnknosunlinknosnapshotnouappndnouappendnouchgnouchangenouimmutablenodumpnoopaquenouunlnknouunlink ,  T)Y0lG^<3zCPD'7*  %rD      # ( / 4 v: ? Signal 0abrtemtfpebussegvsysurgcontchldttinttouioxcpuxfszvtalrmprofwinchusr1usr2c a a a a a a a a a a a a a a \b a a a a a a a \b a a c hc @c \b a Pb Db BLOCKSIZE%ld%s-blocksminimum blocksize is 512%s: unknown blocksizemaximum blocksize is %ldG/boot/kernel/kernelnfs4/etc/fstabfstab: PATH_FSTAB/etc/disktabremovabledtsusimulated#NODEV#%c:%d:0x%xkern.devname_COMPAT_FreeBSD_4/etc/compat-FreeBSD-4-util%04d%4d%e-%b-%Ystrftime format "%s" all localesthe current localeNULL strftime format some locales M M M M M M M M M M M M M M M M M M M M M M M M M M M M M M M M M M M M M M M M M M  M + M M B M M M M M M M M M M M M M M M M Y       7 Z M M M  M  M M      @  j " M M M M S M  W    M  W M v     M  M      # A   CHECK_STRFTIME_FORMATS_FOR_TWO_DIGIT_YEARSyields only two digits of years in shut up gccNULSOHSTXETXEOTENQBELalertBSHTVTvertical-tabform-feedcarriage-returnSODC1DC2DC3DC4NAKSYNETBEMSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfivesixsevenninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELUTF-8;;;;;;;;;;L<<;;;;;;=(=F?===>=>>==>================>===========================>v>=I>=============================;>4U VU4UU4U4U4UU4U4U4U4U4U4U4UU4U4U4U4U4U4U4U4U4U4U4U4U4U4U4UDUrcmdsh: dup2 failed/usr/bin/rshrcmdsh: setuid(%u): %s rcmdsh: socketpairrcmdsh: getaddrinfo: %s rcmdsh: fork failedrcmdsh: unknown user: %s rcmdsh: execlp %s failed: %s rcmdsh: fork to lose parent failedInvalid value for ai_flagsai_family not supportedMemory allocation failureai_socktype not supportedInvalid value for hintsResolved protocol is unknownUnknown errorAddress family for hostname not supportedTemporary failure in name resolutionNon-recoverable failure in name resolutionNo address associated with hostnamehostname nor servname provided, or not knownservname not supported for ai_socktypeSystem error returned in errnoalnumcntrlpunctupperxdigitideogramphonogramrune+,hC ;, ;@ ,,,O#, -,LC_ALLLC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_TIMEPATH_LOCALE/usr/share/locale^_|_u_n_g_&_^[yY]^[nN]0-6->l6ll.l&llllllllllllllllllllllllllll>l6ll.l&lllllllllllllll%s.dbexecvP: : path too long /usr/bin:/bin}}f{}}}}6|L}}}}6|}}}}}}}f{}}}}}6|}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}f{f{JanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturday%a %b %e %H:%M:%S %YPM%a %b %e %H:%M:%S %Z %Y%I:%M:%S %pH/L/P/T/X/\/`/d/h/l/p/t/x////X///////////////////0000z4070x////X////////uO0NONEEUCGB18030GB2312GBKBIG5MSKanjiRuneMag1 error: warning: freelist is destroyed modified (chunk-) pointer pointer to wrong page chunk is already free modified (page-) pointer page is already free /etc/malloc.confMALLOC_OPTIONSrecursive call mmap(2) failed, check limits in malloc(): in free(): in realloc():junk pointer, too high to make sense junk pointer, too low to make sense unknown char in MALLOC_OPTIONS malloc() has never been called j ^  f      V F       6  &              ְ ư           vInternal ypbind errorDomain not boundUnknown ypbind error: #%d /var/yp/binding%s/%s.%dclntudp_createclnttcp_createfcntl: F_SETFDyp_match: clnt_callyp_first: clnt_callyp_next: clnt_callyp_all: clnt_callclnttcp_create failedyp_order: clnt_callyp_master: clnt_callyp_maplist: clnt_callYP unknown error %d Database is busyAccess violationServer data base is badLocal domain name not setCan't communicate with ypservCan't communicate with ypbindYP server errorNo such key in mapRPC failureRequest arguments badSystem resource allocation failureYP: server for domain %s not responding, retrying YP server version mismatch - server can't supply service.Can't communicate with portmapperNo more records in map databaseLocal resource allocation failureNo such map in server's domainCan't bind to server which serves this domainzsle^WPIB;4RPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Unknown protocolAuthentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)RPC: (unknown error code); s1 = %u, s2 = %u; why = ; errno = %srpch != NULL - RPC: Incompatible versions of RPCRPC: Server can't decode argumentsRPC: Failed (unspecified error); low version = %u, high version = %u/usr/src/lib/libc/rpc/clnt_perror.c(unknown authentication error - %d)777 8858@:D8^8w88d:8888:9&989R9m99999clnt_sperrorHHclnt_perrorclnt_spcreateerrorclnt_pcreateerrorCould not get %s transportloopbacksvc%s_create: could not open connectionout of memoryunsupported transport sizecan't get protocol infocan't find appropriate transport%s: %srpc_reg: %s couldn't register prog %u vers %u for %s%s can't reassign procedure number %u%s cant find suitable transport for %srpc: rpc_reg: never registered prog %u vers %urpc: rpc_reg trouble replying to prog %u vers %unetpathsvc_sendreply failedsvc_tli_create: bad service typesvc_tli_create: could not get transport informationsvc_tli_create: could not bind to requested addresssvc_tli_create: could not bind to anonymous portsvc_tli_create: could not open connection for %ssvc_tli_create: invalid netconfigsvc_tp_create: Could not register prog %u vers %u on %ssvc_tp_create: invalid netconfig structure for prog %u vers %usvc_create: could not register prog %u vers %u on %ssvc_create: no memorysvc_create: unknown protocolcould not allocate cache cache already enabledsvc_enablecache: %s %sout of memory transport does not support data transfercould not get transport informationsvc_dg_create: %scould not allocate new rpc buffervictim alloc failedvictim not foundcache_set: %sfifo<pmap_getportaddress != NULL/usr/src/lib/libc/rpc/pmap_getport.cclntraw_create - Fatal header serialization error./usr/src/lib/libc/rpc/clnt_raw.cclnt_raw_callsunrpcff02::202datagram_nclnt_bcast: cannot sendbroadcast packetclnt_bcast: Cannot send broadcast packetclnt_bcast: Cannot receive reply to broadcastsvc_vc_destroyread_vcwrite_vcsvc_vc_statsvc_vc_recvsvc_vc_getargssvc_vc_freeargssvc_vc_replymakefd_xprtsvc_fd_createrendezvous_requestxprt != NULLfd != -1svc_vc_create: out of memory/usr/src/lib/libc/rpc/svc_vc.csvc_vc: makefd_xprt: out of memorysvc_tcp: makefd_xprt: out of memorysvc_fd_create: no mem for local addrsvc_fd_create: could not retrieve remote addrsvc_fd_create: could not retrieve local addrsvc_vc_create: could not retrieve local addrsvc_vc_create: no mem for local addrxprt_register__xprt_do_unregistersvc_findsvc_registersvc_sendreplysvcerr_noprocsvcerr_decodesvcerr_systemerrsvcerr_authsvcerr_weakauthsvcerr_noprogsvcerr_progverssvc_getreqset/usr/src/lib/libc/rpc/svc.cprev != NULLdispatch != NULLreadfds != NULLxdr_callmsgxdrs != NULLcmsg != NULL/usr/src/lib/libc/rpc/rpc_callmsg.cpmap_rmtcallxdr_rmtcall_argsxdr_rmtcallresport_ptr != NULLaddr != NULLcap != NULLcrp != NULL/usr/src/lib/libc/rpc/pmap_rmt.cxdr_pmapregs != NULL/usr/src/lib/libc/rpc/pmap_prot.c0.0.0.0.%d.%dxdr_reference: out of memorywindow verifier mismatchtimestamp before last seensvcauth_des: %s decryptsessionkeybad nicknamegetpublickeyreplayed credentialtimestamp expiredinvalid usecsdecryption failureencryption failureinvalid nicknameunknown netnamemissed ucred cache/etc/publickey # publickey.bynameBad record in %s -- %sBad record in %s val problem - %s_svcauth_unixrqst != NULL/usr/src/lib/libc/rpc/svc_auth_unix.cbad auth_len gid %ld str %ld auth %u authunix_marshalmarshal_new_authauthunix_validateauthunix_refreshauthunix_destroyauth != NULLverf != NULL/usr/src/lib/libc/rpc/auth_unix.cauth_none.c - Fatal marshalling problemauthunix_create: out of memoryunixnetid.byname/etc/netid ,getnetconfig: %scould not close() fd %d; mem & fd leakinetclnt_dg_create: out of memoryԉ~̈ +nĉxdr_authunix_parms/usr/src/lib/libc/rpc/authunix_prot.cdnsnissetpwentendpwentgetpwuid_rgetpwnam_rgetpwent_r/etc/spwd.db/etc/pwd.dbVERSIONpasswd_compatmaster.passwd.by%s##passwd.adjunct.bynamepasswd-%ldKXJJKXJJKXJJKЗJJ@KЗJJ@KЗJJ@KJJ@JJJJUnsupported password database version %dgetpwent memory allocation failure, /etc/netgroupnetgroup.byhost*.**.%s%s.%s%s.*netgroup.byusersetgrentendgrentgetgrent_rgetgrnam_rgetgrgid_r/etc/groupgroup_compatgroup.bynamegroup.bygidgroup-%ldKtJJ\KtJJ\KtJJ\KJJXKJJXKJJXKJJJ\JJXJgetgrent memory allocation failureout of memoryclnt_vc_create%s : %sclnt_vc_createclnt_vc_callclnt_vc_geterrclnt_vc_freeresclnt_vc_controly"5yy~yyyclnt_vc_destroyvc_cv != (cond_t *) NULLvc_cv == (cond_t *) NULLcl != NULLerrp != NULL/usr/src/lib/libc/rpc/clnt_vc.cauthnone_marshal/usr/src/lib/libc/rpc/auth_none.croot uid should be 0no uid for user %scorrupted entry%s uid is incorrect%s gid is incorrectPW_SCAN_BIG_IDS%s > max uid value (%lu)no gid for user %s%s > max gid value (%lu)warning, unknown root shell%s > recommended max uid value (%u)%s > recommended max gid value (%u)/bin/csh/etc/shellsshells-XXXXXshells-%dinitshellsW(SJ J 4 lDxdrrec_create: out of memory( X $ d       $ d    udp6tcp6circuit_vdatagram_vcircuit_ninet6%s.%u.%u85TT=TTT(B584>>>)rpc: failed to open /etc/netconfigDxdr_opaque_authxdr_des_blockxdr_accepted_replyxdr_rejected_replyxdr_replymsgxdr_callhdr_seterr_replyacceptedrejected!!!!!!blkp != NULLar != NULLrr != NULLrmsg != NULLerror != NULL/usr/src/lib/libc/rpc/rpc_prot.cNFINITY$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$f$$$$$)$$$$$))))))))))$$$$$$$N'$n'$N'N'N'$$$$($$$$$$%$$$$%$$'$$$$$N'$u'X'N'N'N'/''a&$%$,&&%%$%%%$$%$$j)0-j,3+c433z767%6655-5--,5555555588-------888888-----------------;8--------888888-----------------;8/etc/hesiod.conflhsrhsHESIOD_CONFIGHES_DOMAINclassesrhs-extensionstringlist: %mSSSSSSSؗҜ<3#I9=D2[%Cod(/ThThThThThThThThTUUUUUhThThThThThThThThThThThThThThThThThTUhThThThThThThThThThT#ThTTAA5?55?5?@?xdr_array: out of memoryxdr_bytes: out of memoryxdr_string: out of memory1.0 1.2 __collate_strdup__collate_substitute.oKW`o.,, ,NETPATHNetconfig database not foundNot enough memoryNot initialized/etc/netconfigtpi_cots_ordtpi_cotstpi_cltstpi_rawin /etc/netconfig. or run mergemaster(8). Continuing in 10 seconds Netconfig database has invalid formatNetid not found in netconfig databaseUnknown network selection errorThe local transport is called "unix" Please change this to "local" manually See UPDATING entry 20021216 for details. This warning will be removed 20030301 p\\\,]T]PP^PPPPPPePPlPPPPPPPPPsPPPPPPPPPPPPPPPPPPPWres_send: %s ([%s].%s): %s res_send: %s: %s ;; res_send() ;; old answer (unexpected): ;; old answer: s out-of-bounds;; wrong query name: sendto;; not our server: keventread failedrecvfrom;; response truncated ;; timeout ;; undersized: %d ;; truncated answer server rejected query: read(vc);; got answer: socket(dg)write failedsocket(vc)connect/vckqueueconnect(dg);; Querying server (# %d) address = %s ghbynameghbyaddr/etc/hostsip6.arpaJJJ<JJ8# 0123456789abcdef;; res_query(%s, %d, %d) ;; rcode = %d, ancount=%d ;; res_query: mkquery failed;; res_query: send errorHOSTALIASES;; res_querydomain(%s, %s, %d, %d) ;; res_mkquery(%d, %s, %d, %d) /&ndots:timeout:attempts:insecure1insecure2no_tld_queryedns0;; ndots=%d ;; timeout=%d ;; retry=%d ;; debug/etc/resolv.confdomainnameserversortlistRES_OPTIONSenvLOCALDOMAIN;; res_setoptions("%s", "%s")... ;; res_setoptions("%s", "%s").. GAIgetaddrinfoipnodes.bynamehosts.byname;; rcode = %u, ancount=%u ;; res_querydomain(%s, %s) 858585Le>HEADER<<- opcode: %s, status: %s, id: %d ; error: unknown LOC RR version%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %smggafÊmfffffffffff af Q?' gj hg g gz1gEgHgWg[g`gsgyggggg͊ggggg~ggggg?@ACDEFGHJKMOQSS   9876543210/.-,+*)('&%$#"! :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::;<;53210/-,+*)('&%$#"!  ::::::::::::::::::::::::    DEAE216+-.99+&%/ /E!()*!!# E^nlll`pSpFp9p,pppgoWo6ownmnbad buffer in yy_scan_bytes()input in flex scanner failedout of dynamic memory in yy_scan_buffer()out of dynamic memory in yy_scan_bytes()out of dynamic memory in yy_create_buffer()fatal flex scanner internal error--no action foundinput buffer overflow, can't enlarge buffer because scanner uses REJECTfatal flex scanner internal error--end of buffer missedNSSWITCH(nslexer): memory allocation failureNSSWITCH(nslexer): %s line %d: %s at '%s'gethostbynamegethostbyaddrJJJJ0Jgethostby*.gethostanswer: asked for "%s", got "%s"gethostby*.gethostanswer: asked for "%s %s %s", got type "%s"Impossible condition (type=%d) static buffer is too small (%d) Too many addresses (%d) size (%d) too big res_search failed (%d) %x.%x.%u.%u.%u.%u.in-addr.arpares_query failed (%d) h̕HASH: Out of overflow pages. Increase page size AZ$FreeBSD: src/lib/csu/i386-elf/crtn.S,v 1.6 2005/05/19 07:31:06 dfr Exp $lxp=|l\d ,H#t12 <4X4X4dh8k}4`X+H R1D@h " ( /<hhP.| /tmp/EdDk.XXXXXXXXXX$+0:DMTcjp8w|BhHhHhHhH8hHunknown _msgbufp$j j!j"j#j&Aa q @PQRVacde3uG@L@     @    @         q{      @  @    @   ^q{      @  @    ahmxrq{      @  @      ##.GqggccYK^^^^V^^ߠII?WIIh}^HIb`H/:HI49HIKggHI4^HHI_% HIrbjH?O^GIgG^]OGI_H GIbbFINF?PFdS^OGI_wFI:K _FIGeLHHI__@FIq_F$EEI5REIB{vEI MJOsE[B_@EIfN#_EIKhD(_DI^gHI4-_fD$GP@D?&n1_D$;m7_CIZ FdS<_CIQiUCmQCZUsOeCB@C?X[VCZUu_C?dSC_B?qBIv5H_`B?lV@D?&nN3BU<GOBBP_3BU<V_A?lUVFdSAISc\_@AIbEIB2_@D?&nc_AIMdk_@?dSp_@?dSt_`@?dSz_ @IN?IL^?IMd?u`Nj?/:8_@?IdZPDHHI__ ?I]+>IgU]>IKo_sE[BHO`>B_ >I~rf>oRw=Ic=I%h_=IM_`=?\_$=?l_=Ieoj?/:_<IL < &p_@<IJ]v<?nkN]>IKo<IkF_;I5_;I|e;IiK};I.5_>Ig_g;I`KGqP;I2_1;I}^_!; qU;M:IX:IL\]>IKohHD0mXyay^hy <_}\aY{+[ЁIYׁ1Yoz[45[hWhH\WЁsZ܋˂т܋h6WhH\6Whb9hTTdeprecated command -- use 'toggle crmod' insteaddeprecated command -- use 'set escape' insteadVWRR\Qc\QcPDPD^o f^ "M_-Orp\ @K{Wb;UߠU;XhHb`Dcompute response to OPIE challengeprint help informationchange environment variables ('environ ?' for more)invoke a subshellsuspend telnetchange state of special charaters ('slc ?' for more)toggle operating parameters ('toggle ?' for more)print status informationunset operating parameters ('unset ?' for more)set operating parameters ('set ?' for more)transmit special characters ('send ?' for more)exit telnetconnect to a sitetry to enter line or character mode ('mode ?' for more)display operating parametersforcibly logout remote user and close the connectionclose current connection",aӃg@IeL8JnxJ[I`I>bx#Ic2[\ކhHKhKl9<ls@$xPDLy~>pppsu~C*ziOvq{te|%}ωՉqՉq37Oau/g93G  ؊#2?C[~>yƋhhHދFhFHHHHJ-QBPYȌQnjQ͌ӌQwQQ Q@*Q?QIQrSQqQzQhQPhH\Q""D""(standard output) }|$2ʉ¡ǡ͡ӡ١ޡjf׋ #(/6=DKRYfmxˢ֢ $0?GS[cl|sw$}/etc/gettytab\^:   }) 0/dev/ptyXXK? : \]^7ba_`c8V9Mdefg:U;J<H=>LhW?O@NiAB CD  !"#$%E &'()*+,-./F 0123456789G :;<=>?@ABCH D E F GIJKjkLMKNIOP[lmcnoQRpqRSrZstuvwxSyz{|}~TPUQVTW|  z%%p%c%%{10}%%/%%{16}%%*%%p%c%%{10}%%m%%+ (5OZr~  (2 NY qF | 0T +2<IR\ gpz|p t  zw)&?7&@E&[Y&\c&\s&]&^&^&_&_&`&{&{&|&}&}'~'7* +3*4+N*f*`+++*+**CCCCCCC,,,,,,ԡ *   III\T  kh545@ÿ? d'@Bʚ;hHhohhop ppp#p+p4p?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ }pP<(`P<( pP<(0 0 0 0 0 0 0 0 0 0 8 8 0 0 0 0 L L 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 @ @ 0 0 0 0 l8I<_hashXXXXXX.shstrtab.init.text.fini.rodata.data.eh_frame.ctors.dtors.jcr.bss ttI$$J @@JB % U +u5u<  uCuH  u  uM ...! . .." fixit_crunch!]" cat"chmoda" cp" dd" df"echo|a"expr*/"kill|a" ln" ls"mkdira" mv" rm"rmdira"sleepa"sync|a"bsdlabel*/"clri|a"dmesga"fdiska"mknoda"mounta" mount_cd9660&" mount_msdosfs&"reboot"restore"swapon"umount" disklabel/"rrestore*/" ftp"telnet" vi"view|a" ex"chowna"chroot"chgrpa# . ..$group/%spwd.db& protocols/'services)/# $FreeBSD: src/etc/group,v 1.32.2.1 2006/03/06 22:23:10 rwatson Exp $ # wheel:*:0:root daemon:*:1: kmem:*:2: sys:*:3: tty:*:4: operator:*:5:root mail:*:6: bin:*:7: news:*:8: man:*:9: games:*:13: staff:*:20: sshd:*:22: smmsp:*:25: mailnull:*:26: guest:*:31: bind:*:53: proxy:*:62: authpf:*:63: _pflogd:*:64: _dhcp:*:65: uucp:*:66: dialer:*:68: network:*:69: audit:*:77: www:*:80: nogroup:*:65533: nobody:*:65534: ( . ..)misc'() .( ..* scsi_modes    ( 0 8 X`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx ip 0 IP icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ipencap 4 IP-ENCAP st2 5 ST2 tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc 10 BBN-RCC-MON nvp 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP sep 33 SEP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPV6 sdrp 42 SDRP ipv6-route 43 IPV6-ROUTE ipv6-frag 44 IPV6-FRAG idrp 45 IDRP rsvp 46 RSVP gre 47 GRE mhrp 48 MHRP bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPV6-ICMP icmp6 ipv6-nonxt 59 IPV6-NONXT ipv6-opts 60 IPV6-OPTS cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospf 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP carp 112 CARP vrrp pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP st 118 ST srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC pfsync 240 PFSYNC divert 258 DIVERT 08@]D@ <   ]Dd7@  [> [>]D@ @@@<@TU ]D  S,0]DA]D]D]D ]EA]D]D]D RQ<m'Pw]D]D]Dh p x H UMA]D]D]D bAj]D]D]D ]D]D]D   ( 0 8 @ H P P ]D]D]D M^g]D]D]D 01A]D]D]D jsA]D]D]D '8]D]D]DX ` Nl%# # Network services, Internet style # # Stripped-down version. # # $FreeBSD: src/release/fixit.services,v 1.4 1999/08/28 01:33:10 peter Exp $ # # WELL KNOWN PORT NUMBERS # echo 7/tcp echo 7/udp discard 9/tcp sink null discard 9/udp sink null systat 11/tcp users #Active Users systat 11/udp users #Active Users daytime 13/tcp daytime 13/udp chargen 19/tcp ttytst source #Character Generator chargen 19/udp ttytst source #Character Generator ftp-data 20/tcp #File Transfer [Default Data] ftp-data 20/udp #File Transfer [Default Data] ftp 21/tcp #File Transfer [Control] ftp 21/udp #File Transfer [Control] ssh 22/tcp #Secure Shell Login ssh 22/udp #Secure Shell Login telnet 23/tcp telnet 23/udp # 24/tcp any private mail system # 24/udp any private mail system smtp 25/tcp mail #Simple Mail Transfer smtp 25/udp mail #Simple Mail Transfer time 37/tcp timserver time 37/udp timserver domain 53/tcp #Domain Name Server domain 53/udp #Domain Name Server bootps 67/tcp dhcps #Bootstrap Protocol Server bootps 67/udp dhcps #Bootstrap Protocol Server bootpc 68/tcp dhcpc #Bootstrap Protocol Client bootpc 68/udp dhcpc #Bootstrap Protocol Client tftp 69/tcp #Trivial File Transfer tftp 69/udp #Trivial File Transfer gopher 70/tcp gopher 70/udp finger 79/tcp finger 79/udp http 80/tcp www www-http #World Wide Web HTTP http 80/udp www www-http #World Wide Web HTTP sunrpc 111/tcp rpcbind #SUN Remote Procedure Call sunrpc 111/udp rpcbind #SUN Remote Procedure Call auth 113/tcp ident tap #Authentication Service auth 113/udp ident tap #Authentication Service nntp 119/tcp usenet #Network News Transfer Protocol nntp 119/udp usenet #Network News Transfer Protocol rmt 411/tcp #Remote MT Protocol rmt 411/udp #Remote MT Protocol https 443/tcp https 443/udp # # Berkeley-specific services # exec 512/tcp #remote process execution; # authentication performed using # passwords and UNIX loppgin names biff 512/udp comsat #used by mail system to notify users # of new mail received; currently # receives messages only from # processes on the same machine login 513/tcp #remote login a la telnet; # automatic authentication performed # based on priviledged port numbers # and distributed data bases which # identify "authentication domains" who 513/udp whod #maintains data bases showing who's # logged in to machines on a local # net and the load average of the # machine cmd 514/tcp shell #like exec, but automatic # authentication is performed as for # login server syslog 514/udp printer 515/tcp spooler printer 515/udp spooler talk 517/tcp #like tenex link, but across # machine - unfortunately, doesn't # use link protocol (this is actually # just a rendezvous port from which a # tcp connection is established) talk 517/udp #like tenex link, but across # machine - unfortunately, doesn't # use link protocol (this is actually # just a rendezvous port from which a # tcp connection is established) ntalk 518/tcp ntalk 518/udp utime 519/tcp unixtime utime 519/udp unixtime efs 520/tcp #extended file name server router 520/udp route routed #local routing process (on site); # uses variant of Xerox NS routing # information protocol uucp 540/tcp uucpd uucp 540/udp uucpd uucp-rlogin 541/tcp uucp-rlogin 541/udp klogin 543/tcp # Kerberos (v4/v5) klogin 543/udp # Kerberos (v4/v5) kshell 544/tcp krcmd # Kerberos (v4/v5) kshell 544/udp krcmd # Kerberos (v4/v5) a  }n}{>9xs61 T O v nobody*Unprivileged user/nonexistent/usr/sbin/nologin3nobody*Unprivileged user/nonexistent/usr/sbin/nologinCpop*DPost Office Owner/nonexistent/usr/sbin/nologin1poppop*DPost Office Owner/nonexistent/usr/sbin/nologinApopbind*55Bind Sandbox//usr/sbin/nologin35bind*55Bind Sandbox//usr/sbin/nologin2bind*55Bind Sandbox//usr/sbin/nologinC5bind*55Bind Sandbox//usr/sbin/nologinBkmem*KMem Sandbox//usr/sbin/nologin3kmem*KMem Sandbox//usr/sbin/nologinCtty*Tty Sandbox//usr/sbin/nologin2tty*Tty Sandbox//usr/sbin/nologinB|w*%rl  V Q r proxy*>>Packet Filter pseudo-user/nonexistent/usr/sbin/nologin3>proxy*>>Packet Filter pseudo-user/nonexistent/usr/sbin/nologin2proxy*>>Packet Filter pseudo-user/nonexistent/usr/sbin/nologinC>proxy*>>Packet Filter pseudo-user/nonexistent/usr/sbin/nologinBsmmsp*Sendmail Submission User/var/spool/clientmqueue/usr/sbin/nologin1smmspsmmsp*Sendmail Submission User/var/spool/clientmqueue/usr/sbin/nologinAsmmspsshd*Secure Shell Daemon/var/empty/usr/sbin/nologin3sshd*Secure Shell Daemon/var/empty/usr/sbin/nologinCkmem*KMem Sandbox//usr/sbin/nologin2kmem*KMem Sandbox//usr/sbin/nologinB`\!@; I D _pflogd*@@pflogd privsep user/var/empty/usr/sbin/nologin2_pflogd*@@pflogd privsep user/var/empty/usr/sbin/nologinBgames* Games pseudo-user/usr/games/usr/sbin/nologin3games* Games pseudo-user/usr/games/usr/sbin/nologin2games* Games pseudo-user/usr/games/usr/sbin/nologinCgames* Games pseudo-user/usr/games/usr/sbin/nologinBtty*Tty Sandbox//usr/sbin/nologin1ttytty*Tty Sandbox//usr/sbin/nologinAttybin*Binaries Commands and Source//usr/sbin/nologin1binbin*Binaries Commands and Source//usr/sbin/nologinAbin(UPTO  6 1 , ' } 5 0 @ @ www*PPWorld Wide Web Owner/nonexistent/usr/sbin/nologin3Pwww*PPWorld Wide Web Owner/nonexistent/usr/sbin/nologinCP_dhcp*AAdhcp programs/var/empty/usr/sbin/nologin2_dhcp*AAdhcp programs/var/empty/usr/sbin/nologinB_pflogd*@@pflogd privsep user/var/empty/usr/sbin/nologin3@_pflogd*@@pflogd privsep user/var/empty/usr/sbin/nologinC@proxy*>>Packet Filter pseudo-user/nonexistent/usr/sbin/nologin1proxyproxy*>>Packet Filter pseudo-user/nonexistent/usr/sbin/nologinAproxysshd*Secure Shell Daemon/var/empty/usr/sbin/nologin1sshdsshd*Secure Shell Daemon/var/empty/usr/sbin/nologinAsshdnews*News Subsystem//usr/sbin/nologin3news*News Subsystem//usr/sbin/nologin2 news*News Subsystem//usr/sbin/nologinCnews*News Subsystem//usr/sbin/nologinB kmem*KMem Sandbox//usr/sbin/nologin1kmemkmem*KMem Sandbox//usr/sbin/nologinAkmemrootCharlie &/root/bin/csh3rootCharlie &/root/bin/csh2rootCharlie &/root/bin/cshCrootCharlie &/root/bin/cshB$}(#|w*% !  d \  r m  N G nobody*Unprivileged user/nonexistent/usr/sbin/nologin1nobodynobody*Unprivileged user/nonexistent/usr/sbin/nologinAnobodyuucp*BBUUCP pseudo-user/var/spool/uucppublic/usr/local/libexec/uucp/uucico2uucp*BBUUCP pseudo-user/var/spool/uucppublic/usr/local/libexec/uucp/uucicoB_dhcp*AAdhcp programs/var/empty/usr/sbin/nologin3A_dhcp*AAdhcp programs/var/empty/usr/sbin/nologinCA_pflogd*@@pflogd privsep user/var/empty/usr/sbin/nologin1_pflogd_pflogd*@@pflogd privsep user/var/empty/usr/sbin/nologinA_pflogdsmmsp*Sendmail Submission User/var/spool/clientmqueue/usr/sbin/nologin3smmsp*Sendmail Submission User/var/spool/clientmqueue/usr/sbin/nologinCman* Mister Man Pages/usr/share/man/usr/sbin/nologin3 man* Mister Man Pages/usr/share/man/usr/sbin/nologin2 man* Mister Man Pages/usr/share/man/usr/sbin/nologinC man* Mister Man Pages/usr/share/man/usr/sbin/nologinB daemon*Owner of many system processes/root/usr/sbin/nologin3daemon*Owner of many system processes/root/usr/sbin/nologinCtoor*Bourne-again Superuser/root2toor*Bourne-again Superuser/rootB.FAQJ U P  : 6 E @  h c   pop*DPost Office Owner/nonexistent/usr/sbin/nologin2pop*DPost Office Owner/nonexistent/usr/sbin/nologinBuucp*BBUUCP pseudo-user/var/spool/uucppublic/usr/local/libexec/uucp/uucico3Buucp*BBUUCP pseudo-user/var/spool/uucppublic/usr/local/libexec/uucp/uucicoCBmailnull*Sendmail Default User/var/spool/mqueue/usr/sbin/nologin3mailnull*Sendmail Default User/var/spool/mqueue/usr/sbin/nologinCsshd*Secure Shell Daemon/var/empty/usr/sbin/nologin2 sshd*Secure Shell Daemon/var/empty/usr/sbin/nologinB man* Mister Man Pages/usr/share/man/usr/sbin/nologin1manman* Mister Man Pages/usr/share/man/usr/sbin/nologinAmanoperator*System &//usr/sbin/nologin3operator*System &//usr/sbin/nologin1operatoroperator*System &//usr/sbin/nologinCoperator*System &//usr/sbin/nologinAoperatordaemon*Owner of many system processes/root/usr/sbin/nologin2daemon*Owner of many system processes/root/usr/sbin/nologin1daemondaemon*Owner of many system processes/root/usr/sbin/nologinBdaemon*Owner of many system processes/root/usr/sbin/nologinAdaemontoor*Bourne-again Superuser/root1toortoor*Bourne-again Superuser/rootAtoorrootCharlie &/root/bin/csh1rootrootCharlie &/root/bin/cshArootVERSION$|w+&61 I D ` [ ? : D D www*PPWorld Wide Web Owner/nonexistent/usr/sbin/nologin2www*PPWorld Wide Web Owner/nonexistent/usr/sbin/nologin1wwwwww*PPWorld Wide Web Owner/nonexistent/usr/sbin/nologinBwww*PPWorld Wide Web Owner/nonexistent/usr/sbin/nologinAwwwuucp*BBUUCP pseudo-user/var/spool/uucppublic/usr/local/libexec/uucp/uucico1uucpuucp*BBUUCP pseudo-user/var/spool/uucppublic/usr/local/libexec/uucp/uucicoAuucpbind*55Bind Sandbox//usr/sbin/nologin1bindbind*55Bind Sandbox//usr/sbin/nologinAbindsmmsp*Sendmail Submission User/var/spool/clientmqueue/usr/sbin/nologin2 smmsp*Sendmail Submission User/var/spool/clientmqueue/usr/sbin/nologinB news*News Subsystem//usr/sbin/nologin1newsnews*News Subsystem//usr/sbin/nologinAnewsgames* Games pseudo-user/usr/games/usr/sbin/nologin1gamesgames* Games pseudo-user/usr/games/usr/sbin/nologinAgamesbin*Binaries Commands and Source//usr/sbin/nologin3bin*Binaries Commands and Source//usr/sbin/nologinCoperator*System &//usr/sbin/nologin2operator*System &//usr/sbin/nologinB^Y{v Z T  m h   t 6 t nobody*Unprivileged user/nonexistent/usr/sbin/nologin2nobody*Unprivileged user/nonexistent/usr/sbin/nologinBpop*DPost Office Owner/nonexistent/usr/sbin/nologin3Dpop*DPost Office Owner/nonexistent/usr/sbin/nologinCD_dhcp*AAdhcp programs/var/empty/usr/sbin/nologin1_dhcp_dhcp*AAdhcp programs/var/empty/usr/sbin/nologinA_dhcpmailnull*Sendmail Default User/var/spool/mqueue/usr/sbin/nologin2 mailnull*Sendmail Default User/var/spool/mqueue/usr/sbin/nologin1mailnullmailnull*Sendmail Default User/var/spool/mqueue/usr/sbin/nologinB mailnull*Sendmail Default User/var/spool/mqueue/usr/sbin/nologinAmailnulltty*Tty Sandbox//usr/sbin/nologin3tty*Tty Sandbox//usr/sbin/nologinCbin*Binaries Commands and Source//usr/sbin/nologin2bin*Binaries Commands and Source//usr/sbin/nologinB 0x0a "Control Mode Page" { {Reserved} *t7 {RLEC} t1 {Queue Algorithm Modifier} t4 {Reserved} *t2 {QErr} t1 {DQue} t1 {EECA} t1 {Reserved} *t4 {RAENP} t1 {UAAENP} t1 {EAENP} t1 {Reserved} *i1 {Ready AEN Holdoff Period} i2 } 0x02 "Disconnect-Reconnect Page" { {Buffer Full Ratio} i1 {Buffer Empty Ratio} i1 {Bus Inactivity Limit} i2 {Disconnect Time Limit} i2 {Connect Time Limit} i2 {Maximum Burst Size} i2 {Reserved} *t6 {DTDC} t2 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 } 0x09 "Peripheral Device Page" { {Interface Identifier} i2 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 } 0x1a "Power Control" { {Reserved} *i1 {Reserved} *t6 {Idle} t1 {Standby} t1 {Idle Condition Timer} i4 {Standby Condition Timer} i4 } 0x08 "Caching Page" { {IC} t1 {ABPF} t1 {CAP} t1 {DISC} t1 {SIZE} t1 {WCE} t1 {MF} t1 {RCD} t1 {Demand Retention Priority} t4 {Write Retention Priority} t4 {Disable Pre-fetch Transfer Length} i2 {Minimum Pre-fetch} i2 {Maximum Pre-fetch} i2 {Maximum Pre-fetch Ceiling} i2 } 0x05 "Flexible Disk Page" { {Transfer rate} i2 {Number of heads} i1 {Sectors per track} i1 {Data bytes per sector} i2 {Number of cylinders} i2 {Starting cylinder-write precompensation} i2 {Starting cylinder-reduced write current} i2 {Drive step rate} i2 {Drive step pulse width} i1 {Head settle delay} i2 {Motor on delay} i1 {Motor off delay} i1 {TRDY} t1 {SSN} t1 {MO} t1 {Reserved} *t5 {Reserved} *t4 {SPC} t4 {Write Compensation} i1 {Head load delay} i1 {Head unload delay} i1 {Pin 34} t4 {Pin 2} t4 {Pin 4} t4 {Pin 1} t4 {Medium rotation rate} i2 {Reserved} *i1 {Reserved} *i1 } 0x03 "Format Device Page" { {Tracks per Zone} i2 {Alternate Sectors per Zone} i2 {Alternate Tracks per Zone} i2 {Alternate Tracks per Logical Unit} i2 {Sectors per Track} i2 {Data Bytes per Physical Sector} i2 {Interleave} i2 {Track Skew Factor} i2 {Cylinder Skew Factor} i2 {SSEC} t1 {HSEC} t1 {RMB} t1 {SURF} t1 {Reserved} *t4 } 0x0b "Medium Types Supported Page" { {Reserved} *i1 {Reserved} *i1 {Medium type one supported} i1 {Medium type two supported} i1 {Medium type three supported} i1 {Medium type four supported} i1 } 0x0c "Notch and Partition Page"; 0x01 "Read-Write Error Recovery Page" { {AWRE (Auto Write Reallocation Enbld)} t1 {ARRE (Auto Read Reallocation Enbld)} t1 {TB (Transfer Block)} t1 {RC (Read Continuous)} t1 {EER (Enable Early Recovery)} t1 {PER (Post Error)} t1 {DTE (Disable Transfer on Error)} t1 {DCR (Disable Correction)} t1 {Read Retry Count} i1 {Correction Span} i1 {Head Offset Count} i1 {Data Strobe Offset Count} i1 {Reserved} *i1 {Write Retry Count} i1 {Reserved} *i1 {Recovery Time Limit} i2 } 0x04 "Rigid Disk Drive Geometry Page" { {Number of Cylinders} i3 {Number of Heads} i1 {Starting Cylinder-Write Precompensation} i3 {Starting Cylinder-Reduced Write Current} i3 {Drive Step Rate} i2 {Landing Zone Cylinder} i3 {Reserved} *t6 {RPL} t2 {Rotational Offset} i1 {Reserved} *i1 {Medium Rotation Rate} i2 {Reserved} *i1 {Reserved} *i1 } 0x07 "Verify Error Recovery Page" { {Reserved} *t4 {EER} t1 {PER} t1 {DTE} t1 {DCR} t1 {Verify Retry Count} i1 {Verify Correction Span} i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Reserved} *i1 {Verify Recovery Time Limit} i2 } 0x0E "CD-ROM Audio Control Parameters Page" { {Reserved} *t5 {Immed} t1 {SOTC} t1 {Reserved} *t1 {Reserved} *i2 {APRVal} t1 {Reserved} *t3 {Format of LBAs / sec.} t4 {Logical Blocks per Second of Audio Playback} i2 {Reserved} *t4 {Output Port 0 Channel Selection} t4 {Output Port 0 Volume} i1 {Reserved} *t4 {Output Port 1 Channel Selection} t4 {Output Port 1 Volume} i1 {Reserved} *t4 {Output Port 2 Channel Selection} t4 {Output Port 2 Volume} i1 {Reserved} *t4 {Output Port 3 Channel Selection} t4 {Output Port 3 Volume} i1 } 0x10 "Device Configuration Page" { {Reserved} *t1 {Change Active Partition} t1 {Change Active Format} t1 {Active Format} t5 {Active Partition} i1 {Write Buffer Full Ratio} i1 {Write Buffer Empty Ratio} i1 {Write Delay Time} i2 {Data Buffer Recovery} t1 {Block Identifiers Support} t1 {Report Setmarks} t1 {Automatic Velocity Control} t1 {Stop on Consecutive Filemarks} t2 {Recover Buffer Order} t1 {Report Early-Warning} t1 {Gap Size} i1 {EOD Defined} t3 {Enable EOD Generation} t1 {Synchronize at Early-Warning} t1 {Reserved} *t3 {Buffer Size at Early-Warning} i3 {Select Data Compression Algorithm} i1 {Reserved} *t5 {SCSI-3 Associated Write Protect} t1 {SCSI-3 Persistent Write Protect} t1 {SCSI-3 Permanent Write Protect} t1 } 0x0f "Data Compression Page" { {Data Compression Enabled} t1 {Date Compression Capable} t1 {Reserved} *t6 {Data Decompression Capable} t1 {Data Decompression Report on Exception} t2 {Reserved} *t5 {Compression Algorithm} i4 {Decompression Algorithm} i4 {Reserved} *i4 } 0x1b "Removable Block Access Capacities Page" { {System Floppy Type Device} t1 {Supports Reporting Format Progress} t1 {Reserved} *t6 {Non CD Optical Device} t1 {Single or Multiple LUN Supported} t1 {Reserved} *t3 {Total Logical Units Supported} t3 {Reserved} *i8 } 0x2a "CD capabilities and mechanical status page" { {Reserved} *t4 {Method 2} t1 {CD-RW Read} t1 {CD-R Read} t1 {Reserved} *t4 {Test Write} t1 {CD-RW Write} t1 {CD-R Write} t1 {Reserved} *t1 {Multi Session} t1 {Mode 2 Form 2} t1 {Mode 2 Form 1} t1 {Digital Port (2)} t1 {Digital Port (1)} t1 {Composite} t1 {Audio Play} t1 {Read Bar Code} t1 {UPC} t1 {ISRC} t1 {C2 Pointers are supported} t1 {R-W De-interleaved & corrected} t1 {R-W Supported} t1 {CD-DA Stream is Accurate} t1 {CD-DA Commands Supported} t1 {Loading Mechanism Type} t3 {Reserved} *t1 {Eject} t1 {Prevent Jumper} t1 {Lock State} t1 {Lock} t1 {Reserved} *t4 {S/W Slot Selection} t1 {Changer Supports Disc Present reporting} t1 {Separate Channel Mute Supported} t1 {Separate volume levels per channel} t1 {Maximum Read Speed Supported (kBps)} i2 {Number of Volume Leves Supported} i2 {Buffer Size supported by Drive (KB)} i2 {Current Read Speed Selected (kBps)} i2 {Reserved} *i1 {Reserved} *t2 {Length} t2 {LSBF} t1 {RCK} t1 {BCK} t1 {Reserved} *t1 {Maximum Write Speed Supported (kBps)} i2 {Current Write Speed Supported (kBps)} i2 }; 0x00 "Vendor-Specific"; ELF 4pu4 (  Um H UWVS ]׍t ۉ50~$Ett Wz h$zPVEPSPxщǐU= t8vҡut h~ ÐUth$hw~tt hU~ÐUVSj/]S ^Zt p& = t3Vƃ ZYt݃;1e[^UWVSPPh/h<5G 1 = tN1MUUO~5j F Yu_3h5QG ;5j F jwUWVSWWEE} EEt8uGj/7 [^Xu = t66Ŝ ZYt>>tEEE} ENe[^_Sh/hr5F e[^_UWVSu] }N}] u[^_,U>UWVSRR;u;=$u@ P _t!=$u f` 5H[EE n =`t u}KEE=\tO=Xt tFEuh5E =$u @ @5 Y u]=T=$u,BHBy;B| $]Rj$] 5j$ _@Z8 =H"=$u)BHBy;B| ^ Rj^\ 5j^ Z@Y]=$u*BHBy;B| IRjI5jI=DÀv Sj _ D4%=$u)BHBy;B| M RjM[ 5jM Z@Y=$u)BHBy;B| - Rj-[ 5j-w Y@_Mv Sei Z D4%=$u)BHBy;B| ^ Rj^4[ 5j^ Y@_=$u7?tك@BHBy ;B| t GRQI5?t؃@P?=$u/BHBy ;B| t RSZ 5S` _Z@t:߃=$uFHFyV賆 @ Ve YÃZ=$uF @ V Zt35Ph\# [=$L_uff V=Y=$u @ @5Y Zt hjp e[^_UWVS DžthHyn} ZYu1PjRP; ^X8-jjjuV jjjf x`jhEPEhV gvË?5PVS y S [jSr3 @ZYuj X؉Džy!h\ _XL:t3u)h?Wa S考 =$u @ 5] ^=@$P诃Y[t5Ph\j d=sP<*) Z@u6h"1@SP y hjH )u5<5@W }5Ph\u [^LtW裉Yt0 e[^_UVShju] vbw~$\XzDTd\X`LDH6j5"X XZ%D5h>= ^XjhSV Ip=Xu-=Tu$=\u=`u=Hu =Dt1҉75 [t hj 5LmUU5hP< jmUWVSLu} EEEEwg1PtgHtGLtRXt| RtZftYur}\htNotR|vtrxrDEEeEEELECE:E1pL9-u<A9u4yu.Cp$EhWV^ p)N<}t0}t hj }t}t}t E Eܽ 7V/EZu Vhjb jSW EE\htG4H ws$}7jWu Cw $who E1ws $whK E }G<@Pu‰EG<@%[9^uwUZYt}uwh\ ^_Et}tnwh\1 Y}[~QuVG<@P]xSG<@% EP|xSG<@% EPVG<@PhP1 $j ^Zu DžXE8t hj u# u* {=t,hh詜 UBPhhh E)jhMAPhhh E؃ }u!hhh\ u5uUB%=EHB0R4:4+#| =jjujjEp0jG EЃ@u UrME}Ћq0VWutEԉá t^1REPEh0},$fE  fEm]mEPhhUrhx5) 9} ~ )v9thhh\ XEZMq0uk ^_hhh\ Y[EEuVWusEԉá t^1REPUj0},$fE  fEm]mEPhhMqhx5( 9} ~ )v9=hhu5s EF}yEph\ XEZ=t9uux^_tE=tuu7Y[tEurur_Zthhh\5 [E^E܍e[^_UWVSj;} W< HZYuj;u- H[^t1E@%=u 3 x1  \3 0 jWӅZYuWhJ8tPjuփ y uh,jWӅZYuWhPjuփ 1҅yuhj e[^_Uhhlh5:' j@WUIUWVS}P5 ÅۣXu 7hjmj=S趹 Y^ƅuS@Fxu 5hChjjhEEP u uhP tuhj PVPZGt*4ttt h X t1uha=puh.Q uTtLt>!t.t tT*t hAj tRPhjaӋ$9ډ 6|9w0PRPhjWaӋd9ډ`|9vhjhpjl e[^_UE E EE` UUW1t hj) |}UEUEXU}tjhIEPU] hjjhEEP u uhPtuhj P@ txUE E EE ` UWVS njEPSeEUn 8t5h\j E9؉EiEEUWt_GtOBt-]Kt/Mt3Qkt# btgt)>mtwt&2E"EEE@EEE EtOuE]މً}]ߍu]uU؉EԋERPEU^\9u{9uwE@EEXt *xum@UuE]މً}]ߍu]uU؉EԋERPEU[9u9t.j"Y $5hj 5hj EUe[^_USEu2 w=vjhhjX P]USEu2w=vjhh#j ]UE ptujjhAj UE[y haj uhl hlUESw=vjhhzja p]UESӃwvjhh{j P]UWVS$ykjEPSdEU\k 8t5h\j }9EEWt_GtOBt-]Kt/Mt3Qkt# btgt)>mtwt&2E"EEE@EEE E]EU܉E؋EËU‹uEƍE܋U܋E؅UE |w1҃} |}w19uuuux[99GEEXt *x@i]EUUԋUӉEЋEЋuU֍UԋUԋEЅUE| v1҃} |}w19tuuuuZ9u9t.j" $5hj 5hj EUe[^_UE`dUE $USxt  )Jt AD;PHrjDHX]áUtHUWVSQQ=tl څtC< tIu1R)P5}4 eAD 1)Ë5D-p9v¡xEt19s,;C t:E8AF19s;C tAF t;pF)ȃ uHp9s!)Px tP RVC` Nt; tC< tBuu HpDH;PHrjZ5D=e[^_ËU҉t]R)P5D2p)Px tH QDRD_pHU xVSt 5)Kt Fp59H9r5x u I9r*9 9r!)YSV5D2DH D H@D;PHrj[p)9УwtR)P51 e[^U=Stp5h"  A[9[r5y u H9r*8 9r!)ЍXSR5D11DH DH D]Ð111111U1‰USdÍEPsR]@ZYt9E%=uK = t=`uXEPhzf@sc @ush\j UtK tKE%= uAuE؉}܋EMH(MQ0]X,ЉUeUЋUI4UE̋]ЋEEЉMEM̋]H0MX4]A8Q<C8A@SF$9|˃t$D8P Zu3~ h|H X X X1n@o1;};j 4S[ 1у \,Rr F_CC^ ^R [6hHt hj DP&Y5hd XZj@hu u3H pU jQ)EU 1^;_s$1Ku} ?Džu*=jPY[9DžDžÉP_ZuVVW2Z=Yuy.9t y Wh# _XhSV,B 9t19sTDžx1=t{xxKu=t]tXDž|1=u1ҋD% u|+|Ku=tj,EP} 7蔏 ZYyD7QE%= $U |M h; ^uhJ艵 [DžtPq Yu#WhXa WDž DhjPtE 0h\ DžbVSYZu,ƅ4=t*U 2h\ƴ XDžZjSS<W M VSPY_ySh\{ XZDžhP[_t DžD}u򍅴=t E } ?=te[^_ÐUVS] 1ۋut-p$;t3V6 ZYt1=pe[^UWVS]1tz;nu{ou p1؀8t 8,uG@P Yuh| 1.؉ @j,P [ZWue[^_ÐUUWVSQ։ED0 UÃ1IQRj DjhkHjC1IQVjC(jhkHjC1IQSjCjhS:jC$j.)UWVSffEfS:u fEE]thmP4 ZYu KEETKUEUP# E_u E>tU1у~Auv|\u|cu AEC>tEC뫃}uEEC}t<]~Suj: @u \sE9E)]Ee[^1_ÐUiUj : Xu hj+ EU AQUVSSj u YtV CZu hj =tEt j PVG~ j PV E <e[^UUHw BE UWVS}1҅ɸtt11҃tkA=tt&j jw} ÉA 8"ujj艮 j jw Ɖ w+ _w1ҍe[^_UVSuHv4j ÅXu hjҮ vvhS1 ^e[^UE8UWVS01҅ts1щuSh ZYuD2щu&~=u <t#!>tVe[^_UVS];Cu C'18tSZY tSC ue[^Uhj踭 UVS]Su Zt SV؍e[^UVSu] VhYu S]Zt'VSY[EE e[^Se[^UWVSuVr} [u WdYtVWwvMw [ZV_WYFVO_11 1RP~VW e[^_UWVSSSuYu u Zt1uu }E pUrv ^_1RP?uu EU XHBR19ӾEU |9w11WVu]u Ue[^_UWVSSSu4Yu u 'Zt/uu E pUrv ^_1RP?uu EU XHBR19ӾEU| 9r11WVuu e[^_UWVSSSuYu u sZt1uu E pUrRu ^_1RP?uXu PEU XHBR19ӾEU |9s11WVbuu e[^_UWVSSSuYu u Zt1ueu ]E pUrt ^_1RP?uu EU XHBR19ӾEU| 9v11WVu=u 5e[^_UWVSuV} Zu W[tVWwvs ZYVWFVO_11 1RP!VWe[^_UU WVSEM]u}|(v|v|wy y y1[^_UWVSuV} V [t WIY uhA=tt?GFWVRPeppwwvvF thj聨 GFRP+YXVWe[^_UVSVVEMU EȉU5U tڃىUMY[[^E^Z[^UWVSuV} p [t WcY uhA=tt?F+GVWRPppwwvvU thj蛧 F+GRPEXZVWe[^_UM WVUS1 Ћu}tQRuu+9u9te[^_UWVSu [tu Y uhs=ttqUBRUEE HXEuM MuEutppU rrMqq* t%hj芦 U BMARP-_Xuu e[^_UE 5 EUMu AuBt1UWVS}Wu [t VY uhRVF uh(?=tt=RPww)RPvvwwhthj謥 G~RPUXZWVe[^_UWVS}Wu [t VY uhVF u h(j> =ttRPww ' G~ЙRPXZW^VXe[^_UWVS0}Wu jE puVl t hSVPISh\j裤 jEPjwV:+ u3]ȋMĉ u'}xWEEGP(E)ȋURP }ujjXZ h$^Wu ~EPk e[^_UVSxu''~'5)t PR Y P Zt`ҍptPR Z Py Yt#DXx1ҍe[^UWV=S|u 1f6=y4y 6x9ul9r hw@BfrBB|j EP3X  :tE8t RhJjc x;=| N~jhd3肵 uNuEtUj EP3  :tE8t Rhgc WQ@ZYu3h\腛 YEXNuJUUh~hhh5: jUWVS`=}] u4EPWt ^ZE%=@u,}uFuVSdt ZYuE%=@t&=ucVSRt ZYuVE%=@uFj/WP Y^u@PShhSS =~&,?W8EPSs ^=Zt=5qSh5 =$u# AHAyQ%% @5" Yƒ tGtB=$u# AHAyQ$ @5" Zƒ tB뼃ytYt5h+ E=tE%=@uSSQ ^uSWZYtSh\ "=tWPSh 1e[^_UWVS`j/u 6zY]_u@h$P _ZDhVSP( @up)Ã4t, 5itXft/Ftvh stTnt+cvtR\U?3h'VS' Xp)Åҍ4< u, -Ңu =u=u tt *t#jh66 Pjv=\t-EPSp ZYuE%=u (EPSp Y_t Sh\j| E%=@tg19tjS6 ǃ W UUE @@E E@@E` UE@@U E B@E` UWVS}u O<^=u5$@ $B@8.u=u B $A&;\v\=Hu = tP$w@;\Y[v\k$@<(@(O<9W8|9v(B8@(A;8P.:@^u!$r@BphY $fy2duq@h\hRF "$w@GphhRF Edt8R2 8R2Y@[u$p@@#4P8!8@_Zu)$q@Aph蛌 8L7 8<7^4uhHy脣 4[14эA;`v`D8Pp Yu hj赊 @P DCP (A%= t=`u Dž=Tt-DCP =0tFD=TTuDC 4PV 4蟻 $_ $@$ u#=\u =$d0W, \UME@hjUR1ۋ }E}D ؉򮋅P=$u$BHBy Rj  5j vO XZ1EP$piƃ{XthP' _[\t<=$u$BHBy Rj :  5j O [^e[^_UWVS,=@@}EԋG ;~/P5f …XYu j| XG Etx t MAM@u=XwtG$p $tGp=LEu!ƍ6x9}}e[^_ЙEЋE}ЃE܋tfx2t.=\ut!8WڍJ1PhS詹 [XEUE9Um=PuuM؉MEEE9EMW$wzE=PYtEEEU9U]E]!;]=Pt E@;EMԋUԍI=$@M̉Uu7ɋBH By ;B| t"RQ 5 PL XZ]]#]aEMu9M=$u$BHBy Rj  5j XL [XE؋E9Ee[^_UST=Eyj9B8dZ=u j [=Dt=^uLkEM9~9}=xu=uEP $SjP]S5Sv ]UWVSp Utfx2t6=\u =$t$MQ8ڍJ1PhS _XUDžDž<y =Xy XZ=$u4؃H0BHBy ;B| tRQ ؃50Pl> [XlGtHuhtjP$ E utPjupP3 4le[^_U5h j UU5h0ű j@ UWVS]} EE9ptmt &vtDEE`haWS? upu F@d, 8u u p Ytu h\h ujhu A xS5hW7 9u5d5hu0 }>uh\g XZu  ^tu hg Y[u W uf^vv W_f t5vv u hLg à tPu hg ff j;W:HYZuBj;u+HYZu3uZu uhPWZYyu h'f YXu FPW訠 tPu h%f l vDWA[Zt#R 8-u~DtvDu h?sf FEF EEPu EEƟZYtu hZ7f [^Ws Yt u h\uh Ztuhf =xtu uh蒣 1e[^_UPb uDju u=xhdhunPhhs\ hsh\e $ujEPRj1 @uhszEt hst Phs/u7juhdh{hh\ hh\e j jEPR0 @uhhd 0Uthhe 1tRhh{e UWVSP=pu} jW [Z|]SV> @ZY3=lt=xxWhH [^f=tth\Whg5! yjW0 ZY SW= ZYEPEPh\Wju[LY[Pju^K[Z} PtPEPh5親 (=$u# AHAyQ @5| Yƒ tGtB=$u# AHAyQ @56 Zƒ tB뼃ytYt5hKը %WVȜZYu=xtWVh荠 1 8uvEPVO< @Y[E%=taSVYZuSVhOc [PS@YZu-$PSM [Zuhc )WVh+Kb ]SV; ZYtVh\.b &E%=u SWV[ WV*ZYe[^_UWVSxitft$nnt=vtXbtl4plt1ltpxh;u u apU )E}U UEP} Mt: _ZuE%=@t }~!E p0t5EP4/5 YZuE%=@u GEEC<Ʌtd=t[5h- XZu uhWh57 }u5h ^X/~-uhUPh5 5hi诠 54 =$u# AHAyQ @5 [ƒ tGt]=$u# AHAyQ @5` Yƒ tBBtntNtyt Y1ytYue[^_UWVS=}utWh/5 =F%=wju ѵ Y[uFDuU=HEPFP:vD2 u hj X =t Wh;jX W;uP;uPjvA_ZPjv @ZY} PtPEPhj5 $SM _5A =$^u# AHAyQ @5 [ƒ tGtB=$u# AHAyQ @5o Yƒ tB1ytYue[^_UWVSd}EPS1 YGE^t0tfEO=t 8OSh\W Pt'jn $ShX U%=@u%=uShMX XZ=u$%=tEPSSA =u EبtuPSYXuME%=uS.=@uS荐=tEPS^ZtKS, Yt*=t 8tSh\V XZ=|t uSpS ^}_e[^_UWVS1=Ut=u=u=t=t jPRj =t 8>hC4H $dsl $shj!U =t {sl $shfV .=u-s6RYy.6h\P XZESh\P [_y=t6WM Y=tb1эDH9v8/t@-H9r8/t@9t)SˉZx=tSL _j/S; ZYu1 E9u U)US jh]S jSj+ ]UWVS }ucE @CE]v Ry Y D4%@uъ1<-u3SUC=fw 5u:.tc<+uCEU=w5tj EPR@ 1ɉMEE8.]uDUBEBЁw(5t0C ȉיuu}}~ jEP蓪 XZ1e[^_ÐUUjU UU1ҍt8u'B~ 15(Q<)‰UU`RP ZYt hjL E%=t=t5hj-M EЋU( $UWVSRj5E' _Xy 5jG=t _:h hd@V uh(hd@V t hjK (Ӌ$9ډ |9v hjlL jjjV h h Vp = t5hQjK V& (jh P$}tt5hYjK $/hrjhP/hPjhlSr/ 5jhS\/hjhwS/ S]0^tS1h1R(P551ۃ9ӣ u49u0f1ft"51҃t)AÃ9|e[^_Uhhhh hXhhhhh)hMh{hhh5Q @j' UWVSVV׉u5hV! =GWf_Uw4 h3PhV Sjh Vӑ ujhVÑ Vhi艐 YGX[t Vh"v XZGXt Vh.c Y[GXt Vh3P XZVj ސ w(h<Vd w,hOVV w0hcVE w8hyV7 w4hV) $w~ j5 ÅXZ(=t5hE <(hjhPw(hPjhlSe( 5jhSO(( PhhS'( S:)^uxS)=Y'hjhP'hPjhlS' 5jhS'h h hS' S(ZtPh\ZE Sp):Sh)?5h S ;t5hZD S  S X1e[^UVSFt1Ӂv R Z D4%@uӄt#u1e[^USSCEt,Ёv R諰 Y D4%@u}#uʊtC<#t ؋]^1]UVSPPj5\ ^Xu5hGgC F=t );h hd@Ss uh(hd@S\ t Sc 1^hjh (1R(P5$5 WEVdWEVuVhd@S u E   ?Vhd@S uE&=w =$ 5 1 fjf(l f*amnesiac51Ҹ=sf3Sfh e[^UWShPӉ YZuWDnZu Whj@ hPSf {1e[_UWVS(EEuE=Ex(u 5h*Uz,u 5hMy0u5h躆 oEx4u5h藆 XEZUfzHu h$nA _My8u A0A,A8Ex<u ‹@4B8B? U,<%tPtLM1ҋA(RPWV虿у tEaPh > XZM1ҋA(RPWV0ƋẼUEE9E_M1Ҹ f5(1fEtLE<`t1t,,<%t"<*t9v)Ɖ9vEǃ9E|MA<9s)ƃ}}dvuh;5X E܃ EffEU<`tB,%u91ҋRP},$fEV $fEm}mEEÃ9E|Vhe5趃 E܃ }1Ҹ M5(1IÉMx?EU<`t"tF*u MyɋMHU9ЋqÀ E܃&9t"}t'tEVaPsh; }t3sME9E7fEˊEaEutPEPh"; UB<9vEPh54 E܃ M;A: Y^tEPhd: XZUB<9tEPhl: _XuuMA<9tEPh;: Y^1;}utx}trtit`E<`tS<`tI9s19w9r!EaPGaPh5 E܃G;}vUE9E:}JEMu t EaPhG9 E}~‹E܍e[^_UWVS$DžDžjhjh` ,1F󪋅ǀ ǀj VR _Ztj:PQ Y^uhB5~ +GShGqSg ^Zui ds8t WP: ZYt- dfBj jW5 vPhYht5} fAhS踹 Y^Dž?h#S肹 ^Zu Th/Sh ZYu :h4SN Y^u  Sh5@} vBXhS ^ZuQ1?j jW D\F 8~PhSA HuPBv0h5{| fǀ0f&uhhHS# ZYujWhS Y^ujWP, hSܷ ^Zu=j jW ttWhB(hS获 ZYu)j jW讑 A,Nh ST Y^u)j jWt B8hS ^Zu)j jW: iA0h^ S ZYu)j jW /B4h,S覶 Y^u)j jWƐ Ahhl, XZhh%V, ^_h [11'S舵 Yj\bZ 8Cts 8#uuj> _r' |utVa[b\ PxdYj\ P$' $A ZuHjhSS6& Sh\jhT+ h=* X39tP _yVoa[ h?hq ZYhjW' Sw Xt hWh> 'hpg ^5耪 =$[u#BHByRG 0@5 YƃtD t?=$u% AHAyQ B: 5讲 Z 뿃n(h XOt1ҡ1th?vQp Y_uvhj' 1[uju vOu Dž61W&Au F1:u tV UVS]SC C u ‰KQA A C ‰VKQA A C ‰VC F C F SC fF[^UWVSQ]SC C  ‹} WEVQA A  WEV ;Ef19ÉEs$Q Ѓ1;MrfKSC fGSC fGjGPCPj jGPCPj K(QA A C( ‰W(K,QA A C, ‰W,K0QA A C0 ‰W0K4QA A C4 ‰W4K8QA A C8 ‰W8K<QA A C< ‰W<SAC@ fG@SCCBKD fGBQA A CD ‰WDSICH fGHSKCJ fGJSMCL fGLSOCN fGNKPQA A CP ‰WPKTQA A CT ‰WTKXQA A CX ‰WXK\QA A C\K` ‰W\QA A C` ‰W`KdQA A Cd ‰WdKhQA A Ch ‰WhKlQA A Cl ‰WlKpQA A Cp ‰WpKtQA A Ct ‰WtKxQA A CxK| ‰WxQA A C| ‰W|QA A  ‰ f fQA A  ‰QA A  ‰SVSXOZy1ɍe[^_US] UBBBCBJAAACBJAAAC B C B fCBfB[UWVSQU ]CCCfBCfCfBCfCjCPЃPe jCPE Pe M A(C(S(BBBA,C,S,BBBA0C0S0BBBA4C4S4BBBA8C8S8BBBAu(x$t衩 8ut}t$]Cj)PSuuh\UU hjt U[ UhRW 5555h U =&w=&w =&v h Xh 5&5&5&5&hT UWVS j h&EPEQ uh* AUBR )@EMÉE}M EԉM؋M؋UMMU19tF|8PUPPh3S MAPuuuA PhKS U(B PB PBPBPB PB PhvyS EPhhS e[^_UShw Xu!Sh5S CZY~ ؋]p]UfUUWVSQQ]f;uuuj h&S( i15&UfCfC 15&CC 1҉5&SS41+515&UfC15&C 1҉5&S e[^_USJ)h6]Ujjj5& =Ph5&辥 @uh1f=Ut h UWVS='t X.h6jhPh<jhlSj/5 Y^u@PjhSh5hنSSZu S`Ph\4 _XSH$j5h5& ;te1xW5hASr jjS x hhMP+ V4 ^t~hG [e[^1_UWVSQ1ۉUuVhc_P 5 5jdh@BZ ujd 1@Ɓ>@t @Ѕt t uAu1]AtBЃ w k \ t ut t uAu Eh@hO _X'e[^_UWPh}O 5& 5jdh@`Y uj肈 1@Ɓ>=@t[hh@\ _Zt?hh@G ZYt*hh@2 Y_thgh@ _Zu1}UWVSEuhN E_=X=t.1}uh [V EF)@PU<MYtEFPUCZtEFFE@PhJhVM 5jdSW 1Ɓ>@ t t uC"uC]t""tC] t Ct u}1эQ E BE@juFPk uUe_tEEuUv[tEE{]F ~ EWU^IYt}u؍U1ZtEESUYt]Ef~ F f~F~F EWU^^^ Zt}u؍UYtEESUZt]Ef~^ F VUEYEQde[^_UWVSu] Dž ft]!18Bt)at3ttY it:stAzutRvtYn wDk_S G;/0 $hhEh5@T jJhpSV =u =t = t p9ƍPheHD@Y[u hqjhS tPh%jPjVS}t Phj +@P< Ztw)RPS: + VEP3 ^_t>՝ 8u48/t-Phhh =uhFj$ $P55Y @Y[us 8'5h- u5h4A XZ=u= u1ۅtS5. &^@_u: 8uuj5 Y[&=&uۜ 8&u5hW XZn Shd@P u &&Shd@5&͛ u &&S hd@5&&d u u Dž  Phd@5&( uP1R PVS܌&1 R&PVS趌&=u5hl=&y5hj  =t hj 5&5&5&5hF huhhF 1ۃ Ft.PV F)Ћ @PRCPhF C ~5hdF _=Xt#=t= = 5&N ^t &5&h [[t &5&~ 5Yt &&&&R f95t &5h NE h p hf  uCP~ >=u =Dž1?y^Sh D XZuF ~Ӄ=t$ t  h!  [!u Dž[ tHS YtCw t= t t=u=u = tP= uh C h  XZg= u (t h+  Xj| UMS] ACACACACACQA fCACA C Q A  fC A C A C QA fC1ҊDDBv[US] UCBCBCBCBCBfCBfBCBC B fC B fB C B C B fCBfB1ɊDD Av[ÐU{U5h^ J j{ UWVSQ׉j j EPSa Q 8t Sh\j E8tWSh j e[^_UWVSE} vlG> ^t.=t%twhIs> !XZt?fx t6h+ =  Y[t 0h\ h= XZ='^LNH u VTFP tvTvPSQh9 = ^\NX u VdF` tvdv`SQhV U= u t(hr 6= 1XPh<C= _XvEqe[^_1 UWVSPPu ]t>umtS;tN1ЃщMMQMW/ DžXu h|jH VShz uWt  V ^tS4/ Ye[^_UWVSVE 0E}EDt><-uj=S FY[t(@h Sd YZt  FFhIEP~ ÅXZuE 0e[^_UWVSQE} tU8tPtL?tGÉE'VW YZt;,u<FCuK,hIEP} ƅXZue[^_US]u PjfYZt h PTYZt h PBYZt h P0YZ t h PYZ@t h P YZt h PYZ@t h PYZy h PYZ@t h PYZt h PYZt h PYZt h P}[Z]UWVSS]sPƍEPW(Sh D: V, S`( u W(Ytpph : e[^_h u6 ^Zu#heHW% Y[u E E E e[^_ UWVSx P]u}u XZuu; t޻VS $jheHR~ uth V7Y[thV XZth V [_h u5~ ZYuEuh hPd譴 WPVdDž8U dh='DŽdt>uh c8 _X;}dhC8 Y^Cj O7ttth=j V* h u6} ^ZuW~Y[P6Wh PA 8uh uh  jp VZ* j|PSy h j|ƒut%wtt4Rhg 3='tISPI1_ZyRh n = 'tSS^1e[^_UWVS }} uhA /hF!WhWu)EE1E5ShF!{ ZYuWSh{ ZYuuSVlY[hIEPkx ÅXZuu) u( Euu1уQ( DžXu h|j fnoGSWd WuW( jSh uCPuY_SuEXZhIEPw Y_oVX( Ee[^_Uh hTh{h5> jn UWVS$uE1EEE  p%dt[FtcatEftaoteurtittkvw'5DQMyD8toPX ';hE}t hj 5DEDEX.M%'hu?Y[Ehu V6 pU )ƍU E tjEP|ÅXZu h(hwx Y^t&h wx ^Zthwx ZYutuwY^uchw r^ZuPEuSuW u6Epw u@w Puw7wEX$tEs!Dh= 't>9]V1EuPZYu EPE_Ku!9]1EuPZYu EPXKu}tE 00_EXU 2EEE^uE 0h1P[ta](V03w ZYu!Pww ZYu Eu)U 8/uxuheHNjEEX}Etpw (pUju jEuЋEu܍RuPWE 08DžXuU 2kDžXu E 0hChw[v [^t7h wHv ZYt$hw5v [^tU 2h/j w uuw7w}j@E 0 ZYuj:U 2 ^_t{?@uw1э|1E 09tR=w 5u5Ӂv R_ Y D4%u.t -t:uF9uEzwjuu܋U r2up@E؃}uf# u]h?hOF9 ÅXZtFEPhSe Hu*E~#jP~h @^_u 8t hcj S| [uh U5h7 jh UVStu] EHp%oujEPh`5Dh9SV uǡp)ƃtnUEЃ%EE[PRSh E+1҅yTʂ tu/SuhEt Suh Suh uh\ XZe[^ÐUWVSE EUEUEu E܅^jj >nu~ou EEj=V4 Y[t@];taU1IMQRVi uUt <=tă;t%{ MuME;CCu !‰='u Vh1j 1hIV6 ƅXZ8U܉Ue[^_ UUSM ˀ:tz/uB:/tBA)H~ y/uA[US`] SuzZYt-EPS ZYuE%=@t)ShMj@Z ̀ 0 $Shj@> ]UWVSQQE uEÍPU26 MljXZu E Uu UU1҉߃}ыELCM ؅_y}֋Et]U e[^_ÐUVS] 1ۋut-'$;t3Vq ZYt1='e[^UWVS]1tz;nu{ou '1؀8t 8,uG@P Yuh|p 1.؉ @j,Pt [ZWue[^_ÐUU5h!3 j@&d UVS,ju Y^Phc@SC~ @tT)ƍFd<fPhcSƅƅ} @uS} S} ZxuHy ȍe[^USh]!%Zy-h$Yxh%Zyh _j| CxYtMjj C|Zt;jh(sx,H jju pZYPs|H s|sxz ҉Ћ]UWVShjtP]u DžpDžl1Rv EEE jtg$bt?Cet6gt=rth ot>st`vtlpppzpqpPlPh5DBNpE5DMd YE4G15DtP8@YZu hjGE p 3h1VSCz p)Ã4ttPv SSlp}DžxtDž|Eu8SEZut h> ^Et Ph|' Y[tPltPh$yth\jQ j` UWVSE EUEUEu E܅^jj >nu~ou EEj=V0 Y[t@];taU1IMQRVe uUt <=tă;t%{ MuME;CCu !‰='u Vh1j 1hIV2 ƅXZ8U܉Ue[^_ UUSM ˀ:tz/uB:/tBA)H~ y/uA[US`] Su}sZYt-EPS ZYuE%=@t)ShMj@V y 0 $Shj@: ]UWVSQQE uEÍPU22 MljXZu E Uu UU1҉߃}ыELCM ؅_y}֋Et]U e[^_ÐUZUSRÊ0<w"jEP5D7Q xE8t Shj@E ‹]Uhhhh5- j@] UShUlZy0hUIYxhUNZyhcO j Yjh(PB uZtP[Z7ji Yt+PR j pu1҉Ћ]UWVS hTjPDžDžDž1Zp 1DžEEE-g5Lu9tjDEM?W.olt)mst ut)DS/ Zt@5CtЁw 5uu Q'^ YQh^DžSDS+ Zt@:CtЁw 5uu Q] [ QhjC DžDfDfE5DjZYtj.5D軽 Y[u5Dh\jNj EZjjCP Y[Puj EZj5DP? PPh`5D j E[ujs EYbh5De [Zu*EISO8@859-f@2ECP85f@2h5De ZYu'EISO8@859-f@7ECP73f@7jh5Dve Y[u jhh5DWe [Zu#jhuVm ECP86f@6 5Dh\jBhu uq pB;EttufEtEfE }4\u/}tJj  EYuh&ISO8@859-f@1T@u hUjG) PSAVV%TDž\Xt tucPS跺 @YZuSh nu u uf%fEfTPPhy Vh\jG5 jjW UWVSE EUEUEu E܅^jj >nu~ou EEj=V Y[t@];taU1IMQRVI uUt <=tă;t%{ MuME;CCu !‰='u Vh1j 1hIV ƅXZ8U܉Ue[^_ UUSM ˀ:tz/uB:/tBA)H~ y/uA[US`] SuajZYt-EPS豸 ZYuE%=@t)ShMj@: p 0 $Shj@ ]UWVSQQE uEÍPU2 MljXZu E Uu UU1҉߃}ыELCM ؅_y}֋Et]U e[^_ÐU?UPPjjEPEPhPEnth\ 1EUWVSj/] 3EpZYt@hhP ^_Et 'E1EE|F w@$MdDEZEQMEDM@;4= 'uP} Phm5$ jS hSul hE%=u hj f7 t n  tuQoj1}thh$hhd ~JjhPm jhSm 1}IQuSm $jhSm S{m }u_uj P| [t8= 'tj"jhh Whj"jh Whj hhhR }uAjjR @ZYuh&'jj5 jjQ @u*?m 8t h3j 5hE*! _Xdj 1^+}uj 9YtC~׻j jQ @_Zu l 8uPz C^um[l 0 $jjIQ @ZYmtRhj U\Uhhh*hhh@hhUhhihh}h5U! 8j/UWVSj?}YAhjXE ZERDž :-P' _ÉE 1Q ^Dž8:OtruWh Y[J1уQm Z‰u jj -B0BPE Y_"u-FDžF94tu+] CEB+q$j P5Dd'\B pW‹ 8t5Dh$hT\' =H'u# D=H'ut hDH'D'tPRhHj D'{P'oj P5DfA ‹ 8t5Dhqjk 0hcL'X'T'Chu uf `p)EE =D'u hj hj0 H_Zu jj0 [^hj0 HZYu jjx0 ^_5y[uhG Yu Dž5H'E<X}ZuU BEE B6D'rtIRtittx~Xj@-j8D/sX=lWX'~ft5hb ^_h8j,Y=X'[t5h#/ XZhjh6T&*9Rt5h< ^_jD8j,Y=X'[t5hS XZhjh6% hWhj^(X ^=\'_t/=X't5ho| Y[hjh6% jhP5XZ+h79S hj'jh5Vj+jN7^_EHE@hVE 0E LVk]th<PV$ VjM+j6Y[EHE@tLhVE 0E V]t˃=tVaZhSV$ Vj&=\'Xtj(UVSÊ< t< uCmts\u Cu5h XZGC 't "tCF2C t CF8uCuPh5 K < t< ue[^UWVSSh6]SU Zu YtjhS" u;/uf. f./F1҈щM߃ыEL;Mr5h j'SV> YX?tG Y D4%u?CƉf+F=\'fFt IdWuF ^u&-Zt @tF *F GЃw$4Ph5 +F @)F =#F #F %7#&_uF /F e[^_UWVShPheHEEE@EEEEuEuk h,菛[t2}tEPEE)Y'@'},u='5hr XZ5O X5hWhh'+ *=' t1'I'' t uH@ڸ'^48u'hPR4+ ƅ2'''8u ''='/uhQh'2h'ShhS! hPS FPjj@RIt'@uAv4h5K )quitCoQv4h$5  FtKFhF+FV4S* ƅFH FuFPXlEcDA ?atk ehx s pqV w v = x/ 1IQh=R  WiVÅX=tW&[^hSW1IQhjRK  W VYvP"HZu WhF WP}8 e 1IQhR B Sk(^t@u Sh[, hpS1IQhwR ej[=\'[tK@'1IQhhR- hhhhhhh4hVhhhhhhh.hJhfh5! L1IQh R VY=\'uIdW=X'u ?VZDžRDž1_ʉщ\ 9'$(lj1I^f[uk $Yu5hVZu hT_Vh5z hVWDžw% heHW5 1[^q=\'uIdW=X'u.?h6_SK ZYt}hSK ZYtlƄ5W=~%hGPPh5 1RGPS ؃ _[ 7Y4hj h5 k DžxDžtDžp|9sE9sC9x}x{ t Džt{ t Džp ;|빃txpx=X't<Džhׅ~ әh担xhDxQxxufT1Й1d9Džl9l`k` Ã=X't*3hh5 hfC@fCttO=$u0BHK By ;B| tRQH% 5C P XZfC5s YpXtO=$u0BHK By ;B| tRQ$ 5C P讗 XZfCkd ;|r5j  Y[x[;x}Nx)ډӃ=$u)BHBy;B|  Rj _$ 5j 0 XZKuld`9lcG;d5 ;r s"Y5j _ XZJG1IQh8_R^ u5h mr PhvG1IQhPDR 1IQhMR ]<1IQhR =X't5h X'5h  X'1IQhRH j'_{1IQh#R ur*K1IQh(R uB=\'t5h. \'5hB \'[^PhU5 e[^_UVSu1=X'u;t#=\'u) IdWuVÅXuu1(+C+C@PCPh+w +e[^UVSuu tYt1=\'uIdWt=X'u ;u3ZufF@fF1e[^UE @E E@Eo U=D'iu=,t jh,^h{fKZuj>ÐUVu NS1ۃ=ádWt;=X't}54tP XZuVh5' e[^UWVSt1M =IʉEdWu}u&=\'Vh5 } u=D'iu =X'tv=u&u h]SM u u S\Gu ÅXtSe$VBC ZYtWu V uPMYfKEe[^_UM S1ۃ=IdWt*u,…XtfBzfBtRX؋]UWV=X'St5h XZjÅXta=X't5hV _XCPJWу0{tdW0tSSKS[^u;5tWV[YtxNWu^=\'tS$h5 {uSeKSSMs -C  -[XZuFie[^_U-|NILS--thh-* XZthh-* YXth h-* XZthh-* Y[-]UWVS M IEEEdWtEuDžXt)wMƅXu h=HX9tEu ƅXtM^t 9t*[EuP9tL}uWIW[_0׃=\'tWF$h651 W+LY1eEt"Et F;EuEt G;EtM}E$pfN}uWcIWXZWKXuu u@ }uPXJXfK=\'hS}ufFufFFu'uVd$CuVJfNq~uVE3$uhZMuu ufH ;}uaWHWEPu uo}uPI_fK=\'SvD$uEPh}ufOfO=\'[WFthVCF[^;~uMu Yt&~t hVFXZVGV[_vuu uPH1 uVJYv -F uu u5 -mƃfN=\'VC$uEPh5 x=\'tuEPh5w EGu uhuEPh5B uEPh7D Ee[^_UWV=X'St5hR [^;=tWsvWYtfxt`OdWtF^t?f{u3=\'tS$hl5 SFS7XZ[G낋5 -t^^tR{uGf{t hS)DY_=\'tS=$hl5( SESXZ[몋v 랍e[^_UWV=X'St5h Y[ -1۾ -tE{ts C SESoXGZuۅuƋ -thSrC_X[ e[^_UWV=D'RSX'ut85h2 $t5h Y[5@'uXZj@Ƌ=@'XtW9WVs@[;5WsEV6Yu Vh~BXZS$h#5 fcV*@ƃ볡W9tPVh:5 K6QVÅXu hYBYCu hoSNBXZCt SCfcXSY$36fcY@'9Pu5X=@'Ze[^_UWVSWW=X't5h [^jfW'5lj9?EtWHPZ?ǃ u@'E?WEX;5WvE9@'u4E9@'t4^u;5WsCVFÅXu h@XS$h#5 fcV<>ƃ;5W9VÅXu h8@XS${4Efc9@'^F4e[^_UWVSjYt<=X't5h XZFtV1$=ff_vu߃=X't5h [^Dž;tWslYtLXtECt:V$W X~ZujjS$WD fc[댍e[^_U=X'VSt5h* [^;5tWsCVyYt3fSЃ{fCufSf{t hS>XZ[F뵍e[^UWVSPuV} EÅXuVh5 1LW9YtEt 9t@u Wh +>XZ{u}t h S]>_XEe[^_ÐUW%=@u1=WuUS1Q`-t 9Ht1Z[USf@ fCD-=~95=h@-jf)hWfW# D-CPD-SWP D-S@-УD-]UWVS1;u ]=[t Sh cXZ=[t;t=[u {uCCC%S)u9C 9=X't5h+  YXCt=X't5h?  XZC S9s=X't-PRhY 5 =X't5j [Xփ;Ue[^_USjjj0B +CC]UWVSƉӋ}9tU)ySh| 5 %jRP6~B %FthF P6QB F e[^_UWVSExu=h PU2!B U B=\'tg5h _ ^_SEH;H| @릋]ˍ{ fWft)9~$=\'tPh 57 1U1UB{ uCheHP2 Y[t2;tWr&=\')Ph 5 e[^_UWVSuS ^/Xu@x/t1k<1҅tR1LPR =$1[y5 =|Yt@9uWVCP uԉڅ҉u1&:heHP. ƅXZt >s؍e[^_UWVS ] ujSuUjSuU huP1ۃ EѸ)PheHP ؉򮋅PIR =5 =e t$h6@P 1 _Zu5 ==^uh!5 t$hCP0 ZYu5 =Xuh(!5 =IDžƄS=CvhPVh5b +RPVu3VVp =5 =Tá =Xhe[^_US]3E> Y]]TUSjPĆ YX1t"h Zu S > 1 @]UVSu6Zt$StVR:1e[^UWVS@=X't5hQ!% [^hx!=e Yt8u!D'rtRu5`WPh!h =#u h!6Kh?h DžXZuI= 0 $h!5 hh!5 5h!q %=$ufg WO^Wj4jEP =$uG W;O[uƠD'b![_5=j@-fDž5D-f)fhWfW 5= =Y+FD-F e[^_ÐUMt(; tWs 15DA@At 9Ht@ 1UVSƉt;tWr Vh#/YX1҉5DA@A=\'C st[ t9suh#S/XZe[^US]t;tWr Sh#.XZ15DA@At9XH u @ P Sh#^.]UVSjuYtX M9sFBAV@=9v"R6)S j 9tK/vSh $H-e[^UPB9ȉuAB$t@9uA҉Bu h"$QQ-XZUUW1I`A_`AUVSuf~t hC$V -Y[~u&~t hV$V,XZ~t hs$V,[XFt^P+Yu h$V,XZ9u^SVXt/1&tC9tFۉCu h$Vz,Y[6 =F 5 =e[^UWS]u h$+X1ЍH`At ׉`APuDžXu h$+XSW e[_UWVSQu ]u h$S+XZ;{t'G{C_j/V而 Y^3xDW61IKSE/Z3Pw# fCu fCe[^_UWVSP= =tG = 1j$j ^_u h$*YECEuK} u jAZtuh%*^_uu}1IڸK[j/u聋 ZY@P@ǃ1IFKsC^EXt+u ƅXu h % *XE CFC^(} t"u _t h;%)^ڋE e[^_UWVS\=X't5hL% [^=P'hu ZEYu30 0辵 $h!5 uhh%P)ja=$u Ef` uBX;5tWw5VXt%C uCPj3i G[FÍ}E;5tWVpYtpj$SW< ECEC@ GC t@ GCt@ GCt@ GC t@ G ujj$W [Fq1;5DAs1@Au E@ EujjEP FNjE EtWEDAEEElWuE`WjEpWjEEP@ =$u E@ @ u蛙 Zt/. 0 $h%5 uh%'u' e[^_UWVS=X't5h% [^}uL tW1һjPDA Z@AYu h% '_jjh6fHjju6v y/. 0! $h!5. uh&&tPS& Y^y/- 0߲ $h&&5 uh0&q&uVj DžXZu hR&N&XVWS#- xjEPS- y/\- 0m $h"5z uhz&%D'Rt7ruhlW9Etk} 5h& 5h& ^_jElW=d'EfW`Wu u[u Y Ph&x%XZE]ܣtW47)ƉE؉DA5@AH19}t k$BQ$9sQkB$BB:t k$BBt k$BBt k$BB t k$B $뫍e[^_US]; pW~BBtPY P\BZu5h& j ]UpWB=d'SB]tRj |} YhWt hBj:Ss YZt/j:`BSps [Z5`B+CYhHyS@ YZh?h'W YhWZue* 0 $h'h&'5 h?h:' hWu&* 0ɯ $h:'h&'5 2pBPΔSԯ [BZu5hD'q j@]UVSV5V5V]?+SE $hn'5[ 5V5V+VE֡V ƹ~'t S [Qh'5 (=Vt:hXVhVhV5Vh'5 hVh'5 e[^U=lBt"f=Wu5Wh'h'O tW=lBW'fWfWWtjhFlB cUQQ=@'=pBt5h ( jH=`BfEEt Pj,XZF=hBu=EPhm5 ( y"( 0覭 $h6(5 U=P'uEu u5G' @u.N( 0_ $5W5WhG(5` UE jRP5G' Bu5@u2' 0 $5W5Wh{(5 jU$KE =U$K~$PRh G5Wh(5 jtU E G* U5Wh(5 jDUS] Su5G G]Uh)E GUUx6=hBt5dB舁dB=`Bt*,Pc& XUE Pu5 UVSuU 1>˃htH09~.bqtn ltAstwtk DF륅uщKxAQuKx~ BJBJJBuKxX BJBJJBJBBJBJJBʅuPh )5 jFe[^UREEPh$EUWVSW C=T=l=ku%5h/)\ 5hY)L =Tt=C=lt3=k5h/) 5hY) =[u%=X't5h) Y^[=[޿Eu EOuEOu}It)5W5Wuh)5 1W=[t0Sh)Ph$pxPh)_BGW$ CC(K,~G)19@{lujxu [s$su$C|XZC{lC|s#s#s0#s8CXS\#C`Kd Rh)u_X=[tC$C&=\'CTxB|BU;uW5h)X Y ^tRPh*5^ 5j XZ=Bw[$5h*@5h3*35hJ* 5h^*5 5h* _XFHB9tPRh*5 5j Y^;1҃t&19}5Gu tB@9|CBF=Be[^_UWVS$}uFlB|BxB=pBF}thh*c=T'[=$u hW@ @5hW Y=$u hW@ 5hW\2Z=@'=hB7@=pBwD't<>/u4WÅXujWY0WP"fK/F뿍e[^_UVS]s{1Yt9tF@u h4SXZsVh4h4h@O e[@O^UWVSuF t h4V[_fN V$S 6JVa$41INV$S e[^_UWVS`=L'u} t=P'uW( X}u6=P'WV觪Y[ 0 $VWh4u}u|=P'WV[ÅXZyqEPVI ZYu)}t#jV蕪ZYuWV(uV}y4y 0芆 $VWh55蕶 uh;514=X't&V}WT5t]5Phb55V e[^_ÐUShy5X| Huكڰ |tPjj|PCPDžtDžx tUh|P5 ~7{ Ƅ|tS:R|P5PSh5TjB UWVSum 1҅PS_Lhj =[=DS^uCh5h  ZYDSuh5TPf _HSu h5^nj@5PSG Y[toPSEƀ8tTÀu-v S Z D4%u _t-tuh5cY[jR F>G=PS HSEh5G& Zu5hh\^_hSuHS0DS@PhPS+LSyu5PSh5 5PSh65ѳ pW =E~EEm}~"jEPhh5LS xjEPhh5LS jEPjj5LSE y h16YjEPjj5LSE y hT6żZLSe[^_UWS uhk6j]S\% 1IQS5LS e[_Uu u5LS UPjEP5LS Htj3XEUWVSlj։Ã~< uC#CNhp6%Wh6je[^_UWS]؁ ljU؍B<wH{SWhEPV }Fu @SCAt51эD9v H8 uEPh6mj: EP e[_UWVS1ۃ ׉EU؉IQR5LS }I 9tjXEe[^_USU x&Ruh6hSo# ڸ6l]UWV1=@SSu+G \KGNy \[^_USPu uh6jP]S# ڸ]UWVS u h6j]S" ڸ\x119}+)PEP5LS jXэe[^_U=@Su6q@SUVSu uVh7hS4" ډ@S*e[^U\s]UWVS u Vhk6j]S! 1IQS5LS Vu5LS (\s e[^_ÐUU=VS։uP茟P@YuM tt&u/Sh 7=u Sh'7h u Sh\g XZ1e[^U{ PhB75腮 \ vt5hM7 5h\7( XZj+ UWVSj/u 6Dž\DžXR 1[ZuhST| ZYt h7S7| Y[t \1dtjU At,at2ktn ht`ltJst9w=un=w\P=t6@Dž\9DžX-M&K=umh7Vu 'p=4Dž`tzkh7s _ZuXhs z ZYuEt Dž`)=37t=Py Ph7 xu >u>1ҋ t Dž`2=\u)=67t=Phy Ph7詢 맃Xu \EDžLDžPDžDDžHz KTtMt"Džp DžpDžl pPlP'r^_hPEPh7Džh= @u h7]Xt@ph7j tS h7lSlh7h7蠡 1jjdPhEP|BREPDžd @}t h8jb Tm4pVP884xV^ Ej:P|IK [_t<|xEPEPj|m }u hb8` YC]jjj(PtEuZh|8j@]S ] PS趙 8uu tPh8^ [_k 8u t h8A_ Y5]S:_ZtSh8Y^ jPjj=\tP(Ph8ʛ } ]}h8jhxP u h8<YFX> EECuujh8puh)jS t%h8Sժ_ZPxh:^ jtA5\ux 5\ uuxh8] G |zP PRCSP 1ҍe[^_UWVS]1u uYE1{ET{=Uw6t=w 6ujjEP >G ~1e[^_UVSSS]SuVjZYujSjju"jjVjujjjVe[^UWVSHuVÅX1эA |/u HVb_uoj@VG ZYV)PBPh 9hW* 1эA/uHƄ荅P_t.jjVjjjVjPVZYtVh(9fPV4 Y_tVK%=@ubVh39hWX PWc4 tWh99Z XZ9uVhB9 uVhg9F[ "u P^_uS2e[^_UWVS4Yt 1=h9j`Y heHs ^_h s ZYt&hs ^_ths ZYu~EPsd@^_tmusZYu\{QىDžXu h|jX sW uuW?1utW誉Y#1e[^_UE hPuYM Uh9h9h5 j UWVS,}] E1jEftJFt6 At!at|ttHht0nvt]ge^5DA}=]ED]4}t hjV 5DEX\h9SW Hp9Ǎut t=]t}uhzwsE_]t@1}Թh\EPjR tP 1$5]hjV t EP[OE~=iuuȍPZYuV^tEOun&}u|Ph\jU uE[(E;tu3ZYtEu UVS] 1ۋut-\$;t3Vm ZYt1=\e[^UWVS]1tz;nu{ou \1؀8t 8,uG@PmYuh|V 1.؉ @j,P/ [ZWue[^_ÐUShah:ٜ X1Zt&u ujb $h:S蜜 S ]U҉u!:RPh(:j~h UWVSh?h:m Yp[Džx]s 1҃8h:hC:j&h hjh p! 1d <#<  < hQ:Vt ÅXZtm;thhQ:V\ YXt?u NhQ:V; ƅXZt>u -j |PSr t @t |8tڸ mhwYthWCP ƃhVP ƃxǃxphcSa p e[^_UWVSVVhh:荚 YE[uh:hU:E5]~twt8CVPR _ZuPR ZYtȅu5W^S6h:u }tWShg:S E